BLASTX nr result
ID: Acanthopanax21_contig00003773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003773 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010042832.1| PREDICTED: WD-40 repeat-containing protein M... 68 5e-12 ref|XP_018719898.1| PREDICTED: WD-40 repeat-containing protein M... 69 1e-11 ref|XP_023872900.1| WD-40 repeat-containing protein MSI4-like [Q... 68 1e-11 ref|XP_022631982.1| WD-40 repeat-containing protein MSI4-like [V... 66 3e-11 emb|CDY70287.1| BnaAnng33220D [Brassica napus] 67 7e-11 gb|AAF97519.1|AF250049_1 WD-repeat protein RBAP3, partial [Zea m... 67 7e-11 ref|XP_020406626.1| WD-40 repeat-containing protein MSI4 [Zea mays] 67 8e-11 gb|AAF97518.1|AF250048_1 WD-repeat protein RBAP2, partial [Zea m... 67 9e-11 gb|ONM38799.1| WD-repeat protein RBAP2 [Zea mays] 67 1e-10 emb|CAR63185.1| SlX1/Y1 protein, partial [Silene nutans] >gi|197... 67 1e-10 gb|ESR39784.1| hypothetical protein CICLE_v10025540mg [Citrus cl... 68 1e-10 ref|XP_018453978.1| PREDICTED: WD-40 repeat-containing protein M... 68 1e-10 gb|ONM38808.1| WD-40 repeat-containing protein MSI4, partial [Ze... 67 1e-10 ref|XP_023872729.1| WD-40 repeat-containing protein MSI4-like [Q... 68 1e-10 gb|OAY79042.1| WD-40 repeat-containing protein MSI4 [Ananas como... 68 2e-10 ref|XP_024036605.1| WD-40 repeat-containing protein MSI4 isoform... 68 2e-10 gb|OMO91653.1| hypothetical protein COLO4_18197 [Corchorus olito... 68 2e-10 gb|PKI43968.1| hypothetical protein CRG98_035644 [Punica granatum] 68 2e-10 gb|POF03201.1| wd-40 repeat-containing protein msi4 [Quercus suber] 68 2e-10 gb|KCW53596.1| hypothetical protein EUGRSUZ_J02866 [Eucalyptus g... 68 2e-10 >ref|XP_010042832.1| PREDICTED: WD-40 repeat-containing protein MSI4-like, partial [Eucalyptus grandis] Length = 114 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114 >ref|XP_018719898.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Eucalyptus grandis] Length = 177 Score = 68.9 bits (167), Expect = 1e-11 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGEACTFSSL 314 VKPRVAA EHISQFNEEARSP VKKFKTI+HPGE SL Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIVHPGEVTHLLSL 121 >ref|XP_023872900.1| WD-40 repeat-containing protein MSI4-like [Quercus suber] Length = 147 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114 >ref|XP_022631982.1| WD-40 repeat-containing protein MSI4-like [Vigna radiata var. radiata] Length = 120 Score = 66.2 bits (160), Expect = 3e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGEACTFSSL 314 VKPRV AVEHISQFNEE++SP VKKFKTI+HPGE SL Sbjct: 78 VKPRVVAVEHISQFNEESQSPFVKKFKTILHPGEGVKIYSL 118 >emb|CDY70287.1| BnaAnng33220D [Brassica napus] Length = 183 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTIIHPGE Sbjct: 117 VKPRVAAAEHISQFNEEARSPFVKKYKTIIHPGE 150 >gb|AAF97519.1|AF250049_1 WD-repeat protein RBAP3, partial [Zea mays] Length = 168 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTI+HPGE Sbjct: 68 VKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGE 101 >ref|XP_020406626.1| WD-40 repeat-containing protein MSI4 [Zea mays] Length = 178 Score = 66.6 bits (161), Expect = 8e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTI+HPGE Sbjct: 72 VKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGE 105 >gb|AAF97518.1|AF250048_1 WD-repeat protein RBAP2, partial [Zea mays] Length = 182 Score = 66.6 bits (161), Expect = 9e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTI+HPGE Sbjct: 80 VKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGE 113 >gb|ONM38799.1| WD-repeat protein RBAP2 [Zea mays] Length = 186 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTI+HPGE Sbjct: 80 VKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGE 113 >emb|CAR63185.1| SlX1/Y1 protein, partial [Silene nutans] emb|CAR63187.1| SlX1/Y1 protein, partial [Silene nutans] emb|CAR63189.1| SlX1/Y1 protein, partial [Silene nutans] Length = 218 Score = 67.0 bits (162), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP V+KFKTIIHPGE Sbjct: 17 VKPRVAAAEHISQFNEEARSPFVRKFKTIIHPGE 50 >gb|ESR39784.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] Length = 326 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114 >ref|XP_018453978.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Raphanus sativus] Length = 347 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 124 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 157 >gb|ONM38808.1| WD-40 repeat-containing protein MSI4, partial [Zea mays] Length = 206 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKK+KTI+HPGE Sbjct: 88 VKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGE 121 >ref|XP_023872729.1| WD-40 repeat-containing protein MSI4-like [Quercus suber] Length = 377 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114 >gb|OAY79042.1| WD-40 repeat-containing protein MSI4 [Ananas comosus] Length = 403 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 19 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 52 >ref|XP_024036605.1| WD-40 repeat-containing protein MSI4 isoform X3 [Citrus clementina] Length = 407 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 99 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 132 >gb|OMO91653.1| hypothetical protein COLO4_18197 [Corchorus olitorius] Length = 408 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 80 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 113 >gb|PKI43968.1| hypothetical protein CRG98_035644 [Punica granatum] Length = 417 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114 >gb|POF03201.1| wd-40 repeat-containing protein msi4 [Quercus suber] Length = 424 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 42 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 75 >gb|KCW53596.1| hypothetical protein EUGRSUZ_J02866 [Eucalyptus grandis] Length = 437 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 436 VKPRVAAVEHISQFNEEARSPLVKKFKTIIHPGE 335 VKPRVAA EHISQFNEEARSP VKKFKTIIHPGE Sbjct: 81 VKPRVAAAEHISQFNEEARSPFVKKFKTIIHPGE 114