BLASTX nr result
ID: Acanthopanax21_contig00003682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003682 (634 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020423565.1| leucine-rich repeat extensin-like protein 4 ... 67 3e-09 >ref|XP_020423565.1| leucine-rich repeat extensin-like protein 4 isoform X1 [Prunus persica] Length = 833 Score = 67.0 bits (162), Expect = 3e-09 Identities = 49/112 (43%), Positives = 56/112 (50%), Gaps = 4/112 (3%) Frame = -3 Query: 632 HPQYTYLHRHQFITTPHLHHRLHRQFTIIHHHRHPQFTTIXXXXXXXXXXXXXHVKILPH 453 HPQ+ ++ RH I H HHR HR TI H HR F T+ H Sbjct: 702 HPQF-HVKRHHLIH--HHHHRRHRFTTIPHPHR---FLTV-------------------H 736 Query: 452 PRRSS-MGAHHLHLQYMKGHCRQSSEFHTHL--HHPHLSIDSFSDF-PLTFP 309 RR M AH L L YM+ HC S EFHT L HHP + DSF +F PLTFP Sbjct: 737 QRRQLFMKAHRLPLLYMRAHCHPSLEFHTRLLRHHPSID-DSFENFPPLTFP 787