BLASTX nr result
ID: Acanthopanax21_contig00003541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003541 (667 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP07461.1| hypothetical protein CCACVL1_01298 [Corchorus cap... 66 3e-11 gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 56 3e-07 ref|YP_001152105.1| ORF66a [Pinus koraiensis] >gi|145048732|gb|A... 52 8e-06 >gb|OMP07461.1| hypothetical protein CCACVL1_01298 [Corchorus capsularis] gb|OMP14090.1| ATP synthase subunit a chloroplastic [Corchorus olitorius] Length = 31 Score = 65.9 bits (159), Expect = 3e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 386 MTGFEPVTFCTQNKGATKLRYIPFNWSTVSL 294 MTGFEPVTFCTQNK ATKLRYIPFNWST+SL Sbjct: 1 MTGFEPVTFCTQNKRATKLRYIPFNWSTMSL 31 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 318 RDVAQLGSAFVLGTKCHWFKSCHPY 392 RDVAQLGSAFVLGTKCH FKSCHPY Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPY 25 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gb|ABP35351.1| ORF66a (chloroplast) [Pinus koraiensis] Length = 66 Score = 52.4 bits (124), Expect = 8e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 312 IERDVAQLGSAFVLGTKCHWFKSCHPY 392 I RDVAQLGS FVLGTKC FKSCHPY Sbjct: 2 IRRDVAQLGSVFVLGTKCRRFKSCHPY 28