BLASTX nr result
ID: Acanthopanax21_contig00003457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003457 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021757760.1| pentatricopeptide repeat-containing protein ... 67 4e-10 ref|XP_021718480.1| pentatricopeptide repeat-containing protein ... 67 5e-10 gb|KNA06377.1| hypothetical protein SOVF_181600 [Spinacia oleracea] 66 7e-10 ref|XP_021852090.1| pentatricopeptide repeat-containing protein ... 66 7e-10 ref|XP_007046988.2| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily p... 65 1e-09 ref|XP_021300988.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 64 3e-09 ref|XP_010680824.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-09 ref|XP_017249594.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-09 dbj|GAY42739.1| hypothetical protein CUMW_069210 [Citrus unshiu] 63 1e-08 ref|XP_004300620.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-08 gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sin... 62 2e-08 ref|XP_006425713.1| pentatricopeptide repeat-containing protein ... 62 2e-08 ref|XP_015890196.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-08 ref|XP_022775298.1| pentatricopeptide repeat-containing protein ... 60 7e-08 ref|XP_021911974.1| pentatricopeptide repeat-containing protein ... 60 7e-08 ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-08 ref|XP_016735240.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-08 ref|XP_024182770.1| pentatricopeptide repeat-containing protein ... 60 7e-08 gb|PPR88938.1| hypothetical protein GOBAR_AA31743 [Gossypium bar... 60 8e-08 >ref|XP_021757760.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Chenopodium quinoa] Length = 405 Score = 67.0 bits (162), Expect = 4e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLV +N+KDA LIRT+K+KFP N+LNAWKKVE ELGLV+ Sbjct: 347 LVEGLVAKNNKKDAKGLIRTVKKKFPPNVLNAWKKVEVELGLVS 390 >ref|XP_021718480.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Chenopodium quinoa] Length = 405 Score = 66.6 bits (161), Expect = 5e-10 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLV +N+KDA LIRT+K+KFP N+LNAWKK+E ELGLV+ Sbjct: 347 LVEGLVAKNNKKDAKGLIRTVKKKFPPNVLNAWKKIEVELGLVS 390 >gb|KNA06377.1| hypothetical protein SOVF_181600 [Spinacia oleracea] Length = 415 Score = 66.2 bits (160), Expect = 7e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLV+ NRKDA LIRT+K+KFP N+LNAWKK+E ELGL + Sbjct: 357 LVEGLVEKKNRKDAKGLIRTVKKKFPSNVLNAWKKLEVELGLAS 400 >ref|XP_021852090.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Spinacia oleracea] Length = 416 Score = 66.2 bits (160), Expect = 7e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLV+ NRKDA LIRT+K+KFP N+LNAWKK+E ELGL + Sbjct: 358 LVEGLVEKKNRKDAKGLIRTVKKKFPSNVLNAWKKLEVELGLAS 401 >ref|XP_007046988.2| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Theobroma cacao] Length = 411 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLVK K+A LIRT+K+KFP N LNAWKK+EEELGLV+G Sbjct: 352 LVEGLVKNKKIKEAKGLIRTVKKKFPPNFLNAWKKLEEELGLVSG 396 >gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLVK K+A LIRT+K+KFP N LNAWKK+EEELGLV+G Sbjct: 352 LVEGLVKNKKIKEAKGLIRTVKKKFPPNFLNAWKKLEEELGLVSG 396 >ref|XP_021300988.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Herrania umbratica] Length = 411 Score = 64.3 bits (155), Expect = 3e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLVK K+A LIRT+K+KFP N LNAWKK+EE+LGLV+G Sbjct: 352 LVEGLVKKKKIKEAKGLIRTVKKKFPPNFLNAWKKLEEKLGLVSG 396 >ref|XP_010680824.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Beta vulgaris subsp. vulgaris] gb|KMT09063.1| hypothetical protein BVRB_6g137640 [Beta vulgaris subsp. vulgaris] Length = 401 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGL 304 LVEGLV + RKDA LIRT+K+KFP N+LNAWKKVE ELGL Sbjct: 343 LVEGLVAKNERKDAKGLIRTVKKKFPPNVLNAWKKVELELGL 384 >ref|XP_017249594.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Daucus carota subsp. sativus] gb|KZM94002.1| hypothetical protein DCAR_017247 [Daucus carota subsp. sativus] Length = 418 Score = 63.2 bits (152), Expect = 8e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLVK SN+KDA LIRTL++KFP+ IL AW +VE ELGL++ Sbjct: 362 LVEGLVKKSNKKDAKGLIRTLRKKFPQKILKAWDQVEVELGLIS 405 >dbj|GAY42739.1| hypothetical protein CUMW_069210 [Citrus unshiu] Length = 403 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLVK K+A +IRT+K+KFP N+L AWKKVEEELGLV+ Sbjct: 348 LVEGLVKKKKIKEAKGVIRTIKKKFPPNVLRAWKKVEEELGLVS 391 >ref|XP_004300620.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Fragaria vesca subsp. vesca] Length = 461 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLV 301 L EGL+K + RK+A LIRT+K+KFP N+LNAWKKVEE LGLV Sbjct: 345 LAEGLMKKNMRKEAKGLIRTVKKKFPPNVLNAWKKVEEGLGLV 387 >gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLV 301 LVEGLVK K+A +IRT+K+KFP N+L AWKKVEEELGLV Sbjct: 348 LVEGLVKKKKIKEAKGVIRTIKKKFPPNVLRAWKKVEEELGLV 390 >ref|XP_006425713.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Citrus clementina] ref|XP_006466769.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Citrus sinensis] gb|ESR38953.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLV 301 LVEGLVK K+A +IRT+K+KFP N+L AWKKVEEELGLV Sbjct: 348 LVEGLVKKKKIKEAKGVIRTIKKKFPPNVLRAWKKVEEELGLV 390 >ref|XP_015890196.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Ziziphus jujuba] Length = 412 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLVK K+A LIRT+K+KFP N+LN+WKKVEE LGL + Sbjct: 353 LVEGLVKKKKIKEAKGLIRTIKKKFPPNVLNSWKKVEESLGLAS 396 >ref|XP_022775298.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Durio zibethinus] Length = 404 Score = 60.5 bits (145), Expect = 7e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVN 298 LVEGLVK K+A LIRT+K+KFP N LNAWKK+E ELGLV+ Sbjct: 353 LVEGLVKNKKIKEAKGLIRTVKKKFPPNFLNAWKKLEVELGLVS 396 >ref|XP_021911974.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Carica papaya] Length = 408 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGL 304 LVEGLVK K+A LIRT+K+KFP N+LNAWKKVEE L L Sbjct: 352 LVEGLVKKEKTKEAKGLIRTMKKKFPPNLLNAWKKVEENLSL 393 >ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] gb|KJB48422.1| hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 60.5 bits (145), Expect = 7e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLV KDA LIRT+K+ FP N L AWKK+EEELGLV+G Sbjct: 352 LVEGLVMKKKIKDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSG 396 >ref|XP_016735240.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 409 Score = 60.5 bits (145), Expect = 7e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLV KDA LIRT+K+ FP N L AWKK+EEELGLV+G Sbjct: 353 LVEGLVMKKKIKDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSG 397 >ref|XP_024182770.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Rosa chinensis] gb|PRQ47651.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 462 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLV 301 L EGL+K + RK+A LIRT+K+KFP N++NAWK+VEE LGLV Sbjct: 346 LAEGLMKKNMRKEAKGLIRTVKKKFPPNVVNAWKRVEEGLGLV 388 >gb|PPR88938.1| hypothetical protein GOBAR_AA31743 [Gossypium barbadense] Length = 913 Score = 60.5 bits (145), Expect = 8e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 429 LVEGLVKMSNRKDAIALIRTLKEKFPRNILNAWKKVEEELGLVNG 295 LVEGLV KDA LIRT+K+ FP N L AWKK+EEELGLV+G Sbjct: 855 LVEGLVMKKKIKDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSG 899