BLASTX nr result
ID: Acanthopanax21_contig00003409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003409 (587 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073495475.1| hypothetical protein, partial [Enterococcus ... 57 2e-07 ref|WP_073470631.1| hypothetical protein [Enterococcus faecium] 57 2e-07 ref|WP_072539067.1| hypothetical protein [Enterococcus faecium] 55 5e-07 ref|WP_080491688.1| 50S ribosomal protein L6 [Enterococcus faecium] 55 7e-07 ref|WP_073495484.1| hypothetical protein [Enterococcus faecalis] 55 7e-07 ref|WP_073990025.1| hypothetical protein [Enterococcus faecium] 55 9e-07 ref|WP_073994929.1| hypothetical protein [Enterococcus faecium] 55 1e-06 ref|WP_072539064.1| hypothetical protein [Enterococcus faecium] 55 1e-06 ref|WP_080489832.1| hypothetical protein [Enterococcus faecium] 54 1e-06 ref|WP_073459378.1| hypothetical protein [Enterococcus faecalis] 54 1e-06 ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073981350.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073459383.1| hypothetical protein [Enterococcus faecalis] 54 2e-06 ref|WP_082197626.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_075881626.1| hypothetical protein [Halomonas sp. Marseill... 54 2e-06 ref|WP_073990122.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073495673.1| hypothetical protein [Enterococcus faecalis] 54 3e-06 ref|WP_073495536.1| hypothetical protein [Enterococcus faecalis] 54 3e-06 ref|WP_072539053.1| hypothetical protein [Enterococcus faecium] 54 3e-06 ref|WP_073470604.1| hypothetical protein [Enterococcus faecium] 54 3e-06 >ref|WP_073495475.1| hypothetical protein, partial [Enterococcus faecalis] Length = 77 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 126 HLVRSCIYKKNDII*SQLFFFFLMIRRPPRSTLFPYTTLFRS 1 HL S +Y + + + FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 7 HLHSSSVYTISSLFCNSSSFFFLMIRRPPRSTLFPYTTLFRS 48 >ref|WP_073470631.1| hypothetical protein [Enterococcus faecium] Length = 87 Score = 56.6 bits (135), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 123 LVRSCIYKKNDII*SQLFFFFLMIRRPPRSTLFPYTTLFRS 1 L+RSC K I +FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 2 LIRSCY--KIHIQPVLIFFFFLMIRRPPRSTLFPYTTLFRS 40 >ref|WP_072539067.1| hypothetical protein [Enterococcus faecium] Length = 79 Score = 55.5 bits (132), Expect = 5e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 75 LFFFFLMIRRPPRSTLFPYTTLFRS 1 LFFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 8 LFFFFLMIRRPPRSTLFPYTTLFRS 32 >ref|WP_080491688.1| 50S ribosomal protein L6 [Enterococcus faecium] Length = 89 Score = 55.5 bits (132), Expect = 7e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 75 LFFFFLMIRRPPRSTLFPYTTLFRS 1 LFFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 24 LFFFFLMIRRPPRSTLFPYTTLFRS 48 >ref|WP_073495484.1| hypothetical protein [Enterococcus faecalis] Length = 78 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 81 SQLFFFFLMIRRPPRSTLFPYTTLFRS 1 ++L+FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 8 NRLYFFFLMIRRPPRSTLFPYTTLFRS 34 >ref|WP_073990025.1| hypothetical protein [Enterococcus faecium] Length = 87 Score = 55.1 bits (131), Expect = 9e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 78 QLFFFFLMIRRPPRSTLFPYTTLFRS 1 ++FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 23 KIFFFFLMIRRPPRSTLFPYTTLFRS 48 >ref|WP_073994929.1| hypothetical protein [Enterococcus faecium] Length = 82 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 75 LFFFFLMIRRPPRSTLFPYTTLFRS 1 +FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 13 IFFFFLMIRRPPRSTLFPYTTLFRS 37 >ref|WP_072539064.1| hypothetical protein [Enterococcus faecium] Length = 86 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 75 LFFFFLMIRRPPRSTLFPYTTLFRS 1 +FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 1 MFFFFLMIRRPPRSTLFPYTTLFRS 25 >ref|WP_080489832.1| hypothetical protein [Enterococcus faecium] Length = 65 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 3 FFFFLMIRRPPRSTLFPYTTLFRS 26 >ref|WP_073459378.1| hypothetical protein [Enterococcus faecalis] Length = 65 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 32 FFFFLMIRRPPRSTLFPYTTLFRS 55 >ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] Length = 69 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 10 FFFFLMIRRPPRSTLFPYTTLFRS 33 >ref|WP_073981350.1| hypothetical protein [Enterococcus faecium] Length = 73 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 4 FFFFLMIRRPPRSTLFPYTTLFRS 27 >ref|WP_073459383.1| hypothetical protein [Enterococcus faecalis] Length = 74 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 12 FFFFLMIRRPPRSTLFPYTTLFRS 35 >ref|WP_082197626.1| hypothetical protein [Enterococcus faecium] Length = 79 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 9 FFFFLMIRRPPRSTLFPYTTLFRS 32 >ref|WP_075881626.1| hypothetical protein [Halomonas sp. Marseille-P2426] Length = 80 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 23 FFFFLMIRRPPRSTLFPYTTLFRS 46 >ref|WP_073990122.1| hypothetical protein [Enterococcus faecium] Length = 85 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 13 FFFFLMIRRPPRSTLFPYTTLFRS 36 >ref|WP_073495673.1| hypothetical protein [Enterococcus faecalis] Length = 90 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 5 FFFFLMIRRPPRSTLFPYTTLFRS 28 >ref|WP_073495536.1| hypothetical protein [Enterococcus faecalis] Length = 106 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 75 LFFFFLMIRRPPRSTLFPYTTLFRS 1 L+FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 22 LYFFFLMIRRPPRSTLFPYTTLFRS 46 >ref|WP_072539053.1| hypothetical protein [Enterococcus faecium] Length = 106 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 105 YKKNDII*SQLFFFFLMIRRPPRSTLFPYTTLFRS 1 Y+ + I+ FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 4 YRSSHIL---FFFFFLMIRRPPRSTLFPYTTLFRS 35 >ref|WP_073470604.1| hypothetical protein [Enterococcus faecium] Length = 93 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 72 FFFFLMIRRPPRSTLFPYTTLFRS 1 FFFFLMIRRPPRSTLFPYTTLFRS Sbjct: 6 FFFFLMIRRPPRSTLFPYTTLFRS 29