BLASTX nr result
ID: Acanthopanax21_contig00003278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003278 (881 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516853.1| hypothetical protein GlmaxMp03 (mitochondrio... 72 9e-12 gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 71 9e-11 gb|EYU25691.1| hypothetical protein MIMGU_mgv1a018587mg, partial... 65 7e-10 gb|AIE42561.1| hypothetical protein RadishMT_p030 (mitochondrion... 64 3e-09 ref|YP_717108.1| hypothetical protein BrnapMp009 [Brassica napus... 64 4e-09 ref|YP_004927580.1| orf106a (mitochondrion) [Brassica carinata] ... 64 4e-09 ref|YP_004927474.1| orf106a (mitochondrion) [Brassica oleracea] ... 64 4e-09 gb|AGC81682.1| hypothetical protein DCGMS_00220 (mitochondrion) ... 64 4e-09 gb|AGY62829.1| orf123b (mitochondrion) [Eruca vesicaria subsp. s... 63 8e-09 ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 46 2e-06 >ref|YP_007516853.1| hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] gb|AFR34334.1| hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] Length = 150 Score = 72.0 bits (175), Expect = 9e-12 Identities = 38/65 (58%), Positives = 40/65 (61%), Gaps = 11/65 (16%) Frame = +1 Query: 715 IC*LQRHIKVTGFEPMALCTQNRCADQTALHLVSPP-----------RSI*IHPIDEHSN 861 +C HIKVTGFEPMALCTQNRCADQTALHLVSPP R+ HP Sbjct: 53 LCTSALHIKVTGFEPMALCTQNRCADQTALHLVSPPSAYRSTRSMKTRTELAHPFGHRDA 112 Query: 862 RTRPS 876 RT PS Sbjct: 113 RTNPS 117 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 71.2 bits (173), Expect = 9e-11 Identities = 37/59 (62%), Positives = 38/59 (64%), Gaps = 11/59 (18%) Frame = +1 Query: 733 HIKVTGFEPMALCTQNRCADQTALHLVSPP-----------RSI*IHPIDEHSNRTRPS 876 HIKVTGFEPMALCTQNRCADQTALHLVSPP R+ HP RT PS Sbjct: 2 HIKVTGFEPMALCTQNRCADQTALHLVSPPEAYRSARSMNTRTELAHPFGHRGARTNPS 60 >gb|EYU25691.1| hypothetical protein MIMGU_mgv1a018587mg, partial [Erythranthe guttata] Length = 90 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +2 Query: 782 DALTRLRYTSSHHPGAYRSTRSMNTQTELAHPF 880 DALTRL YTSSHHPGAYR TRSM TQTELAHPF Sbjct: 2 DALTRLPYTSSHHPGAYRFTRSMKTQTELAHPF 34 >gb|AIE42561.1| hypothetical protein RadishMT_p030 (mitochondrion) [Raphanus sativus] Length = 94 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 821 GGETRCSAVWSAHLFWVQRAIGSNPVTLM 735 G ETRCSAVWSAHLFWVQRAIGSNPVTLM Sbjct: 51 GSETRCSAVWSAHLFWVQRAIGSNPVTLM 79 >ref|YP_717108.1| hypothetical protein BrnapMp009 [Brassica napus] dbj|BAC98856.1| hypothetical protein (mitochondrion) [Brassica napus] Length = 106 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 821 GGETRCSAVWSAHLFWVQRAIGSNPVTLM 735 G ETRCSAVWSAHLFWVQRAIGSNPVTLM Sbjct: 54 GSETRCSAVWSAHLFWVQRAIGSNPVTLM 82 >ref|YP_004927580.1| orf106a (mitochondrion) [Brassica carinata] ref|YP_009228124.1| hypothetical protein AYB38_gp24 (mitochondrion) [Brassica nigra] gb|AEH43595.1| orf106a (mitochondrion) [Brassica carinata] gb|AJD85476.1| hypothetical protein BniMp054 (mitochondrion) [Brassica nigra] Length = 106 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 821 GGETRCSAVWSAHLFWVQRAIGSNPVTLM 735 G ETRCSAVWSAHLFWVQRAIGSNPVTLM Sbjct: 54 GSETRCSAVWSAHLFWVQRAIGSNPVTLM 82 >ref|YP_004927474.1| orf106a (mitochondrion) [Brassica oleracea] gb|AEH43502.1| orf106a (mitochondrion) [Brassica oleracea] Length = 106 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 821 GGETRCSAVWSAHLFWVQRAIGSNPVTLM 735 G ETRCSAVWSAHLFWVQRAIGSNPVTLM Sbjct: 54 GSETRCSAVWSAHLFWVQRAIGSNPVTLM 82 >gb|AGC81682.1| hypothetical protein DCGMS_00220 (mitochondrion) [Raphanus sativus] Length = 108 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 821 GGETRCSAVWSAHLFWVQRAIGSNPVTLM 735 G ETRCSAVWSAHLFWVQRAIGSNPVTLM Sbjct: 51 GSETRCSAVWSAHLFWVQRAIGSNPVTLM 79 >gb|AGY62829.1| orf123b (mitochondrion) [Eruca vesicaria subsp. sativa] Length = 123 Score = 63.2 bits (152), Expect = 8e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 727 QRHIKVTGFEPMALCTQNRCADQTALHLVSPPRS 828 +++IKVTGFEPMALCTQNRCADQTALHLVS P + Sbjct: 80 KKYIKVTGFEPMALCTQNRCADQTALHLVSLPEA 113 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] ref|YP_004222346.1| hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842151.1| hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] dbj|BAA99498.1| orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] emb|CBJ14076.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ17566.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ20714.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX24956.1| hypothetical protein (mitochondrion) [Beta macrocarpa] emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 760 MALCTQNRCADQTALHLVSP 819 MALCTQNRCADQTALHLVSP Sbjct: 1 MALCTQNRCADQTALHLVSP 20 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 827 AYRSTRSMNTQTELAHPF 880 AYRSTRS+ T+TELAHPF Sbjct: 23 AYRSTRSIKTRTELAHPF 40