BLASTX nr result
ID: Acanthopanax21_contig00003196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003196 (555 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM80793.1| hypothetical protein DCAR_031659 [Daucus carota s... 54 1e-10 ref|YP_173442.1| hypothetical protein NitaMp104 [Nicotiana tabac... 59 8e-08 >gb|KZM80793.1| hypothetical protein DCAR_031659 [Daucus carota subsp. sativus] Length = 103 Score = 53.9 bits (128), Expect(2) = 1e-10 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 316 FFHQCWPSRGSSMPNPNGKTFD 251 FFHQCWPSRGSSMPNPNGK FD Sbjct: 46 FFHQCWPSRGSSMPNPNGKPFD 67 Score = 40.0 bits (92), Expect(2) = 1e-10 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 201 GGLALFLNSSLKFSGFHR 148 GGLALFLNSSLKFSGFHR Sbjct: 86 GGLALFLNSSLKFSGFHR 103 >ref|YP_173442.1| hypothetical protein NitaMp104 [Nicotiana tabacum] dbj|BAD83507.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 118 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 451 PKQNELLSLERKECREQLFPFRWFLKAINPRFS 549 P Q L LERKECRE++FPF WFLKAINPRFS Sbjct: 78 PAQTNFLFLERKECREEVFPFHWFLKAINPRFS 110