BLASTX nr result
ID: Acanthopanax21_contig00003187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003187 (1247 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON49855.1| hypothetical protein PanWU01x14_227540, partial [... 58 2e-06 >gb|PON49855.1| hypothetical protein PanWU01x14_227540, partial [Parasponia andersonii] Length = 154 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = -1 Query: 1022 KEEAIIKLEQLFLKDWDNIEEFCKHYVHYCVISGNDYNPEFGEKLFRKLPGPLGELIRE 846 ++EA+ KLEQ+ L DW I F ++HY S N YN E KL KLPGPLG I+E Sbjct: 62 QKEAMRKLEQIKLNDWRKIVPFLTEFIHYATKSQNTYNKEVMNKLLLKLPGPLGIEIQE 120