BLASTX nr result
ID: Acanthopanax21_contig00003123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003123 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM45565.1| hypothetical protein ABT39_MTgene2400 (mitochondr... 100 9e-33 >gb|KUM45565.1| hypothetical protein ABT39_MTgene2400 (mitochondrion) [Picea glauca] gb|KUM45572.1| hypothetical protein ABT39_MTgene2407 (mitochondrion) [Picea glauca] gb|KUM46366.1| hypothetical protein ABT39_MTgene1465 (mitochondrion) [Picea glauca] gb|KUM47451.1| hypothetical protein ABT39_MTgene5637 (mitochondrion) [Picea glauca] Length = 152 Score = 100 bits (249), Expect(2) = 9e-33 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = -1 Query: 314 DWFSYSSIPGEKESALLLPIFIASSSDLRVRLGDIFFLAQSLSPDLDSTGKKNYRVR 144 DWFSYSSIPGEKES LLL IFIASSSDLRVRLGDIFFLAQSLSPDLDSTGK+ + +R Sbjct: 94 DWFSYSSIPGEKESQLLLQIFIASSSDLRVRLGDIFFLAQSLSPDLDSTGKRLFAMR 150 Score = 68.2 bits (165), Expect(2) = 9e-33 Identities = 39/69 (56%), Positives = 46/69 (66%), Gaps = 3/69 (4%) Frame = -3 Query: 513 KRASQDFHKKAGLGWVKPLLGTKVSHKKGLSGY*L---LPCRYYRGLLSTKSDLLTGFGK 343 K++ +++ WVKP LGTKVSHKK + LP RGLLSTK+DLLTGFGK Sbjct: 25 KKSKPRLSQESWTWWVKPPLGTKVSHKKQGAKRVFTPPLPLLPARGLLSTKADLLTGFGK 84 Query: 342 AYKDYSKTM 316 AY DYSKTM Sbjct: 85 AYLDYSKTM 93