BLASTX nr result
ID: Acanthopanax21_contig00002360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00002360 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNR28613.1| hypothetical protein PHYPA_029205 [Physcomitrella... 40 6e-06 ref|XP_001779566.1| predicted protein [Physcomitrella patens] 40 6e-06 >gb|PNR28613.1| hypothetical protein PHYPA_029205 [Physcomitrella patens] Length = 576 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -1 Query: 156 FDADLFSTESYFLDKIVRQSRSSCLLDVQHDLTALK 49 F + S ESY LD+++ +S++ LLDVQHD+ ALK Sbjct: 138 FTPGMESDESYSLDEVIYRSKTGALLDVQHDMEALK 173 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 50 KTT*PYGSGIWSKKEW 3 KTT PYGSG+WSKKEW Sbjct: 191 KTTWPYGSGVWSKKEW 206 >ref|XP_001779566.1| predicted protein [Physcomitrella patens] Length = 472 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -1 Query: 156 FDADLFSTESYFLDKIVRQSRSSCLLDVQHDLTALK 49 F + S ESY LD+++ +S++ LLDVQHD+ ALK Sbjct: 34 FTPGMESDESYSLDEVIYRSKTGALLDVQHDMEALK 69 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 50 KTT*PYGSGIWSKKEW 3 KTT PYGSG+WSKKEW Sbjct: 87 KTTWPYGSGVWSKKEW 102