BLASTX nr result
ID: Acanthopanax21_contig00001918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00001918 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN05047.1| hypothetical protein DCAR_005884 [Daucus carota s... 74 4e-12 ref|XP_017236466.1| PREDICTED: asparagine synthetase [glutamine-... 74 5e-12 ref|XP_021977900.1| asparagine synthetase [glutamine-hydrolyzing... 70 7e-11 gb|AAF74755.1| asparagine synthetase [Helianthus annuus] 70 7e-11 gb|AAB91481.1| asparagine synthetase, partial [Helianthus annuus] 65 4e-10 ref|XP_019188532.1| PREDICTED: asparagine synthetase [glutamine-... 68 5e-10 ref|XP_019229709.1| PREDICTED: asparagine synthetase [glutamine-... 66 2e-09 emb|CDP09210.1| unnamed protein product [Coffea canephora] 66 2e-09 ref|XP_016513654.1| PREDICTED: asparagine synthetase [glutamine-... 64 7e-09 ref|XP_009622719.1| PREDICTED: asparagine synthetase [glutamine-... 64 7e-09 ref|XP_009766230.1| PREDICTED: asparagine synthetase [glutamine-... 64 1e-08 ref|XP_009792170.1| PREDICTED: asparagine synthetase [glutamine-... 64 1e-08 emb|CAZ65727.1| asparagine synthetase, partial [Solanum lycopers... 58 3e-08 ref|XP_022014294.1| asparagine synthetase, root [glutamine-hydro... 59 3e-08 ref|XP_018630662.1| PREDICTED: asparagine synthetase [glutamine-... 62 5e-08 ref|XP_009616367.1| PREDICTED: asparagine synthetase [glutamine-... 62 5e-08 gb|OTF92120.1| putative rossmann-like alpha/beta/alpha sandwich ... 61 8e-08 gb|PHU13781.1| Asparagine synthetase [glutamine-hydrolyzing] [Ca... 61 1e-07 gb|PHT78503.1| Asparagine synthetase [glutamine-hydrolyzing] [Ca... 61 1e-07 ref|XP_019233889.1| PREDICTED: asparagine synthetase [glutamine-... 61 1e-07 >gb|KZN05047.1| hypothetical protein DCAR_005884 [Daucus carota subsp. sativus] Length = 486 Score = 73.6 bits (179), Expect = 4e-12 Identities = 38/50 (76%), Positives = 39/50 (78%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAALGVHNSAYEKQ S NKNL IID+V RMME AP LTIRS Sbjct: 437 DPSGRAALGVHNSAYEKQLSSTVNKNLTNNIIDSVPRMMEASAPPLTIRS 486 >ref|XP_017236466.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Daucus carota subsp. sativus] Length = 589 Score = 73.6 bits (179), Expect = 5e-12 Identities = 38/50 (76%), Positives = 39/50 (78%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAALGVHNSAYEKQ S NKNL IID+V RMME AP LTIRS Sbjct: 540 DPSGRAALGVHNSAYEKQLSSTVNKNLTNNIIDSVPRMMEASAPPLTIRS 589 >ref|XP_021977900.1| asparagine synthetase [glutamine-hydrolyzing] 1 [Helianthus annuus] gb|OTG19013.1| putative asparagine synthase, glutamine-hydrolyzing, nucleophile aminohydrolase [Helianthus annuus] Length = 589 Score = 70.1 bits (170), Expect = 7e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAALGVHN+AY+K S+ + NLAP I DNV RMM++ PEL IRS Sbjct: 540 DPSGRAALGVHNAAYKKNSGSISSANLAPSIADNVPRMMDITGPELVIRS 589 >gb|AAF74755.1| asparagine synthetase [Helianthus annuus] Length = 589 Score = 70.1 bits (170), Expect = 7e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAALGVHN+AY+K S+ + NLAP I DNV RMM++ PEL IRS Sbjct: 540 DPSGRAALGVHNAAYKKNSGSISSANLAPSIADNVPRMMDITGPELVIRS 589 >gb|AAB91481.1| asparagine synthetase, partial [Helianthus annuus] Length = 134 Score = 64.7 bits (156), Expect = 4e-10 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGR ALGVHN+AY+K+ S+ LAP I DNV RMM++ PE+ IRS Sbjct: 85 DPSGRGALGVHNAAYKKKSGSISPAKLAPSIADNVPRMMDITGPEIVIRS 134 >ref|XP_019188532.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Ipomoea nil] Length = 589 Score = 67.8 bits (164), Expect = 5e-10 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIR 363 DPSGRAA+GVHNSAY+ QPP II+NV RMMEV APELTIR Sbjct: 540 DPSGRAAIGVHNSAYKNQPPPAVAATTTANIIENVPRMMEVSAPELTIR 588 >ref|XP_019229709.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Nicotiana attenuata] gb|OIT29916.1| asparagine synthetase [glutamine-hydrolyzing] 1 [Nicotiana attenuata] Length = 590 Score = 66.2 bits (160), Expect = 2e-09 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAYE P++ N NLA II V M+EVG APELTIRS Sbjct: 540 DPSGRAAIGVHNSAYENHVPAMANGNLAKKIIGRVPSMVEVGAAPELTIRS 590 >emb|CDP09210.1| unnamed protein product [Coffea canephora] Length = 606 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAA+GVHNSAYE P V N NLAP +ID+V RM+ + A ELTI+S Sbjct: 557 DPSGRAAVGVHNSAYEDLLPPVANGNLAPTMIDDVPRMVGIPAKELTIQS 606 >ref|XP_016513654.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana tabacum] Length = 590 Score = 64.3 bits (155), Expect = 7e-09 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGA-PELTIRS 360 DPSGRAA+GVHNSAY+ P V N NL IIDNV RM+ VGA ELTIRS Sbjct: 540 DPSGRAAIGVHNSAYDDHLPDVSNGNLDTTIIDNVPRMVGVGASAELTIRS 590 >ref|XP_009622719.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana tomentosiformis] Length = 590 Score = 64.3 bits (155), Expect = 7e-09 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGA-PELTIRS 360 DPSGRAA+GVHNSAY+ P V N NL IIDNV RM+ VGA ELTIRS Sbjct: 540 DPSGRAAIGVHNSAYDDHLPDVSNGNLDTTIIDNVPRMVGVGASAELTIRS 590 >ref|XP_009766230.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana sylvestris] ref|XP_016468109.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Nicotiana tabacum] Length = 590 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAY+ P V N NL IIDNV RM+ VG A ELTIRS Sbjct: 540 DPSGRAAIGVHNSAYDDHLPDVGNGNLDTTIIDNVPRMVGVGAAAELTIRS 590 >ref|XP_009792170.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Nicotiana sylvestris] ref|XP_016496738.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Nicotiana tabacum] Length = 590 Score = 63.5 bits (153), Expect = 1e-08 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAYE P++ N NL II V M+EVG APELTI+S Sbjct: 540 DPSGRAAIGVHNSAYENHVPAMANGNLTKKIIGRVPSMVEVGAAPELTIKS 590 >emb|CAZ65727.1| asparagine synthetase, partial [Solanum lycopersicum] Length = 68 Score = 57.8 bits (138), Expect = 3e-08 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAY+ V N NL II N+ RM+ VG A ELTIRS Sbjct: 18 DPSGRAAIGVHNSAYDNHLSGVANGNLDTPIISNMPRMVGVGVAAELTIRS 68 >ref|XP_022014294.1| asparagine synthetase, root [glutamine-hydrolyzing]-like, partial [Helianthus annuus] Length = 96 Score = 58.5 bits (140), Expect = 3e-08 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAPELTIRS 360 DPSGRAALGVHN+AY K S+ + NLA I++NV RMM + PE IRS Sbjct: 48 DPSGRAALGVHNAAY-KNSGSISSANLATSIVENVLRMMVITGPEFVIRS 96 >ref|XP_018630662.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like isoform X2 [Nicotiana tomentosiformis] Length = 545 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAP-ELTIRS 360 DPSGRAA+GVHNSAYE P++ N NLA II M+EVGA ELTIRS Sbjct: 495 DPSGRAAIGVHNSAYENHEPAMANGNLATKIIGRAPSMVEVGAAHELTIRS 545 >ref|XP_009616367.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016472774.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Nicotiana tabacum] Length = 590 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVGAP-ELTIRS 360 DPSGRAA+GVHNSAYE P++ N NLA II M+EVGA ELTIRS Sbjct: 540 DPSGRAAIGVHNSAYENHEPAMANGNLATKIIGRAPSMVEVGAAHELTIRS 590 >gb|OTF92120.1| putative rossmann-like alpha/beta/alpha sandwich fold protein [Helianthus annuus] Length = 293 Score = 60.8 bits (146), Expect = 8e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEV 387 DPSGRAALGVHN+AY+K P S+ + NL P I++NV RMM++ Sbjct: 248 DPSGRAALGVHNAAYKKNPGSISSANLEPSIVENVPRMMDI 288 >gb|PHU13781.1| Asparagine synthetase [glutamine-hydrolyzing] [Capsicum chinense] Length = 584 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAYE V N NL II+NV RM+ VG A ELTIRS Sbjct: 534 DPSGRAAIGVHNSAYENHLSGVANGNLNATIINNVPRMVGVGSAAELTIRS 584 >gb|PHT78503.1| Asparagine synthetase [glutamine-hydrolyzing] [Capsicum annuum] Length = 589 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAYE V N NL II+NV RM+ VG A ELTIRS Sbjct: 539 DPSGRAAIGVHNSAYENHLSGVANGNLNATIINNVPRMVGVGSAAELTIRS 589 >ref|XP_019233889.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana attenuata] gb|OIT06833.1| asparagine synthetase [glutamine-hydrolyzing] 1 [Nicotiana attenuata] Length = 590 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 509 DPSGRAALGVHNSAYEKQPPSVPNKNLAPMIIDNVSRMMEVG-APELTIRS 360 DPSGRAA+GVHNSAY+ P V N L IIDNV RM+ VG A ELTIRS Sbjct: 540 DPSGRAAIGVHNSAYDDHLPDVGNGYLDTTIIDNVPRMVGVGAAAELTIRS 590