BLASTX nr result
ID: Acanthopanax21_contig00001726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00001726 (748 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE44655.1| hypothetical protein CFP56_77598 [Quercus suber] 165 3e-47 >gb|POE44655.1| hypothetical protein CFP56_77598 [Quercus suber] Length = 219 Score = 165 bits (418), Expect = 3e-47 Identities = 82/85 (96%), Positives = 83/85 (97%) Frame = +3 Query: 432 EETYSLHDPDDRGYSLMSLGIFRVMTMALSGYTTRVIRGTLVMMMITFTLTLDARPGVDP 611 EETYSLHDPDDRG LMSLGIFRVMTMALSGYTTRVIRGTLVMMM+TFTLTLDARPGVDP Sbjct: 69 EETYSLHDPDDRG--LMSLGIFRVMTMALSGYTTRVIRGTLVMMMMTFTLTLDARPGVDP 126 Query: 612 WFLDESGTPRYSYDHVIESEQSDTE 686 WFLDESGTPRYSYDHVIESEQSDTE Sbjct: 127 WFLDESGTPRYSYDHVIESEQSDTE 151 Score = 86.7 bits (213), Expect = 7e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 109 GAHKGAHRSIMNYPPLPDVPISILLIRRELRSVHKNDDEP 228 GAHKGAHRSIMNYPPLPDVPISILLIRRELRSVHKNDDEP Sbjct: 28 GAHKGAHRSIMNYPPLPDVPISILLIRRELRSVHKNDDEP 67