BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Acanthopanax21_contig00001571
         (538 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|WP_001393454.1| MULTISPECIES: nucleotide exchange factor Grp...   344   e-119
ref|WP_087605267.1| nucleotide exchange factor GrpE, partial [Es...   343   e-119
ref|WP_065405673.1| nucleotide exchange factor GrpE, partial [Sh...   343   e-119
ref|WP_065406221.1| nucleotide exchange factor GrpE, partial [Sh...   343   e-119
ref|WP_087604965.1| nucleotide exchange factor GrpE, partial [Es...   343   e-119
ref|WP_096841622.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_087683308.1| nucleotide exchange factor GrpE, partial [Es...   343   e-119
ref|WP_001300112.1| MULTISPECIES: nucleotide exchange factor Grp...   343   e-119
ref|WP_105456666.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_097346495.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_097368706.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_096886128.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_001301442.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_001296310.1| MULTISPECIES: nucleotide exchange factor Grp...   343   e-119
ref|WP_053271178.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
gb|ODQ13691.1| nucleotide exchange factor GrpE [Shigella sp. FC569]   343   e-119
ref|WP_021578969.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_001701929.1| nucleotide exchange factor GrpE [Escherichia...   343   e-119
ref|WP_001332400.1| MULTISPECIES: nucleotide exchange factor Grp...   343   e-119
gb|OSK84778.1| co-chaperone GrpE [Escherichia coli B367]              343   e-119

>ref|WP_001393454.1| MULTISPECIES: nucleotide exchange factor GrpE [Proteobacteria]
 ref|NP_417104.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 sp|P09372.1|GRPE_ECOLI RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor; AltName:
           Full=HSP24; AltName: Full=Heat shock protein B25.3
 sp|B1XBT4.1|GRPE_ECODH RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|C4ZYN1.1|GRPE_ECOBW RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 emb|CAA30711.1| unnamed protein product [Escherichia coli]
 gb|AAB32515.1| GrpE=heat shock protein [Escherichia coli, mutant grpE25, Peptide
           Mutant, 197 aa]
 gb|AAC75663.1| heat shock protein [Escherichia coli str. K-12 substr. MG1655]
 dbj|BAA16498.1| heat shock protein [Escherichia coli str. K-12 substr. W3110]
 gb|ACB03758.1| heat shock protein [Escherichia coli str. K-12 substr. DH10B]
 gb|ACR63401.1| heat shock protein [Escherichia coli BW2952]
 gb|ACX38735.1| Ribulose-phosphate 3-epimerase [Escherichia coli DH1]
 dbj|BAJ44390.1| heat shock protein HSP70 cofactor [Escherichia coli DH1]
 gb|EGU28237.1| heat shock protein HSP70 cofactor [Escherichia coli XH140A]
 gb|EGV46352.1| heat shock protein HSP70 cofactor [Escherichia coli XH001]
 dbj|BAL39364.1| heat shock protein [Escherichia coli str. K-12 substr. MDS42]
 gb|EIE38672.1| heat shock protein [Escherichia coli J53]
 gb|EMD08591.1| heat shock protein [Escherichia coli S17]
 gb|AGX34647.1| heat shock protein [synthetic Escherichia coli C321.deltaA]
 emb|CDJ74192.1| heat shock protein GrpE [Escherichia coli str. K-12 substr. MC4100]
 gb|KDU27960.1| protein grpE [Escherichia coli 3-373-03_S4_C2]
 gb|KDU49487.1| protein grpE [Escherichia coli 3-373-03_S4_C1]
 gb|KEL21257.1| protein grpE [Escherichia coli 3-373-03_S4_C3]
 gb|AIF37859.1| heat shock protein GrpE [Escherichia coli KLY]
 emb|CEE05247.1| grpE family protein [Escherichia coli]
 gb|AIN33011.1| heat shock protein [Escherichia coli BW25113]
 gb|KGA87475.1| heat shock protein GrpE [Escherichia coli]
 emb|CDY60673.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair, subunit of DnaJ/DnaK/GrpE [Escherichia
           coli]
 emb|CDZ21423.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair, subunit of DnaJ/DnaK/GrpE [Escherichia
           coli]
 gb|KGL71234.1| heat shock protein [Escherichia coli NCTC 50110]
 gb|AIZ29105.1| heat shock protein [Escherichia coli ER2796]
 gb|AIZ52430.1| heat shock protein [Escherichia coli K-12]
 gb|AIZ90326.1| heat shock protein GrpE [Escherichia coli str. K-12 substr. MG1655]
 emb|CQR82075.1| heat shock protein [Escherichia coli K-12]
 gb|AKD62112.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD66485.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD70844.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD75205.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD79614.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD83985.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD88341.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKD92769.1| heat shock protein GrpE [Escherichia coli K-12]
 gb|AKF56441.1| heat shock protein [Escherichia coli]
 gb|AKF60581.1| heat shock protein [Escherichia coli]
 gb|AKF64719.1| heat shock protein [Escherichia coli]
 gb|AKF68859.1| heat shock protein [Escherichia coli]
 gb|AKF72998.1| heat shock protein [Escherichia coli]
 gb|AKK15439.1| heat shock protein [Escherichia coli K-12]
 gb|AKK18506.1| heat shock protein [Escherichia coli K-12]
 gb|AKO58114.1| heat shock protein GrpE [Escherichia coli]
 gb|AKR21478.1| heat shock protein GrpE [Escherichia coli]
 gb|AKR25832.1| heat shock protein GrpE [Escherichia coli]
 gb|AKR30279.1| heat shock protein GrpE [Escherichia coli]
 gb|ALB32697.1| heat shock protein GrpE [Escherichia coli]
 emb|CUH56905.1| heat shock protein [Escherichia coli KRX]
 emb|CUQ97852.1| Heat shock protein GrpE [Escherichia coli]
 gb|ALI39652.1| molecular chaperone GrpE [Escherichia coli str. K-12 substr.
           MG1655]
 gb|ALI44052.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALI48450.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALQ71722.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMC95556.1| molecular chaperone GrpE [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AMH31274.1| molecular chaperone GrpE [Escherichia coli K-12]
 gb|AMH35993.1| molecular chaperone GrpE [Escherichia coli K-12]
 emb|CUW21450.1| Heat shock protein B25,3 [Escherichia coli]
 gb|AML00843.1| molecular chaperone GrpE [Escherichia coli str. K-12 substr.
           MG1655]
 gb|KXQ09581.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXU66661.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXU70040.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXU77172.1| molecular chaperone GrpE [Escherichia coli]
 gb|ANK08303.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCW76863.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOO70879.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL53088.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SCQ08010.1| Heat shock protein B25,3 [Escherichia coli]
 gb|APC52839.1| nucleotide exchange factor GrpE [Escherichia coli str. K-12 substr.
           W3110]
 gb|OJS28710.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS83750.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APQ20495.1| Heat shock protein B25.3 [Escherichia coli]
 gb|AQP92533.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OON79546.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQZ29493.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARD78031.1| molecular chaperone GrpE [Escherichia coli]
 gb|ARD81905.1| molecular chaperone GrpE [Escherichia coli]
 gb|ORE78481.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORE80708.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SMH36469.1| molecular chaperone GrpE [Escherichia coli]
 gb|ARM41938.1| molecular chaperone GrpE [Escherichia coli]
 gb|ASO01712.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ20456.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ23603.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ25721.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ32445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ34092.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ43287.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ44854.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ48988.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ56572.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUG17358.1| nucleotide exchange factor GrpE [Escherichia coli str. K-12 substr.
           MG1655]
 gb|PNS24815.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVD34002.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVI52811.1| nucleotide exchange factor GrpE [Escherichia coli str. K-12 substr.
           MG1655]
          Length = 197

 Score =  344 bits (882), Expect = e-119
 Identities = 179/179 (100%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_087605267.1| nucleotide exchange factor GrpE, partial [Escherichia coli]
          Length = 188

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 5   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 64

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 65  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 124

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 125 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 183


>ref|WP_065405673.1| nucleotide exchange factor GrpE, partial [Shigella sonnei]
          Length = 189

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 6   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 65

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 66  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 125

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 126 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 184


>ref|WP_065406221.1| nucleotide exchange factor GrpE, partial [Shigella sonnei]
          Length = 190

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 7   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 66

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 67  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 126

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 127 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 185


>ref|WP_087604965.1| nucleotide exchange factor GrpE, partial [Escherichia coli]
          Length = 195

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 12  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 71

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 72  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 131

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 132 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 190


>ref|WP_096841622.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 196

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_087683308.1| nucleotide exchange factor GrpE, partial [Escherichia coli]
 gb|OVD05212.1| hypothetical protein UQ17_28080, partial [Escherichia coli]
          Length = 196

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 13  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 72

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 73  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 132

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 133 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 191


>ref|WP_001300112.1| MULTISPECIES: nucleotide exchange factor GrpE [Enterobacteriaceae]
 sp|A7ZQ54.1|GRPE_ECO24 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 gb|ABV20707.1| co-chaperone GrpE [Escherichia coli O139:H28 str. E24377A]
 gb|EDX30421.1| co-chaperone GrpE [Escherichia coli B171]
 dbj|BAI31939.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 12009]
 gb|EFE61484.1| co-chaperone GrpE [Escherichia coli B088]
 gb|EFK01612.1| co-chaperone GrpE [Escherichia coli MS 182-1]
 gb|EFK74354.1| co-chaperone GrpE [Escherichia coli MS 78-1]
 gb|EFZ45126.1| protein grpE [Escherichia coli E128010]
 gb|EFZ69885.1| protein grpE [Escherichia coli OK1357]
 gb|EGB42292.1| GrpE protein [Escherichia coli H120]
 gb|EGW83993.1| protein grpE [Escherichia coli 3030-1]
 gb|EGX08317.1| protein grpE [Escherichia coli STEC_H.1.8]
 gb|EHN80995.1| protein grpE [Escherichia coli H494]
 gb|EHW89758.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC11A]
 gb|EHX01883.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC11B]
 gb|EHX08623.1| grpE family protein [Escherichia coli DEC11D]
 gb|EHX10636.1| grpE family protein [Escherichia coli DEC11C]
 gb|EHX17652.1| grpE family protein [Escherichia coli DEC11E]
 gb|EHX24373.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC12B]
 gb|EHX28626.1| grpE family protein [Escherichia coli DEC12A]
 gb|EHX29537.1| grpE family protein [Escherichia coli DEC12C]
 gb|EHX41255.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC12D]
 gb|EHX47396.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC12E]
 gb|EID67532.1| heat shock protein HSP70 cofactor [Escherichia coli W26]
 gb|EIH55284.1| co-chaperone GrpE [Escherichia coli 3.2608]
 gb|EIH65911.1| co-chaperone GrpE [Escherichia coli 93.0624]
 gb|EII34985.1| co-chaperone GrpE [Escherichia coli 4.0967]
 gb|EII96413.1| co-chaperone GrpE [Escherichia coli TW07793]
 gb|EIL02136.1| heat shock protein HSP70 cofactor [Escherichia coli O103:H2 str.
           CVM9450]
 gb|EIL02965.1| heat shock protein HSP70 cofactor [Escherichia coli O103:H25 str.
           CVM9340]
 gb|EIQ69807.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli EPEC C342-62]
 gb|ELD21486.1| protein grpE [Escherichia coli KTE210]
 gb|ELG34820.1| protein grpE [Escherichia coli KTE84]
 gb|EMD06894.1| heat shock protein [Escherichia coli O08]
 gb|EMV31726.1| protein grpE [Escherichia coli BCE002_MS12]
 gb|EMV92554.1| protein grpE [Escherichia coli 2860050]
 gb|EMW50904.1| protein grpE [Escherichia coli 2770900]
 gb|EMW67321.1| protein grpE [Escherichia coli 2749250]
 gb|EMW73917.1| protein grpE [Escherichia coli 2747800]
 gb|EMX07821.1| protein grpE [Escherichia coli P0302308.1]
 gb|EMX68368.1| protein grpE [Escherichia coli Envira 10/1]
 gb|EMX70026.1| protein grpE [Escherichia coli Envira 8/11]
 gb|EMX88602.1| protein grpE [Escherichia coli BCE001_MS16]
 gb|ENA51206.1| protein grpE [Escherichia coli 2729250]
 gb|ENA93138.1| protein grpE [Escherichia coli 2860650]
 gb|ENC97703.1| protein grpE [Escherichia coli P0302308.10]
 gb|END01439.1| protein grpE [Escherichia coli P0302308.11]
 gb|END09516.1| protein grpE [Escherichia coli P0302308.3]
 gb|END13574.1| protein grpE [Escherichia coli P0302308.2]
 gb|END21298.1| protein grpE [Escherichia coli P0302308.5]
 gb|END25516.1| protein grpE [Escherichia coli P0302308.4]
 gb|END42995.1| protein grpE [Escherichia coli p0305293.13]
 gb|ENE09660.1| protein grpE [Escherichia coli p0305293.14]
 gb|ENG41507.1| protein grpE [Escherichia coli p0305293.11]
 gb|ENG42225.1| protein grpE [Escherichia coli p0305293.12]
 gb|ENG54900.1| protein grpE [Escherichia coli p0305293.2]
 gb|ENG61436.1| protein grpE [Escherichia coli p0305293.3]
 gb|ENG64342.1| protein grpE [Escherichia coli p0305293.4]
 gb|ENG70734.1| protein grpE [Escherichia coli p0305293.8]
 gb|ENG76738.1| protein grpE [Escherichia coli p0305293.9]
 gb|ENH16643.1| protein grpE [Escherichia coli P0302308.13]
 gb|ENH18309.1| protein grpE [Escherichia coli P0302308.12]
 gb|ENH19394.1| protein grpE [Escherichia coli P0302308.14]
 gb|ENH44866.1| protein grpE [Escherichia coli p0305293.5]
 gb|ENH51025.1| protein grpE [Escherichia coli p0305293.7]
 gb|ENH56011.1| protein grpE [Escherichia coli p0305293.6]
 gb|EOU71221.1| protein grpE [Escherichia coli KTE24]
 gb|EPH48598.1| Heat shock protein GrpE [Escherichia coli E2265]
 gb|EQQ97341.1| protein grpE [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR01127.1| protein grpE [Escherichia coli HVH 115 (4-4465997)]
 gb|EQR96228.1| protein grpE [Escherichia coli HVH 139 (4-3192644)]
 gb|EQS33103.1| protein grpE [Escherichia coli HVH 147 (4-5893887)]
 gb|EQT92454.1| protein grpE [Escherichia coli HVH 195 (3-7155360)]
 gb|ERF90173.1| heat shock protein GrpE [Escherichia coli O104:H21 str.
           CFSAN002237]
 gb|ESA68033.1| co-chaperone GrpE [Escherichia coli 113303]
 gb|ESP07797.1| protein grpE [Escherichia coli HVH 36 (4-5675286)]
 gb|ESS93376.1| Heat shock protein GrpE [Escherichia coli CE516]
 gb|ESV04026.1| Heat shock protein GrpE [Escherichia coli E1777]
 gb|ETD54961.1| heat shock protein GrpE [Escherichia coli ATCC BAA-2215]
 gb|EYU97072.1| heat shock protein GrpE [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYX81668.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX86628.1| heat shock protein GrpE [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYY39098.1| heat shock protein GrpE [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYZ16724.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ17052.1| heat shock protein GrpE [Escherichia coli O103:H25 str. 2010C-4529]
 gb|EZA27225.1| heat shock protein GrpE [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA64283.1| heat shock protein GrpE [Escherichia coli O104:H21 str. 94-3025]
 gb|EZE03495.1| heat shock protein GrpE [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE13773.1| heat shock protein GrpE [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE24705.1| heat shock protein GrpE [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE64099.1| heat shock protein GrpE [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZG33407.1| heat shock protein GrpE [Escherichia coli E1728]
 gb|EZJ39746.1| protein grpE [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ60084.1| protein grpE [Escherichia coli 1-182-04_S4_C1]
 gb|KDM85234.1| heat shock protein GrpE [Escherichia coli]
 gb|KDV57657.1| heat shock protein GrpE [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV80233.1| protein grpE [Escherichia coli 2-052-05_S4_C2]
 gb|KDW15933.1| protein grpE [Escherichia coli 2-177-06_S3_C1]
 gb|KDW39916.1| protein grpE [Escherichia coli 2-177-06_S4_C2]
 gb|KDZ01505.1| protein grpE [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ09982.1| protein grpE [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ47122.1| protein grpE [Escherichia coli 3-073-06_S1_C1]
 gb|KEM13911.1| protein grpE [Escherichia coli 6-319-05_S1_C2]
 gb|KEM26843.1| protein grpE [Escherichia coli 6-319-05_S1_C3]
 gb|KEN02705.1| protein grpE [Escherichia coli 6-319-05_S1_C1]
 gb|KEN84132.1| protein grpE [Escherichia coli 2-474-04_S4_C1]
 gb|KEP78433.1| heat shock protein GrpE [Escherichia coli E1140]
 gb|AIT35730.1| heat shock protein GrpE [Escherichia coli FAP1]
 gb|KHG88611.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH19367.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH54799.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH98831.1| heat shock protein GrpE [Escherichia coli]
 gb|AIZ83685.1| heat shock protein GrpE [Escherichia coli]
 gb|AIZ88190.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG32727.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG37187.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG69503.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH15611.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH15796.1| heat shock protein GrpE [Escherichia coli]
 gb|KJJ75408.1| heat shock protein [Escherichia coli]
 gb|KJW24195.1| heat shock protein GrpE [Escherichia coli]
 gb|KJW26459.1| heat shock protein GrpE [Escherichia coli]
 gb|AKC15265.1| heat shock protein GrpE [Escherichia coli]
 gb|AKH23315.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG33727.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG42232.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG49256.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG67015.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG90207.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG93109.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH01679.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH20536.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH65609.1| heat shock protein GrpE [Escherichia coli]
 gb|KMV44026.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF12350.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF37815.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF54674.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF78459.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF84174.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF96442.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF99020.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG20399.1| heat shock protein GrpE [Escherichia coli]
 gb|KNY57738.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY85696.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY93196.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNZ26099.1| heat -hock protein GrpE [Escherichia coli]
 emb|CTX24350.1| heat shock protein [Escherichia coli]
 emb|CTS26202.1| heat shock protein [Escherichia coli]
 emb|CTW18070.1| heat shock protein [Escherichia coli]
 emb|CTV97598.1| heat shock protein [Escherichia coli]
 emb|CTS94528.1| heat shock protein [Escherichia coli]
 emb|CTS63955.1| heat shock protein [Escherichia coli]
 emb|CTW50498.1| heat shock protein [Escherichia coli]
 emb|CTS98884.1| heat shock protein [Escherichia coli]
 emb|CTT63647.1| heat shock protein [Escherichia coli]
 emb|CTT10786.1| heat shock protein [Escherichia coli]
 emb|CTS57727.1| heat shock protein [Escherichia coli]
 emb|CTW59379.1| heat shock protein [Escherichia coli]
 emb|CTT03649.1| heat shock protein [Escherichia coli]
 emb|CTV90318.1| heat shock protein [Escherichia coli]
 emb|CTW44625.1| heat shock protein [Escherichia coli]
 emb|CTT48703.1| heat shock protein [Escherichia coli]
 emb|CTT98084.1| heat shock protein [Escherichia coli]
 emb|CTY13279.1| heat shock protein [Escherichia coli]
 emb|CTZ73304.1| heat shock protein [Escherichia coli]
 emb|CTZ04937.1| heat shock protein [Escherichia coli]
 emb|CTZ94059.1| heat shock protein [Escherichia coli]
 emb|CUA27223.1| heat shock protein [Escherichia coli]
 emb|CTX80857.1| heat shock protein [Escherichia coli]
 emb|CTX68562.1| heat shock protein [Escherichia coli]
 emb|CTX58976.1| heat shock protein [Escherichia coli]
 gb|KPO44120.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO70751.1| heat shock protein GrpE [Escherichia coli]
 gb|KQI89424.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ29274.1| heat -hock protein GrpE [Escherichia coli]
 gb|KUS12284.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS92592.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL32852.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYR16279.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR87442.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR89888.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS13956.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS62260.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS81988.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT09653.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT12607.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT59041.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU08950.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU44307.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU82638.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV76559.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV87520.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV93598.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW15787.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW65804.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYZ94476.1| molecular chaperone GrpE [Escherichia coli]
 gb|KZI32216.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAC40411.1| heat shock protein [Escherichia coli]
 gb|OAJ83248.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAO63816.1| heat shock protein GrpE [Escherichia coli]
 gb|OAR88157.1| molecular chaperone GrpE [Escherichia coli]
 gb|ANO90384.1| heat -hock protein GrpE [Escherichia coli]
 gb|OCT08619.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODG73059.1| nucleotide exchange factor GrpE [Shigella sp. FC2045]
 gb|ODG80172.1| nucleotide exchange factor GrpE [Shigella sp. FC2928]
 gb|OEI23905.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI33026.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI47397.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI49728.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL52265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL68500.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL80713.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM07423.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM18095.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM96727.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN41196.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN52434.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN58223.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN91285.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN99354.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SDP19666.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OIZ86934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK96685.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM16535.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM17443.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM53666.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM93082.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM96309.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN18680.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN44305.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN94530.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS47284.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APJ64586.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ68039.1| heat shock protein GrpE [Escherichia coli]
 gb|APK31045.1| heat shock protein GrpE [Escherichia coli]
 gb|APK93529.1| heat shock protein GrpE [Escherichia coli]
 gb|APK99997.1| heat shock protein GrpE [Escherichia coli]
 gb|APL09240.1| heat shock protein GrpE [Escherichia coli]
 gb|APL32677.1| heat shock protein GrpE [Escherichia coli]
 gb|APL46205.1| heat shock protein GrpE [Escherichia coli]
 gb|APL87637.1| heat shock protein GrpE [Escherichia coli]
 gb|APL52480.1| heat shock protein GrpE [Escherichia coli]
 gb|OKS90686.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT74414.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU25340.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU86397.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW16939.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW65149.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW68345.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW83764.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW83810.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW99269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQZ85205.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARA01370.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORJ75966.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS45490.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS59905.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS68476.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS74713.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSB88050.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSL89835.1| co-chaperone GrpE [Escherichia coli T426]
 gb|OTB69587.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB97253.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC62214.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD78029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE37683.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARV33467.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARV54348.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC19347.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC48294.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC48518.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC60420.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE42533.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE95545.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF04178.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF18766.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASJ44430.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYC58002.1| protein GrpE [Escherichia coli]
 gb|OYF74917.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI68852.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ68483.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYK20103.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PAY68430.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PAZ23079.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ27748.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ34071.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ42153.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ45370.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ51286.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ62173.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ77077.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ82661.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ96019.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB09453.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO98292.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PBP09237.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PBQ45140.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR44648.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR97241.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS27657.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS32586.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS39061.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS42815.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS49753.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT29380.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU08372.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU20214.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU28175.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU62926.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU65963.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCD53113.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATG63097.1| nucleotide exchange factor GrpE [Escherichia coli O104:H21 str.
           CFSAN002236]
 gb|PDV48141.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG07046.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG11865.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG36235.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL93029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM30971.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM41003.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD85443.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PMB58649.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POF76634.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POF80648.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POH98045.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POI13832.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POO43889.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS13454.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS26409.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW60789.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY67666.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ25579.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ31067.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ97970.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA14607.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA49915.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRO98654.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP07397.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP19773.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP22551.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP35640.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF30057.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 196

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_105456666.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_097346495.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_097368706.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDM92047.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_096886128.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_001301442.1| nucleotide exchange factor GrpE [Escherichia coli]
 sp|B5Z231.1|GRPE_ECO5E RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 gb|EDU34448.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4196]
 gb|EDU72428.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4076]
 gb|EDU75756.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4401]
 gb|EDU80423.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4486]
 gb|EDZ75112.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4206]
 gb|EDZ82939.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4045]
 gb|EDZ88879.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4042]
 gb|ACI39414.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4115]
 gb|ACI79568.1| heat shock protein GrpE [Escherichia coli]
 gb|ACI79570.1| heat shock protein GrpE [Escherichia coli]
 gb|ACT73320.1| heat shock protein [Escherichia coli O157:H7 str. TW14359]
 gb|EHU75423.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3E]
 gb|EHU98838.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC4B]
 gb|EIN52692.1| protein grpE [Escherichia coli PA3]
 gb|EIN58851.1| protein grpE [Escherichia coli PA9]
 gb|EIN94554.1| protein grpE [Escherichia coli PA25]
 gb|EIN95985.1| protein grpE [Escherichia coli PA24]
 gb|EIN98836.1| protein grpE [Escherichia coli PA28]
 gb|EIO36796.1| protein grpE [Escherichia coli PA39]
 gb|EIO57199.1| protein grpE [Escherichia coli TW07945]
 gb|EIO71555.1| protein grpE [Escherichia coli TW09098]
 gb|EIO91258.1| protein grpE [Escherichia coli EC4203]
 gb|EIO95739.1| protein grpE [Escherichia coli EC4196]
 gb|EIP09381.1| protein grpE [Escherichia coli O157:H7 str. TW14313]
 gb|EIP24765.1| protein grpE [Escherichia coli EC4013]
 gb|EIP31596.1| protein grpE [Escherichia coli EC4402]
 gb|EIP38745.1| protein grpE [Escherichia coli EC4439]
 gb|EIP43568.1| protein grpE [Escherichia coli EC4436]
 gb|EIP52164.1| protein grpE [Escherichia coli EC4437]
 gb|EIP54618.1| protein grpE [Escherichia coli EC4448]
 gb|EIP66289.1| protein grpE [Escherichia coli EC1734]
 gb|EIP76922.1| protein grpE [Escherichia coli EC1863]
 gb|EIP78043.1| protein grpE [Escherichia coli EC1845]
 gb|EKH03701.1| protein grpE [Escherichia coli PA34]
 gb|EKI50214.1| protein grpE [Escherichia coli EC1735]
 gb|EKI60644.1| protein grpE [Escherichia coli EC1736]
 gb|EKI68445.1| protein grpE [Escherichia coli EC1846]
 gb|EKI76355.1| protein grpE [Escherichia coli EC1847]
 gb|EKI79688.1| protein grpE [Escherichia coli EC1848]
 gb|EKI93654.1| protein grpE [Escherichia coli EC1850]
 gb|EKI96458.1| protein grpE [Escherichia coli EC1856]
 gb|EKJ04703.1| protein grpE [Escherichia coli EC1862]
 gb|EKJ09214.1| protein grpE [Escherichia coli EC1864]
 gb|EKJ21118.1| protein grpE [Escherichia coli EC1868]
 gb|EKJ24608.1| protein grpE [Escherichia coli EC1866]
 gb|EKJ34328.1| protein grpE [Escherichia coli EC1869]
 gb|EKJ40245.1| protein grpE [Escherichia coli EC1870]
 gb|EKK53725.1| protein grpE [Escherichia coli 10.0833]
 gb|EKK56088.1| protein grpE [Escherichia coli 8.2524]
 gb|EKK70048.1| protein grpE [Escherichia coli 88.0221]
 gb|EKW73917.1| protein grpE [Escherichia coli 97.1742]
 gb|EKW88757.1| protein grpE [Escherichia coli 99.0678]
 gb|ELV17571.1| protein grpE [Escherichia coli 99.0814]
 gb|ELV25718.1| protein grpE [Escherichia coli 99.0815]
 gb|ELV34275.1| protein grpE [Escherichia coli 99.0839]
 gb|ELV34858.1| protein grpE [Escherichia coli 99.0816]
 gb|ELV39866.1| protein grpE [Escherichia coli 99.0848]
 gb|ELV80489.1| protein grpE [Escherichia coli PA13]
 gb|ELV81136.1| protein grpE [Escherichia coli PA19]
 gb|ELV89362.1| protein grpE [Escherichia coli PA2]
 gb|ELV96473.1| protein grpE [Escherichia coli PA47]
 gb|ELW02889.1| protein grpE [Escherichia coli PA8]
 gb|ELW17837.1| protein grpE [Escherichia coli 99.1762]
 gb|ELW26515.1| protein grpE [Escherichia coli PA35]
 gb|ERB72459.1| protein grpE [Escherichia coli 09BKT076207]
 gb|ERB97117.1| protein grpE [Escherichia coli B28-2]
 gb|ERB97149.1| protein grpE [Escherichia coli B28-1]
 gb|ERC04759.1| protein grpE [Escherichia coli B29-1]
 gb|ERC12565.1| protein grpE [Escherichia coli B29-2]
 gb|ERC16813.1| protein grpE [Escherichia coli B36-1]
 gb|ERC19481.1| protein grpE [Escherichia coli B36-2]
 gb|ERC28747.1| protein grpE [Escherichia coli B7-2]
 gb|ERC35590.1| protein grpE [Escherichia coli B7-1]
 gb|ERC37941.1| protein grpE [Escherichia coli B93]
 gb|ERC42602.1| protein grpE [Escherichia coli B94]
 gb|ERC47702.1| protein grpE [Escherichia coli B95]
 gb|ERC69472.1| protein grpE [Escherichia coli T1840_97]
 gb|ERD27906.1| protein grpE [Escherichia coli B112]
 gb|ERD31666.1| protein grpE [Escherichia coli B113]
 gb|ERD40190.1| protein grpE [Escherichia coli B114]
 gb|ERE26621.1| protein grpE [Escherichia coli B89]
 gb|ERE28377.1| protein grpE [Escherichia coli B90]
 gb|ERE40548.1| protein grpE [Escherichia coli Tx3800]
 gb|EYV99092.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2312]
 gb|EYW03449.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2288]
 gb|EYW05333.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2289]
 gb|EYW18547.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2287]
 gb|EYW26591.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2286]
 gb|EYX63903.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-1107]
 gb|EYZ29770.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ52948.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 06-3745]
 gb|EZA84816.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F6142]
 gb|EZB11173.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F7384]
 gb|EZB21013.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F7410]
 gb|EZB48290.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1420]
 gb|EZB83295.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1921]
 gb|EZB83327.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1927]
 gb|EZC32719.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K4405]
 gb|EZC41156.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K4406]
 gb|EZC44700.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K4527]
 gb|EZC52855.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5418]
 gb|EZD09989.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K6676]
 gb|EZD22513.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K6687]
 gb|EZD78334.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 08-4529]
 gb|EZE80895.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZF03939.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2313]
 gb|EZF06785.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2290]
 gb|AIF95131.1| Heat shock protein GrpE [Escherichia coli O157:H7 str. SS17]
 gb|AJA27569.1| Heat shock protein GrpE [Escherichia coli O157:H7 str. SS52]
 gb|KKF84594.1| heat shock protein GrpE [Escherichia coli O157:H7]
 gb|KPP29084.1| heat shock protein GrpE [Escherichia coli]
 gb|AMG76982.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AMW42441.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF22445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF26334.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF29806.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF39140.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF39795.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF48284.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF54993.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF56244.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF64244.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API05267.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB75378.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC94831.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD64492.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE18752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE21101.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE73221.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTU94855.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV03602.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OVA39377.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA40243.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA44715.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA56849.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA60547.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA63030.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA68770.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA76082.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA83668.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA86240.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA94612.1| heat shock protein GrpE [Escherichia coli]
 gb|OVA95256.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB04600.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB18952.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB29824.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB51065.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB58903.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB68639.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB76995.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB80553.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB83981.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB89327.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB96372.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC04222.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC05690.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC13110.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC17734.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC20718.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC25704.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC32867.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC39025.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC41169.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC49933.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC54203.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC59830.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC63774.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC69147.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC76130.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC82997.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC88723.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC89373.1| heat shock protein GrpE [Escherichia coli]
 gb|OVE18171.1| heat shock protein GrpE [Escherichia coli]
 gb|OVE25925.1| heat shock protein GrpE [Escherichia coli]
 gb|PDV04239.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV31810.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV37248.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJR32013.1| heat shock protein GrpE [Escherichia coli O157:H7 str. TW14313]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_001296310.1| MULTISPECIES: nucleotide exchange factor GrpE [Proteobacteria]
 ref|NP_311503.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 ref|NP_708461.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 ref|YP_404321.1| heat shock protein GrpE [Shigella dysenteriae Sd197]
 ref|YP_002408754.1| heat shock protein GrpE [Escherichia coli IAI39]
 ref|YP_002413633.1| heat shock protein [Escherichia coli UMN026]
 ref|YP_006120946.1| heat shock protein HSP70 cofactor [Escherichia coli O83:H1 str. NRG
           857C]
 ref|YP_006777981.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           2011C-3493]
 sp|Q7ABI1.1|GRPE_ECO57 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q7C0D0.1|GRPE_SHIFL RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q8FEY9.1|GRPE_ECOL6 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q0TEM6.1|GRPE_ECOL5 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q31XD2.1|GRPE_SHIBS RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q32CX5.1|GRPE_SHIDS RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|Q3YYM5.1|GRPE_SHISS RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|A8A3C0.1|GRPE_ECOHS RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B1IVM0.1|GRPE_ECOLC RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7NSB2.1|GRPE_ECO7I RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7M983.1|GRPE_ECO8A RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7N6J9.1|GRPE_ECOLU RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B6I635.1|GRPE_ECOSE RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B2TYN5.1|GRPE_SHIB3 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7UH62.1|GRPE_ECO27 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7LDK2.1|GRPE_ECO55 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 gb|AAG57724.1|AE005491_4 phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair [Escherichia coli O157:H7 str. EDL933]
 gb|AAN81585.1|AE016764_267 GrpE protein [Escherichia coli CFT073]
 dbj|BAB36899.1| heat shock protein GrpE [Escherichia coli O157:H7 str. Sakai]
 gb|AAN44168.1| heat shock protein GrpE [Shigella flexneri 2a str. 301]
 gb|AAP17993.1| heat shock protein GrpE [Shigella flexneri 2a str. 2457T]
 gb|AAZ89387.1| heat shock protein [Shigella sonnei Ss046]
 gb|ABB62830.1| GrpE [Shigella dysenteriae Sd197]
 gb|ABB67276.1| GrpE [Shigella boydii Sb227]
 gb|ABG70603.1| GrpE protein [Escherichia coli 536]
 gb|ABV07024.1| co-chaperone GrpE [Escherichia coli HS]
 gb|ACA76737.1| Ribulose-phosphate 3-epimerase [Escherichia coli ATCC 8739]
 gb|ACD09482.1| co-chaperone GrpE [Shigella boydii CDC 3083-94]
 gb|EDU62343.1| co-chaperone GrpE [Escherichia coli 53638]
 gb|EDU85694.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC4501]
 gb|EDU89277.1| co-chaperone GrpE [Escherichia coli O157:H7 str. EC869]
 gb|EDV67897.1| co-chaperone GrpE [Escherichia coli F11]
 gb|EDV85889.1| co-chaperone GrpE [Escherichia coli E110019]
 gb|ACI79566.1| heat shock protein GrpE [Escherichia coli]
 gb|ACI79567.1| heat shock protein GrpE [Escherichia coli]
 gb|ACI79569.1| heat shock protein GrpE [Escherichia coli]
 dbj|BAG78421.1| heat shock protein [Escherichia coli SE11]
 emb|CAS10450.1| heat shock protein [Escherichia coli O127:H6 str. E2348/69]
 gb|EEC28482.1| co-chaperone GrpE [Escherichia coli O157:H7 str. TW14588]
 emb|CAU98769.1| heat shock protein [Escherichia coli 55989]
 emb|CAQ99562.1| heat shock protein [Escherichia coli IAI1]
 emb|CAR18939.1| heat shock protein [Escherichia coli IAI39]
 emb|CAR14109.1| heat shock protein [Escherichia coli UMN026]
 emb|CAP77056.1| Protein grpE [Escherichia coli LF82]
 gb|EEH71335.1| protein grpE [Escherichia sp. 1_1_43]
 gb|EEJ45285.1| co-chaperone GrpE [Escherichia coli 83972]
 emb|CAQ32983.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair, subunit of DnaJ/DnaK/GrpE [Escherichia
           coli BL21(DE3)]
 gb|ACT28139.1| GrpE protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gb|ACT40155.1| heat shock protein [Escherichia coli B str. REL606]
 gb|ACT44321.1| heat shock protein [Escherichia coli BL21(DE3)]
 dbj|BAI26853.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 11368]
 dbj|BAI37145.1| heat shock protein GrpE [Escherichia coli O111:H- str. 11128]
 dbj|BAI55989.1| heat shock protein [Escherichia coli SE15]
 gb|ADA75007.1| Protein grpE [Shigella flexneri 2002017]
 gb|ADD57719.1| heat shock protein GrpE [Escherichia coli O55:H7 str. CB9615]
 gb|EFE99158.1| heat shock protein GrpE [Escherichia coli FVEC1412]
 gb|EFI18510.1| grpE [Escherichia coli FVEC1302]
 gb|EFJ54177.1| co-chaperone GrpE [Escherichia coli MS 185-1]
 gb|EFJ60205.1| co-chaperone GrpE [Escherichia coli MS 200-1]
 gb|EFJ65617.1| co-chaperone GrpE [Escherichia coli MS 175-1]
 gb|EFJ72185.1| co-chaperone GrpE [Escherichia coli MS 198-1]
 gb|EFJ79081.1| co-chaperone GrpE [Escherichia coli MS 69-1]
 gb|EFJ86591.1| co-chaperone GrpE [Escherichia coli MS 84-1]
 gb|EFJ91407.1| co-chaperone GrpE [Escherichia coli MS 45-1]
 gb|EFJ95200.1| co-chaperone GrpE [Escherichia coli MS 115-1]
 gb|EFK15155.1| co-chaperone GrpE [Escherichia coli MS 116-1]
 gb|EFK24974.1| co-chaperone GrpE [Escherichia coli MS 187-1]
 gb|EFK43416.1| co-chaperone GrpE [Escherichia coli MS 119-7]
 gb|EFK48564.1| co-chaperone GrpE [Escherichia coli MS 107-1]
 gb|EFK66756.1| co-chaperone GrpE [Escherichia coli MS 124-1]
 gb|EFK92406.1| co-chaperone GrpE [Escherichia coli MS 146-1]
 gb|EFM54945.1| heat shock protein HSP70 cofactor [Escherichia coli NC101]
 gb|EFN36038.1| GrpE protein [Escherichia coli W]
 gb|ADN47401.1| co-chaperone GrpE [Escherichia coli ABU 83972]
 gb|EFO59291.1| co-chaperone GrpE [Escherichia coli MS 145-7]
 gb|EFP73012.1| protein grpE [Shigella dysenteriae 1617]
 emb|CBJ02324.1| heat shock protein (heat shock protein B25.3) [Escherichia coli
           ETEC H10407]
 gb|EFQ00300.1| protein grpE [Escherichia coli 1827-70]
 gb|EFR17681.1| protein grpE [Escherichia coli 2362-75]
 gb|ADR28012.1| heat shock protein HSP70 cofactor [Escherichia coli O83:H1 str. NRG
           857C]
 gb|EFS12735.1| protein grpE [Shigella flexneri 2a str. 2457T]
 gb|ADT76254.1| heat shock protein [Escherichia coli W]
 gb|EFU33108.1| co-chaperone GrpE [Escherichia coli MS 85-1]
 gb|EFU50311.1| co-chaperone GrpE [Escherichia coli MS 153-1]
 gb|EFU95947.1| protein grpE [Escherichia coli 3431]
 gb|EFW52051.1| Heat shock protein GrpE [Shigella dysenteriae CDC 74-1112]
 gb|EFW57367.1| Heat shock protein GrpE [Shigella boydii ATCC 9905]
 gb|EFW57956.1| Heat shock protein GrpE [Shigella flexneri CDC 796-83]
 gb|EFX10293.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           G5101]
 gb|EFX15085.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str.
           493-89]
 gb|EFX19838.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H- str. H
           2687]
 gb|EFX24865.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           3256-97]
 gb|EFX30050.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           USDA 5905]
 gb|EFX34447.1| heat shock protein HSP70 cofactor [Escherichia coli O157:H7 str.
           LSU-61]
 gb|EFZ42426.1| protein grpE [Escherichia coli EPECa14]
 gb|EFZ53431.1| protein grpE [Shigella sonnei 53G]
 gb|EFZ58701.1| protein grpE [Escherichia coli LT-68]
 gb|EFZ62849.1| protein grpE [Escherichia coli OK1180]
 gb|EFZ73684.1| protein grpE [Escherichia coli RN587/1]
 gb|ADX49761.1| GrpE protein [Escherichia coli KO11FL]
 gb|EGB31990.1| GrpE protein [Escherichia coli E1520]
 gb|EGB37553.1| GrpE protein [Escherichia coli E482]
 gb|EGB56158.1| GrpE protein [Escherichia coli H489]
 gb|EGB59415.1| GrpE protein [Escherichia coli M863]
 gb|EGB66680.1| GrpE protein [Escherichia coli TA007]
 gb|EGB75030.1| co-chaperone GrpE [Escherichia coli MS 57-2]
 gb|EGB81670.1| co-chaperone GrpE [Escherichia coli MS 60-1]
 gb|EGB85820.1| co-chaperone GrpE [Escherichia coli MS 117-3]
 gb|EGC13946.1| GrpE protein [Escherichia coli E1167]
 gb|EGC94178.1| heat shock protein HSP70 cofactor [Escherichia fergusonii ECD227]
 gb|EGI09024.1| co-chaperone GrpE [Escherichia coli H736]
 gb|EGI14244.1| co-chaperone GrpE [Escherichia coli M605]
 gb|EGI19529.1| co-chaperone GrpE [Escherichia coli M718]
 gb|EGI25372.1| co-chaperone GrpE [Escherichia coli TA206]
 gb|EGI30613.1| co-chaperone GrpE [Escherichia coli TA143]
 gb|EGI34944.1| co-chaperone GrpE [Escherichia coli TA271]
 gb|EGI40185.1| co-chaperone GrpE [Escherichia coli TA280]
 gb|EGI44755.1| co-chaperone GrpE [Escherichia coli H591]
 gb|EGI93246.1| protein grpE [Shigella boydii 5216-82]
 gb|EGI94320.1| protein grpE [Shigella dysenteriae 155-74]
 gb|EGI97197.1| protein grpE [Shigella boydii 3594-74]
 gb|EGJ06390.1| co-chaperone GrpE [Escherichia coli D9]
 gb|AEE57816.1| heat shock protein GrpE [Escherichia coli UMNK88]
 gb|EGJ83739.1| protein grpE [Shigella flexneri 4343-70]
 gb|EGJ85964.1| protein grpE [Shigella flexneri 2747-71]
 gb|EGJ95804.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Shigella flexneri 2930-71]
 gb|EGK18973.1| protein grpE [Shigella flexneri VA-6]
 gb|EGK20354.1| protein grpE [Shigella flexneri K-218]
 gb|EGK20555.1| protein grpE [Shigella flexneri K-272]
 gb|EGK34850.1| protein grpE [Shigella flexneri K-227]
 gb|EGK35198.1| protein grpE [Shigella flexneri K-304]
 gb|AEJ57929.1| heat shock protein grpE [Escherichia coli UMNF18]
 gb|EGR62682.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           01-09591]
 gb|EGR73691.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           LB226692]
 gb|EGT69600.1| hypothetical protein C22711_3630 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGU96580.1| co-chaperone GrpE [Escherichia coli MS 79-10]
 gb|EGW67060.1| protein grpE [Escherichia coli STEC_C165-02]
 gb|EGW68011.1| protein grpE [Escherichia coli STEC_B2F1]
 gb|EGW69556.1| protein grpE [Escherichia coli 2534-86]
 gb|EGW81590.1| protein grpE [Escherichia coli STEC_94C]
 gb|EGW89751.1| protein grpE [Escherichia coli STEC_DG131-3]
 gb|EGX01725.1| protein grpE [Escherichia coli STEC_MHI813]
 gb|EGX06464.1| protein grpE [Escherichia coli G58-1]
 gb|EGX16334.1| protein grpE [Escherichia coli STEC_S1191]
 gb|EGX22546.1| protein grpE [Escherichia coli TX1999]
 gb|EHF22898.1| protein grpE [Escherichia coli O104:H4 str. C236-11]
 gb|EHF28166.1| protein grpE [Escherichia coli O104:H4 str. C227-11]
 gb|EHF28560.1| protein grpE [Escherichia coli O104:H4 str. 04-8351]
 gb|EHF34118.1| protein grpE [Escherichia coli O104:H4 str. 09-7901]
 gb|EHF40761.1| protein grpE [Escherichia coli O104:H4 str. 11-3677]
 gb|EHF48805.1| protein grpE [Escherichia coli O104:H4 str. 11-4404]
 gb|EHF52916.1| protein grpE [Escherichia coli O104:H4 str. 11-4522]
 gb|EHF53976.1| protein grpE [Escherichia coli O104:H4 str. 11-4632 C1]
 gb|EHF57024.1| protein grpE [Escherichia coli O104:H4 str. 11-4623]
 gb|EHF58705.1| protein grpE [Escherichia coli O104:H4 str. 11-4632 C2]
 gb|EHF72320.1| protein grpE [Escherichia coli O104:H4 str. 11-4632 C5]
 gb|EHF75255.1| protein grpE [Escherichia coli O104:H4 str. 11-4632 C3]
 gb|EHF77132.1| protein grpE [Escherichia coli O104:H4 str. 11-4632 C4]
 gb|AER85476.1| heat shock protein GrpE [Escherichia coli str. 'clone D i2']
 gb|AER90395.1| heat shock protein GrpE [Escherichia coli str. 'clone D i14']
 gb|EHN89387.1| protein grpE [Escherichia coli TA124]
 gb|EHO03865.1| grpE [Escherichia coli B093]
 gb|EHP66869.1| protein grpE [Escherichia coli 4_1_47FAA]
 gb|AEZ41678.1| heat shock protein HSP70 cofactor [Escherichia coli O55:H7 str.
           RM12579]
 gb|EHU07594.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC1C]
 gb|EHU07735.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC1A]
 gb|EHU11252.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC1B]
 gb|EHU20857.1| grpE family protein [Escherichia coli DEC1D]
 gb|EHU24079.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC1E]
 gb|EHU26049.1| grpE family protein [Escherichia coli DEC2A]
 gb|EHU37706.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC2B]
 gb|EHU41216.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC2C]
 gb|EHU43424.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC2D]
 gb|EHU53578.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC2E]
 gb|EHU58791.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3A]
 gb|EHU67637.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3B]
 gb|EHU67680.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3D]
 gb|EHU75096.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3C]
 gb|EHU88721.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC4A]
 gb|EHU90814.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC3F]
 gb|EHV04999.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC4D]
 gb|EHV09800.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC4E]
 gb|EHV15727.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC4F]
 gb|EHV22847.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC5A]
 gb|EHV28537.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC5B]
 gb|EHV36961.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC5C]
 gb|EHV38110.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC5D]
 gb|EHV45443.1| grpE family protein [Escherichia coli DEC5E]
 gb|EHV54380.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC6B]
 gb|EHV56508.1| grpE family protein [Escherichia coli DEC6A]
 gb|EHV69431.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC6E]
 gb|EHV69521.1| grpE family protein [Escherichia coli DEC6D]
 gb|EHV78221.1| grpE family protein [Escherichia coli DEC7A]
 gb|EHV85506.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC7C]
 gb|EHV90273.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC7D]
 gb|EHV94551.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC7B]
 gb|EHW00536.1| grpE family protein [Escherichia coli DEC7E]
 gb|EHW08276.1| grpE family protein [Escherichia coli DEC8A]
 gb|EHW14598.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC8C]
 gb|EHW14866.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC8B]
 gb|EHW22516.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC8D]
 gb|EHW26882.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC8E]
 gb|EHW34504.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC9A]
 gb|EHW38176.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC9B]
 gb|EHW45020.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC9C]
 gb|EHW50938.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC9D]
 gb|EHW55341.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC9E]
 gb|EHW61002.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10A]
 gb|EHW66561.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10B]
 gb|EHW76612.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10C]
 gb|EHW77083.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10D]
 gb|EHW88533.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10E]
 gb|EHW91647.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC10F]
 gb|EHX45719.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC13A]
 gb|EHX59515.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC13C]
 gb|EHX59755.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC13B]
 gb|EHX62273.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC13D]
 gb|EHX72163.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC13E]
 gb|EHX76300.1| grpE family protein [Escherichia coli DEC14A]
 gb|EHX78419.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC14B]
 gb|EHX87157.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC14C]
 gb|EHX90515.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC14D]
 gb|EHX96348.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC15A]
 gb|EHY03780.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC15B]
 gb|EHY05310.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC15C]
 gb|EHY12724.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC15D]
 gb|EHY18404.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Escherichia coli DEC15E]
 gb|EIA35656.1| heat shock protein HSP70 cofactor [Escherichia coli SCI-07]
 gb|AFG41550.1| heat shock protein GrpE [Escherichia coli P12b]
 gb|AFH16930.1| heat shock protein HSP70 cofactor [Escherichia coli KO11FL]
 gb|AFH12434.1| heat shock protein HSP70 cofactor [Escherichia coli W]
 gb|EIE54843.1| heat shock protein HSP70 cofactor [Escherichia coli AI27]
 gb|EIF15926.1| heat shock protein HSP70 cofactor [Escherichia coli O32:H37 str.
           P4]
 gb|EIF84115.1| protein grpE [Escherichia coli M919]
 gb|EIG44159.1| protein grpE [Escherichia coli H730]
 gb|EIG48166.1| protein grpE [Escherichia coli B799]
 gb|EIG69849.1| protein grpE [Escherichia sp. 4_1_40B]
 gb|EIG79942.1| co-chaperone GrpE [Escherichia coli 1.2741]
 gb|EIH04131.1| co-chaperone GrpE [Escherichia coli 5.0588]
 gb|EIH22017.1| co-chaperone GrpE [Escherichia coli 1.2264]
 gb|EIH34590.1| co-chaperone GrpE [Escherichia coli 96.0497]
 gb|EIH43905.1| co-chaperone GrpE [Escherichia coli 99.0741]
 gb|EIH81444.1| co-chaperone GrpE [Escherichia coli 4.0522]
 gb|EIH88347.1| co-chaperone GrpE [Escherichia coli JB1-95]
 gb|EII02100.1| co-chaperone GrpE [Escherichia coli 96.154]
 gb|EII23533.1| co-chaperone GrpE [Escherichia coli 9.0111]
 gb|EII46064.1| co-chaperone GrpE [Escherichia coli 2.3916]
 gb|EII55121.1| co-chaperone GrpE [Escherichia coli 3.3884]
 gb|EII67157.1| co-chaperone GrpE [Escherichia coli 2.4168]
 gb|EII76088.1| co-chaperone GrpE [Escherichia coli 3.2303]
 gb|EII86928.1| co-chaperone GrpE [Escherichia coli 3003]
 gb|EIJ02828.1| co-chaperone GrpE [Escherichia coli B41]
 gb|EIJ12181.1| co-chaperone GrpE [Escherichia coli 900105 (10e)]
 gb|AFJ30298.1| heat shock protein GrpE [Escherichia coli Xuzhou21]
 gb|EIL01473.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H11 str.
           CVM9534]
 gb|EIL16861.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H11 str.
           CVM9545]
 gb|EIL19812.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H8 str.
           CVM9574]
 gb|EIL28392.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H8 str.
           CVM9570]
 gb|EIL32094.1| heat shock protein HSP70 cofactor [Escherichia coli O26:H11 str.
           CVM9942]
 gb|EIL34379.1| heat shock protein HSP70 cofactor [Escherichia coli O26:H11 str.
           CVM10026]
 gb|EIL46973.1| heat shock protein HSP70 cofactor [Escherichia coli KD2]
 gb|EIL53010.1| heat shock protein HSP70 cofactor [Escherichia coli KD1]
 gb|EIL58920.1| heat shock protein HSP70 cofactor [Escherichia coli 541-15]
 gb|EIL66491.1| heat shock protein HSP70 cofactor [Escherichia coli 75]
 gb|EIL68752.1| heat shock protein HSP70 cofactor [Escherichia coli 576-1]
 gb|EIL68801.1| heat shock protein HSP70 cofactor [Escherichia coli 541-1]
 gb|EIL80762.1| heat shock protein HSP70 cofactor [Escherichia coli CUMT8]
 gb|EIN20308.1| protein grpE [Escherichia coli FRIK1996]
 gb|EIN21812.1| protein grpE [Escherichia coli FDA517]
 gb|EIN22729.1| protein grpE [Escherichia coli FDA505]
 gb|EIN38731.1| protein grpE [Escherichia coli FRIK1985]
 gb|EIN40415.1| protein grpE [Escherichia coli FRIK1990]
 gb|EIN74470.1| protein grpE [Escherichia coli PA15]
 gb|EIO12544.1| protein grpE [Escherichia coli PA31]
 gb|EIO12965.1| protein grpE [Escherichia coli PA32]
 gb|EIO26910.1| protein grpE [Escherichia coli PA40]
 gb|EIO37184.1| protein grpE [Escherichia coli PA42]
 gb|EIO48504.1| protein grpE [Escherichia coli TW06591]
 gb|EIO54323.1| protein grpE [Escherichia coli TW10246]
 gb|EIO69332.1| protein grpE [Escherichia coli TW11039]
 gb|EIO81876.1| protein grpE [Escherichia coli TW10119]
 gb|EIO94946.1| protein grpE [Escherichia coli TW09195]
 gb|EIP09163.1| protein grpE [Escherichia coli TW14301]
 gb|EIP13415.1| protein grpE [Escherichia coli EC4421]
 gb|EIP56672.1| protein grpE [Escherichia coli EC1738]
 gb|EIQ08648.1| grpE family protein [Shigella flexneri K-1770]
 gb|EIQ18739.1| grpE family protein [Shigella flexneri K-315]
 gb|EIQ23766.1| grpE family protein [Shigella flexneri K-404]
 gb|EIQ26822.1| grpE family protein [Shigella boydii 965-58]
 gb|EIQ39208.1| grpE family protein [Shigella sonnei 3226-85]
 gb|EIQ42314.1| grpE family protein [Shigella sonnei 3233-85]
 gb|EIQ62399.1| grpE family protein [Escherichia coli EPECa12]
 gb|EIQ73531.1| grpE family protein [Shigella flexneri 1235-66]
 gb|EJE59513.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H8 str.
           CVM9634]
 gb|EJE61291.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H8 str.
           CVM9602]
 gb|EJE61738.1| heat shock protein [Escherichia coli O26:H11 str. CVM10224]
 gb|EJE76641.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H11 str.
           CVM9553]
 gb|EJE78555.1| heat shock protein HSP70 cofactor [Escherichia coli O26:H11 str.
           CVM10021]
 gb|EJE82835.1| heat shock protein HSP70 cofactor [Escherichia coli O111:H11 str.
           CVM9455]
 gb|EJE90425.1| heat shock protein HSP70 cofactor [Escherichia coli O26:H11 str.
           CVM10030]
 gb|EJE93652.1| heat shock protein HSP70 cofactor [Escherichia coli O26:H11 str.
           CVM9952]
 gb|EJK95272.1| protein grpE [Escherichia coli STEC_O31]
 gb|EJL14818.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Shigella sonnei str. Moseley]
 gb|EJZ64042.1| phage lambda replication host DNA synthesis heat shock protein
           repair [Shigella flexneri 1485-80]
 gb|AFS55984.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           2009EL-2050]
 gb|AFS73180.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           2011C-3493]
 gb|AFS87588.1| heat shock protein HSP70 cofactor [Escherichia coli O104:H4 str.
           2009EL-2071]
 gb|EKG99911.1| protein grpE [Escherichia coli PA7]
 gb|EKH00538.1| protein grpE [Escherichia coli FRIK920]
 gb|EKH12669.1| protein grpE [Escherichia coli FDA506]
 gb|EKH16394.1| protein grpE [Escherichia coli FDA507]
 gb|EKH29913.1| protein grpE [Escherichia coli FRIK1999]
 gb|EKH40101.1| protein grpE [Escherichia coli NE1487]
 gb|EKH46047.1| protein grpE [Escherichia coli NE037]
 gb|EKH51395.1| protein grpE [Escherichia coli FRIK2001]
 gb|EKH57481.1| protein grpE [Escherichia coli PA4]
 gb|EKH66898.1| protein grpE [Escherichia coli PA23]
 gb|EKH69091.1| protein grpE [Escherichia coli PA49]
 gb|EKH74761.1| protein grpE [Escherichia coli PA45]
 gb|EKH82837.1| protein grpE [Escherichia coli TT12B]
 gb|EKH87437.1| protein grpE [Escherichia coli MA6]
 gb|EKH91019.1| protein grpE [Escherichia coli 5905]
 gb|EKH99832.1| protein grpE [Escherichia coli CB7326]
 gb|EKI06198.1| protein grpE [Escherichia coli EC96038]
 gb|EKI08836.1| protein grpE [Escherichia coli 5412]
 gb|EKI25369.1| protein grpE [Escherichia coli ARS4.2123]
 gb|EKI26373.1| protein grpE [Escherichia coli TW00353]
 gb|EKI37169.1| protein grpE [Escherichia coli 3006]
 gb|EKI41385.1| protein grpE [Escherichia coli PA38]
 gb|EKI51165.1| protein grpE [Escherichia coli N1]
 gb|EKJ13791.1| protein grpE [Escherichia coli EC1865]
 gb|EKJ41552.1| protein grpE [Escherichia coli NE098]
 gb|EKJ50780.1| protein grpE [Escherichia coli FRIK523]
 gb|EKJ57289.1| protein grpE [Escherichia coli 0.1288]
 gb|EKJ59977.1| protein grpE [Escherichia coli 0.1304]
 gb|EKJ80429.1| heat shock protein HSP70 cofactor [Escherichia coli AD30]
 gb|EKK22878.1| protein grpE [Escherichia coli 3.4870]
 gb|EKK26394.1| protein grpE [Escherichia coli 5.2239]
 gb|EKK27607.1| protein grpE [Escherichia coli 6.0172]
 gb|EKK44253.1| protein grpE [Escherichia coli 8.0586]
 gb|EKK65382.1| protein grpE [Escherichia coli 10.0869]
 gb|EKK85382.1| protein grpE [Escherichia coli 10.0821]
 emb|CCK47901.1| phage lambda replication [Escherichia coli chi7122]
 gb|EKT94066.1| heat shock protein [Escherichia coli O111:H8 str. CFSAN001632]
 gb|EKT97437.1| heat shock protein [Escherichia coli O26:H11 str. CFSAN001629]
 gb|EKU01614.1| heat shock protein [Escherichia coli O111:H11 str. CFSAN001630]
 gb|EKV74453.1| protein grpE [Escherichia coli 88.1042]
 gb|EKV78195.1| protein grpE [Escherichia coli 88.1467]
 gb|EKV92415.1| protein grpE [Escherichia coli 90.2281]
 gb|EKV96033.1| protein grpE [Escherichia coli 90.0039]
 gb|EKW08676.1| protein grpE [Escherichia coli 93.0056]
 gb|EKW09020.1| protein grpE [Escherichia coli 93.0055]
 gb|EKW12528.1| protein grpE [Escherichia coli 94.0618]
 gb|EKW26064.1| protein grpE [Escherichia coli 95.0183]
 gb|EKW26724.1| protein grpE [Escherichia coli 95.0943]
 gb|EKW29759.1| protein grpE [Escherichia coli 95.1288]
 gb|EKW40470.1| protein grpE [Escherichia coli 96.0428]
 gb|EKW42811.1| protein grpE [Escherichia coli 96.0427]
 gb|EKW46696.1| protein grpE [Escherichia coli 96.0939]
 gb|EKW54759.1| protein grpE [Escherichia coli 96.0932]
 gb|EKW61424.1| protein grpE [Escherichia coli 96.0107]
 gb|EKW62899.1| protein grpE [Escherichia coli 97.0003]
 gb|EKW76790.1| protein grpE [Escherichia coli 97.0007]
 gb|EKW90047.1| protein grpE [Escherichia coli 99.0713]
 gb|EKY37599.1| protein grpE [Escherichia coli 96.0109]
 gb|EKY39181.1| protein grpE [Escherichia coli 97.0010]
 gb|EKY85118.1| protein grpE [Escherichia coli O104:H4 str. 11-02092]
 gb|EKY95760.1| protein grpE [Escherichia coli O104:H4 str. 11-02030]
 gb|EKY98080.1| protein grpE [Escherichia coli O104:H4 str. 11-02093]
 gb|EKY98385.1| protein grpE [Escherichia coli O104:H4 str. 11-02033-1]
 gb|EKZ00992.1| protein grpE [Escherichia coli O104:H4 str. 11-02318]
 gb|EKZ11759.1| protein grpE [Escherichia coli O104:H4 str. 11-02913]
 gb|EKZ12907.1| protein grpE [Escherichia coli O104:H4 str. 11-02281]
 gb|EKZ15195.1| protein grpE [Escherichia coli O104:H4 str. 11-03439]
 gb|EKZ16051.1| protein grpE [Escherichia coli O104:H4 str. 11-03943]
 gb|EKZ27095.1| protein grpE [Escherichia coli O104:H4 str. 11-04080]
 gb|EKZ42415.1| protein grpE [Escherichia coli O104:H4 str. Ec11-9990]
 gb|EKZ45304.1| protein grpE [Escherichia coli O104:H4 str. Ec11-9450]
 gb|EKZ49590.1| protein grpE [Escherichia coli O104:H4 str. Ec11-4987]
 gb|EKZ52702.1| protein grpE [Escherichia coli O104:H4 str. Ec11-4984]
 gb|EKZ56387.1| protein grpE [Escherichia coli O104:H4 str. Ec11-4986]
 gb|EKZ64227.1| protein grpE [Escherichia coli O104:H4 str. Ec11-5604]
 gb|EKZ67617.1| protein grpE [Escherichia coli O104:H4 str. Ec11-4988]
 gb|EKZ72696.1| protein grpE [Escherichia coli O104:H4 str. Ec11-5603]
 gb|EKZ73587.1| protein grpE [Escherichia coli O104:H4 str. Ec11-6006]
 gb|EKZ83178.1| protein grpE [Escherichia coli O104:H4 str. Ec12-0465]
 gb|EKZ87398.1| protein grpE [Escherichia coli O104:H4 str. Ec11-9941]
 gb|EKZ92611.1| protein grpE [Escherichia coli O104:H4 str. Ec12-0466]
 gb|ELB97899.1| protein grpE [Escherichia coli KTE2]
 gb|ELC06693.1| protein grpE [Escherichia coli KTE10]
 gb|ELC20031.1| protein grpE [Escherichia coli KTE12]
 gb|ELC26854.1| protein grpE [Escherichia coli KTE16]
 gb|ELC28522.1| protein grpE [Escherichia coli KTE15]
 gb|ELC35900.1| protein grpE [Escherichia coli KTE25]
 gb|ELC44928.1| protein grpE [Escherichia coli KTE21]
 gb|ELC45333.1| protein grpE [Escherichia coli KTE26]
 gb|ELC49356.1| protein grpE [Escherichia coli KTE28]
 gb|ELC54789.1| protein grpE [Escherichia coli KTE39]
 gb|ELC58436.1| protein grpE [Escherichia coli KTE44]
 gb|ELC63527.1| protein grpE [Escherichia coli KTE178]
 gb|ELC70912.1| protein grpE [Escherichia coli KTE187]
 gb|ELC73249.1| protein grpE [Escherichia coli KTE181]
 gb|ELC80521.1| protein grpE [Escherichia coli KTE188]
 gb|ELC82923.1| protein grpE [Escherichia coli KTE189]
 gb|ELC90420.1| protein grpE [Escherichia coli KTE191]
 gb|ELC97898.1| protein grpE [Escherichia coli KTE201]
 gb|ELD04582.1| protein grpE [Escherichia coli KTE204]
 gb|ELD13264.1| protein grpE [Escherichia coli KTE206]
 gb|ELD19370.1| protein grpE [Escherichia coli KTE208]
 gb|ELD28611.1| protein grpE [Escherichia coli KTE212]
 gb|ELD32728.1| protein grpE [Escherichia coli KTE213]
 gb|ELD37122.1| protein grpE [Escherichia coli KTE214]
 gb|ELD40736.1| protein grpE [Escherichia coli KTE216]
 gb|ELD48411.1| protein grpE [Escherichia coli KTE220]
 gb|ELD51830.1| protein grpE [Escherichia coli KTE224]
 gb|ELD59796.1| protein grpE [Escherichia coli KTE228]
 gb|ELD60403.1| protein grpE [Escherichia coli KTE230]
 gb|ELD68734.1| protein grpE [Escherichia coli KTE234]
 gb|ELD71904.1| protein grpE [Escherichia coli KTE233]
 gb|ELD77227.1| protein grpE [Escherichia coli KTE235]
 gb|ELD89046.1| protein grpE [Escherichia coli KTE47]
 gb|ELD95970.1| protein grpE [Escherichia coli KTE49]
 gb|ELD98281.1| protein grpE [Escherichia coli KTE51]
 gb|ELE04094.1| protein grpE [Escherichia coli KTE53]
 gb|ELE17662.1| protein grpE [Escherichia coli KTE56]
 gb|ELE29242.1| protein grpE [Escherichia coli KTE60]
 gb|ELE39286.1| protein grpE [Escherichia coli KTE67]
 gb|ELE49003.1| protein grpE [Escherichia coli KTE72]
 gb|ELE53865.1| protein grpE [Escherichia coli KTE75]
 gb|ELE62779.1| protein grpE [Escherichia coli KTE77]
 gb|ELE69468.1| protein grpE [Escherichia coli KTE80]
 gb|ELE70163.1| protein grpE [Escherichia coli KTE81]
 gb|ELE79416.1| protein grpE [Escherichia coli KTE86]
 gb|ELE80827.1| protein grpE [Escherichia coli KTE83]
 gb|ELE88996.1| protein grpE [Escherichia coli KTE87]
 gb|ELE89408.1| protein grpE [Escherichia coli KTE93]
 gb|ELE97562.1| protein grpE [Escherichia coli KTE111]
 gb|ELE98630.1| protein grpE [Escherichia coli KTE116]
 gb|ELF08061.1| protein grpE [Escherichia coli KTE119]
 gb|ELF11414.1| protein grpE [Escherichia coli KTE142]
 gb|ELF18251.1| protein grpE [Escherichia coli KTE156]
 gb|ELF28641.1| protein grpE [Escherichia coli KTE162]
 gb|ELF33010.1| protein grpE [Escherichia coli KTE161]
 gb|ELF36692.1| protein grpE [Escherichia coli KTE171]
 gb|ELF36888.1| protein grpE [Escherichia coli KTE169]
 gb|ELF48695.1| protein grpE [Escherichia coli KTE8]
 gb|ELF49944.1| protein grpE [Escherichia coli KTE6]
 gb|ELF53558.1| protein grpE [Escherichia coli KTE9]
 gb|ELF56374.1| protein grpE [Escherichia coli KTE17]
 gb|ELF63522.1| protein grpE [Escherichia coli KTE18]
 gb|ELF65210.1| protein grpE [Escherichia coli KTE45]
 gb|ELF71853.1| protein grpE [Escherichia coli KTE42]
 gb|ELF73706.1| protein grpE [Escherichia coli KTE23]
 gb|ELF81287.1| protein grpE [Escherichia coli KTE43]
 gb|ELF85420.1| protein grpE [Escherichia coli KTE29]
 gb|ELF95247.1| protein grpE [Escherichia coli KTE46]
 gb|ELF97568.1| protein grpE [Escherichia coli KTE48]
 gb|ELG01982.1| protein grpE [Escherichia coli KTE50]
 gb|ELG04935.1| protein grpE [Escherichia coli KTE54]
 gb|ELG16253.1| protein grpE [Escherichia coli KTE63]
 gb|ELG25838.1| protein grpE [Escherichia coli KTE78]
 gb|ELG37751.1| protein grpE [Escherichia coli KTE79]
 gb|ELG40923.1| protein grpE [Escherichia coli KTE91]
 gb|ELG47934.1| protein grpE [Escherichia coli KTE101]
 gb|ELG68446.1| protein grpE [Escherichia coli KTE135]
 gb|ELG68511.1| protein grpE [Escherichia coli KTE136]
 gb|ELG71762.1| protein grpE [Escherichia coli KTE140]
 gb|ELG77568.1| protein grpE [Escherichia coli KTE141]
 gb|ELG92999.1| protein grpE [Escherichia coli KTE147]
 gb|ELG98019.1| protein grpE [Escherichia coli KTE158]
 gb|ELH01864.1| protein grpE [Escherichia coli KTE154]
 gb|ELH13086.1| protein grpE [Escherichia coli KTE194]
 gb|ELH14704.1| protein grpE [Escherichia coli KTE165]
 gb|ELH20070.1| protein grpE [Escherichia coli KTE190]
 gb|ELH22890.1| protein grpE [Escherichia coli KTE173]
 gb|ELH24220.1| protein grpE [Escherichia coli KTE175]
 gb|ELH32487.1| protein grpE [Escherichia coli KTE184]
 gb|ELH36465.1| protein grpE [Escherichia coli KTE196]
 gb|ELH42813.1| protein grpE [Escherichia coli KTE183]
 gb|ELH46593.1| protein grpE [Escherichia coli KTE197]
 gb|ELH50026.1| protein grpE [Escherichia coli KTE203]
 gb|ELH52291.1| protein grpE [Escherichia coli KTE202]
 gb|ELH60392.1| protein grpE [Escherichia coli KTE207]
 gb|ELH67444.1| protein grpE [Escherichia coli KTE209]
 gb|ELH70106.1| protein grpE [Escherichia coli KTE211]
 gb|ELH75376.1| protein grpE [Escherichia coli KTE217]
 gb|ELH78057.1| protein grpE [Escherichia coli KTE215]
 gb|ELH82830.1| protein grpE [Escherichia coli KTE218]
 gb|ELH85862.1| protein grpE [Escherichia coli KTE223]
 gb|ELI06243.1| protein grpE [Escherichia coli KTE104]
 gb|ELI06344.1| protein grpE [Escherichia coli KTE105]
 gb|ELI10601.1| protein grpE [Escherichia coli KTE106]
 gb|ELI24441.1| protein grpE [Escherichia coli KTE113]
 gb|ELI29031.1| protein grpE [Escherichia coli KTE117]
 gb|ELI36796.1| protein grpE [Escherichia coli KTE120]
 gb|ELI41105.1| protein grpE [Escherichia coli KTE124]
 gb|ELI42301.1| protein grpE [Escherichia coli KTE122]
 gb|ELI52810.1| protein grpE [Escherichia coli KTE125]
 gb|ELI54526.1| protein grpE [Escherichia coli KTE128]
 gb|ELI65526.1| protein grpE [Escherichia coli KTE131]
 gb|ELI70469.1| protein grpE [Escherichia coli KTE133]
 gb|ELI73278.1| protein grpE [Escherichia coli KTE137]
 gb|ELI78746.1| protein grpE [Escherichia coli KTE138]
 gb|ELI83780.1| protein grpE [Escherichia coli KTE139]
 gb|ELI86975.1| protein grpE [Escherichia coli KTE145]
 gb|ELI94531.1| protein grpE [Escherichia coli KTE148]
 gb|ELI95799.1| protein grpE [Escherichia coli KTE150]
 gb|ELJ01285.1| protein grpE [Escherichia coli KTE153]
 gb|ELJ11064.1| protein grpE [Escherichia coli KTE160]
 gb|ELJ12938.1| protein grpE [Escherichia coli KTE163]
 gb|ELJ22350.1| protein grpE [Escherichia coli KTE166]
 gb|ELJ25819.1| protein grpE [Escherichia coli KTE167]
 gb|ELJ27515.1| protein grpE [Escherichia coli KTE168]
 gb|ELJ36007.1| protein grpE [Escherichia coli KTE174]
 gb|ELJ42664.1| protein grpE [Escherichia coli KTE177]
 gb|ELJ56382.1| protein grpE [Escherichia coli KTE232]
 gb|ELJ64977.1| protein grpE [Escherichia coli KTE82]
 gb|ELJ69625.1| protein grpE [Escherichia coli KTE88]
 gb|ELJ78972.1| protein grpE [Escherichia coli KTE90]
 gb|ELJ83699.1| protein grpE [Escherichia coli KTE95]
 gb|ELJ83983.1| protein grpE [Escherichia coli KTE94]
 gb|ELJ93000.1| protein grpE [Escherichia coli KTE97]
 gb|ELJ97228.1| protein grpE [Escherichia coli KTE99]
 gb|ELL43066.1| heat shock protein [Escherichia coli J96]
 emb|CCP98037.1| Heat shock protein GrpE [Escherichia coli O10:K5(L):H4 str. ATCC
           23506]
 emb|CCQ02804.1| Heat shock protein GrpE [Escherichia coli O5:K4(L):H4 str. ATCC
           23502]
 emb|CCQ05586.1| Heat shock protein GrpE [Escherichia coli Nissle 1917]
 gb|AGC88078.1| heat shock protein [Escherichia coli APEC O78]
 gb|ELV18974.1| protein grpE [Escherichia coli 09BKT078844]
 gb|ELV48855.1| protein grpE [Escherichia coli 99.1753]
 gb|ELV54856.1| protein grpE [Escherichia coli 99.1793]
 gb|ELV67999.1| protein grpE [Escherichia coli PA11]
 gb|ELV68042.1| protein grpE [Escherichia coli ATCC 700728]
 gb|ELV69706.1| protein grpE [Escherichia coli 99.1805]
 gb|ELV97335.1| protein grpE [Escherichia coli PA48]
 gb|ELW11351.1| protein grpE [Escherichia coli 7.1982]
 gb|ELW13713.1| protein grpE [Escherichia coli 99.1781]
 gb|ELW31625.1| protein grpE [Escherichia coli 3.4880]
 gb|ELW35707.1| protein grpE [Escherichia coli 95.0083]
 gb|ELW41335.1| protein grpE [Escherichia coli 99.0670]
 gb|EMR93945.1| heat shock protein [Escherichia coli ONT:H33 str. C48/93]
 gb|EMR99425.1| heat shock protein [Escherichia coli O104:H4 str. E92/11]
 gb|EMS01181.1| heat shock protein [Escherichia coli O104:H4 str. E112/10]
 gb|EMS07289.1| heat shock protein [Escherichia coli O127:H27 str. C43/90]
 gb|EMU60309.1| protein grpE [Escherichia coli MP021552.11]
 gb|EMU60480.1| protein grpE [Escherichia coli MP021552.7]
 gb|EMU68789.1| protein grpE [Escherichia coli MP021552.12]
 gb|EMU77145.1| protein grpE [Escherichia coli MP021017.9]
 gb|EMU79941.1| protein grpE [Escherichia coli MP021017.6]
 gb|EMU82049.1| protein grpE [Escherichia coli MP021017.5]
 gb|EMU92029.1| protein grpE [Escherichia coli MP021017.4]
 gb|EMU93738.1| protein grpE [Escherichia coli MP021017.3]
 gb|EMU96844.1| protein grpE [Escherichia coli MP021017.2]
 gb|EMV05469.1| protein grpE [Escherichia coli MP021017.10]
 gb|EMV10247.1| protein grpE [Escherichia coli MP021017.11]
 gb|EMV18498.1| protein grpE [Escherichia coli C-34666]
 gb|EMV21241.1| protein grpE [Escherichia coli MP021017.12]
 gb|EMV38005.1| protein grpE [Escherichia coli 2875000]
 gb|EMV40145.1| protein grpE [Escherichia coli BCE019_MS-13]
 gb|EMV45527.1| protein grpE [Escherichia coli 2872800]
 gb|EMV70435.1| protein grpE [Escherichia coli 2866550]
 gb|EMV74810.1| protein grpE [Escherichia coli 2866750]
 gb|EMV89180.1| protein grpE [Escherichia coli 2865200]
 gb|EMW01327.1| protein grpE [Escherichia coli 2853500]
 gb|EMW01936.1| protein grpE [Escherichia coli 2851500]
 gb|EMW07233.1| protein grpE [Escherichia coli 2850750]
 gb|EMW17882.1| protein grpE [Escherichia coli 2850400]
 gb|EMW18291.1| protein grpE [Escherichia coli 2845650]
 gb|EMW23038.1| protein grpE [Escherichia coli 2848050]
 gb|EMW30472.1| protein grpE [Escherichia coli 2845350]
 gb|EMW41066.1| protein grpE [Escherichia coli 2788150]
 gb|EMW47917.1| protein grpE [Escherichia coli 2780750]
 gb|EMW57167.1| protein grpE [Escherichia coli 2762100]
 gb|EMW77752.1| protein grpE [Escherichia coli 2731150]
 gb|EMW86810.1| protein grpE [Escherichia coli 180050]
 gb|EMW94387.1| protein grpE [Escherichia coli ThroopD]
 gb|EMX00734.1| protein grpE [Escherichia coli 174750]
 gb|EMX13989.1| protein grpE [Escherichia coli P0302293.2]
 gb|EMX18243.1| protein grpE [Escherichia coli P0301867.1]
 gb|EMX22500.1| protein grpE [Escherichia coli MP021566.1]
 gb|EMX30052.1| protein grpE [Escherichia coli MP021561.2]
 gb|EMX34775.1| protein grpE [Escherichia coli MP021552.8]
 gb|EMX38016.1| protein grpE [Escherichia coli MP021017.1]
 gb|EMX48458.1| protein grpE [Escherichia coli MP020980.2]
 gb|EMX50362.1| protein grpE [Escherichia coli Jurua 20/10]
 gb|EMX54684.1| protein grpE [Escherichia coli MP020940.1]
 gb|EMX62267.1| protein grpE [Escherichia coli Jurua 18/11]
 gb|EMX76096.1| protein grpE [Escherichia coli 2726800]
 gb|EMX84600.1| protein grpE [Escherichia coli 2719100]
 gb|EMX92145.1| protein grpE [Escherichia coli 2720900]
 gb|EMZ42349.1| protein grpE [Escherichia coli SWW33]
 gb|EMZ63285.1| protein grpE [Escherichia coli 174900]
 gb|EMZ66841.1| protein grpE [Escherichia coli 2735000]
 gb|EMZ68883.1| protein grpE [Escherichia coli 2846750]
 gb|EMZ79941.1| protein grpE [Escherichia coli 2722950]
 gb|EMZ91174.1| protein grpE [Escherichia coli P0305260.1]
 gb|EMZ97065.1| protein grpE [Escherichia coli P0304816.1]
 gb|ENA04311.1| protein grpE [Escherichia coli P0299917.1]
 gb|ENA13785.1| protein grpE [Escherichia coli BCE008_MS-13]
 gb|ENA14547.1| protein grpE [Escherichia coli P0298942.1]
 gb|ENA19315.1| protein grpE [Escherichia coli 201600.1]
 gb|ENA30163.1| protein grpE [Escherichia coli BCE007_MS-11]
 gb|ENA38865.1| protein grpE [Escherichia coli P0301867.4]
 gb|ENA44339.1| protein grpE [Escherichia coli P0301867.2]
 gb|ENA51995.1| protein grpE [Escherichia coli 2726950]
 gb|ENA63533.1| protein grpE [Escherichia coli 179550]
 gb|ENA67349.1| protein grpE [Escherichia coli 180200]
 gb|ENA81749.1| protein grpE [Escherichia coli 2730350]
 gb|ENA94582.1| protein grpE [Escherichia coli 2864350]
 gb|ENA97447.1| protein grpE [Escherichia coli 2862600]
 gb|ENB11976.1| protein grpE [Escherichia coli 2875150]
 gb|ENB14981.1| protein grpE [Escherichia coli BCE008_MS-01]
 gb|ENB21229.1| protein grpE [Escherichia coli BCE011_MS-01]
 gb|ENB26939.1| protein grpE [Escherichia coli BCE030_MS-09]
 gb|ENB33726.1| protein grpE [Escherichia coli BCE032_MS-12]
 gb|ENB36750.1| protein grpE [Escherichia coli MP021561.3]
 gb|ENB39936.1| protein grpE [Escherichia coli P0298942.10]
 gb|ENB47441.1| protein grpE [Escherichia coli P0298942.11]
 gb|ENB54141.1| protein grpE [Escherichia coli P0298942.14]
 gb|ENB60754.1| protein grpE [Escherichia coli P0298942.15]
 gb|ENB61220.1| protein grpE [Escherichia coli P0298942.6]
 gb|ENB64021.1| protein grpE [Escherichia coli P0298942.2]
 gb|ENB76337.1| protein grpE [Escherichia coli P0298942.8]
 gb|ENB77323.1| protein grpE [Escherichia coli P0298942.7]
 gb|ENB78459.1| protein grpE [Escherichia coli P0298942.9]
 gb|ENB87047.1| protein grpE [Escherichia coli P0299438.10]
 gb|ENB94413.1| protein grpE [Escherichia coli P0299438.11]
 gb|ENB98412.1| protein grpE [Escherichia coli P0299438.3]
 gb|ENC03177.1| protein grpE [Escherichia coli P0299438.4]
 gb|ENC10144.1| protein grpE [Escherichia coli P0299438.5]
 gb|ENC15394.1| protein grpE [Escherichia coli P0299438.6]
 gb|ENC17298.1| protein grpE [Escherichia coli P0299438.7]
 gb|ENC24246.1| protein grpE [Escherichia coli P0299438.8]
 gb|ENC31011.1| protein grpE [Escherichia coli P0299438.9]
 gb|ENC31295.1| protein grpE [Escherichia coli P02997067.6]
 gb|ENC39433.1| protein grpE [Escherichia coli P0299917.10]
 gb|ENC45960.1| protein grpE [Escherichia coli P0299917.2]
 gb|ENC54045.1| protein grpE [Escherichia coli P0299917.3]
 gb|ENC54698.1| protein grpE [Escherichia coli P0299917.4]
 gb|ENC60502.1| protein grpE [Escherichia coli P0299917.5]
 gb|ENC70135.1| protein grpE [Escherichia coli P0299917.8]
 gb|ENC70177.1| protein grpE [Escherichia coli P0299917.6]
 gb|ENC78100.1| protein grpE [Escherichia coli P0299917.7]
 gb|ENC83050.1| protein grpE [Escherichia coli P0299917.9]
 gb|ENC90537.1| protein grpE [Escherichia coli P0301867.11]
 gb|ENC94863.1| protein grpE [Escherichia coli P0301867.8]
 gb|END31907.1| protein grpE [Escherichia coli 179100]
 gb|END39979.1| protein grpE [Escherichia coli 2854350]
 gb|END51519.1| protein grpE [Escherichia coli MP020980.1]
 gb|END57217.1| protein grpE [Escherichia coli BCE006_MS-23]
 gb|END66311.1| protein grpE [Escherichia coli P0298942.4]
 gb|END67272.1| protein grpE [Escherichia coli P0299483.1]
 gb|END67521.1| protein grpE [Escherichia coli P0298942.3]
 gb|END78472.1| protein grpE [Escherichia coli P0299483.2]
 gb|END81537.1| protein grpE [Escherichia coli P0299483.3]
 gb|END90793.1| protein grpE [Escherichia coli P0301867.13]
 gb|END92371.1| protein grpE [Escherichia coli P0301904.3]
 gb|END98142.1| protein grpE [Escherichia coli P0302293.7]
 gb|ENE07071.1| protein grpE [Escherichia coli P0305260.2]
 gb|ENE07423.1| protein grpE [Escherichia coli P0304799.3]
 gb|ENE21255.1| protein grpE [Escherichia coli P0302293.10]
 gb|ENE21869.1| protein grpE [Escherichia coli P0302293.3]
 gb|ENE29097.1| protein grpE [Escherichia coli P0302293.4]
 gb|ENE50936.1| protein grpE [Escherichia coli P0302293.9]
 gb|ENF18528.1| protein grpE [Escherichia coli P0304816.11]
 gb|ENF23320.1| protein grpE [Escherichia coli P0304816.10]
 gb|ENF29860.1| protein grpE [Escherichia coli P0304816.12]
 gb|ENF33626.1| protein grpE [Escherichia coli P0304816.14]
 gb|ENF39732.1| protein grpE [Escherichia coli P0304816.13]
 gb|ENF46099.1| protein grpE [Escherichia coli P0304816.15]
 gb|ENF51040.1| protein grpE [Escherichia coli P0304816.6]
 gb|ENF67594.1| protein grpE [Escherichia coli P0304816.8]
 gb|ENF70809.1| protein grpE [Escherichia coli P0304816.9]
 gb|ENF74973.1| protein grpE [Escherichia coli P0305260.10]
 gb|ENF82348.1| protein grpE [Escherichia coli P0305260.11]
 gb|ENF84795.1| protein grpE [Escherichia coli P0305260.12]
 gb|ENF90120.1| protein grpE [Escherichia coli P0305260.13]
 gb|ENF96012.1| protein grpE [Escherichia coli P0305260.15]
 gb|ENG11473.1| protein grpE [Escherichia coli P0305260.5]
 gb|ENG16217.1| protein grpE [Escherichia coli P0305260.6]
 gb|ENG33324.1| protein grpE [Escherichia coli P0305260.9]
 gb|ENG81952.1| protein grpE [Escherichia coli 178200]
 gb|ENG84047.1| protein grpE [Escherichia coli P0298942.12]
 gb|ENG91948.1| protein grpE [Escherichia coli 178850]
 gb|ENG96142.1| protein grpE [Escherichia coli P0301867.3]
 gb|ENH01661.1| protein grpE [Escherichia coli P0301867.5]
 gb|ENH08133.1| protein grpE [Escherichia coli P0301867.7]
 gb|ENH31748.1| protein grpE [Escherichia coli P0304816.3]
 gb|ENH39170.1| protein grpE [Escherichia coli P0304816.5]
 gb|ENO07424.1| heat shock protein [Escherichia coli O157:H43 str. T22]
 gb|EOR54598.1| heat shock protein [Escherichia coli ATCC 25922]
 gb|EOU31680.1| protein grpE [Escherichia coli KTE13]
 gb|EOU47305.1| protein grpE [Escherichia coli KTE35]
 gb|EOU49949.1| protein grpE [Escherichia coli KTE231]
 gb|EOU56957.1| protein grpE [Escherichia coli KTE14]
 gb|EOU61852.1| protein grpE [Escherichia coli KTE19]
 gb|EOU65772.1| protein grpE [Escherichia coli KTE20]
 gb|EOU91379.1| protein grpE [Escherichia coli KTE34]
 gb|EOV06707.1| protein grpE [Escherichia coli KTE195]
 gb|EOV10865.1| protein grpE [Escherichia coli KTE40]
 gb|EOV17109.1| protein grpE [Escherichia coli KTE198]
 gb|EOV21713.1| protein grpE [Escherichia coli KTE200]
 gb|EOV37820.1| protein grpE [Escherichia coli KTE221]
 gb|EOV42279.1| protein grpE [Escherichia coli KTE222]
 gb|EOV50319.1| protein grpE [Escherichia coli KTE61]
 gb|EOV56463.1| protein grpE [Escherichia coli KTE64]
 gb|EOV58691.1| protein grpE [Escherichia coli KTE68]
 gb|EOV75167.1| protein grpE [Escherichia coli KTE71]
 gb|EOV77271.1| protein grpE [Escherichia coli KTE73]
 gb|EOV90214.1| protein grpE [Escherichia coli KTE89]
 gb|EOW04058.1| protein grpE [Escherichia coli KTE102]
 gb|EOW06041.1| protein grpE [Escherichia coli KTE100]
 gb|EOW13070.1| protein grpE [Escherichia coli KTE103]
 gb|EOW17051.1| protein grpE [Escherichia coli KTE108]
 gb|EOW21105.1| protein grpE [Escherichia coli KTE107]
 gb|EOW34773.1| protein grpE [Escherichia coli KTE127]
 gb|EOW39543.1| protein grpE [Escherichia coli KTE126]
 gb|EOW44042.1| protein grpE [Escherichia coli KTE130]
 gb|EOW46088.1| protein grpE [Escherichia coli KTE132]
 gb|EOW55383.1| protein grpE [Escherichia coli KTE134]
 gb|EOW58676.1| protein grpE [Escherichia coli KTE155]
 gb|EOW66995.1| protein grpE [Escherichia coli KTE170]
 gb|EOW74196.1| protein grpE [Escherichia sp. KTE172]
 gb|EOW90668.1| protein grpE [Escherichia coli KTE1]
 gb|EOW94690.1| protein grpE [Escherichia coli KTE41]
 gb|EOX04431.1| protein grpE [Escherichia coli KTE225]
 gb|EOX08190.1| protein grpE [Escherichia coli KTE226]
 gb|EOX22323.1| protein grpE [Escherichia coli KTE185]
 emb|CDC83016.1| protein GrpE [Escherichia coli CAG:4]
 gb|EQN01197.1| protein grpE [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN17462.1| protein grpE [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN25308.1| protein grpE [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN31118.1| protein grpE [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN33770.1| protein grpE [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN43245.1| protein grpE [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN46334.1| protein grpE [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN47724.1| protein grpE [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN52439.1| protein grpE [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN61002.1| protein grpE [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN63888.1| protein grpE [Escherichia coli HVH 18 (4-8589585)]
 gb|EQN74169.1| protein grpE [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN77490.1| protein grpE [Escherichia coli HVH 22 (4-2258986)]
 gb|EQN92216.1| protein grpE [Escherichia coli HVH 25 (4-5851939)]
 gb|EQN94821.1| protein grpE [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO03538.1| protein grpE [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO09082.1| protein grpE [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO17233.1| protein grpE [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO28325.1| protein grpE [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO37120.1| protein grpE [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO41586.1| protein grpE [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO45998.1| protein grpE [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO51734.1| protein grpE [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO67888.1| protein grpE [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO70470.1| protein grpE [Escherichia coli HVH 44 (4-2298570)]
 gb|EQO76705.1| protein grpE [Escherichia coli HVH 45 (4-3129918)]
 gb|EQO91088.1| protein grpE [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO98030.1| protein grpE [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP07276.1| protein grpE [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP10339.1| protein grpE [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP19649.1| protein grpE [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP24435.1| protein grpE [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP34300.1| protein grpE [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP34700.1| protein grpE [Escherichia coli HVH 65 (4-2262045)]
 gb|EQP36154.1| protein grpE [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP48251.1| protein grpE [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP49330.1| protein grpE [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP68922.1| protein grpE [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP69865.1| protein grpE [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP88004.1| protein grpE [Escherichia coli HVH 82 (4-2209276)]
 gb|EQP91065.1| protein grpE [Escherichia coli HVH 84 (4-1021478)]
 gb|EQP92524.1| protein grpE [Escherichia coli HVH 85 (4-0792144)]
 gb|EQQ02651.1| protein grpE [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ04346.1| protein grpE [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ13575.1| protein grpE [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ19841.1| protein grpE [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ23048.1| protein grpE [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ26262.1| protein grpE [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ38426.1| protein grpE [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ42712.1| protein grpE [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ51507.1| protein grpE [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ57390.1| protein grpE [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ64679.1| protein grpE [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ71809.1| protein grpE [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ73916.1| protein grpE [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ87231.1| protein grpE [Escherichia coli HVH 112 (4-5987253)]
 gb|EQQ87650.1| protein grpE [Escherichia coli HVH 113 (4-7535473)]
 gb|EQQ89083.1| protein grpE [Escherichia coli HVH 114 (4-7037740)]
 gb|EQR05659.1| protein grpE [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR13681.1| protein grpE [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR19166.1| protein grpE [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR27669.1| protein grpE [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR32055.1| protein grpE [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR37596.1| protein grpE [Escherichia coli HVH 121 (4-6877826)]
 gb|EQR41644.1| protein grpE [Escherichia coli HVH 125 (4-2634716)]
 gb|EQR62820.1| protein grpE [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR65264.1| protein grpE [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR76112.1| protein grpE [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR78862.1| protein grpE [Escherichia coli HVH 135 (4-4449320)]
 gb|EQR85560.1| protein grpE [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR92986.1| protein grpE [Escherichia coli HVH 138 (4-6066704)]
 gb|EQS02686.1| protein grpE [Escherichia coli HVH 140 (4-5894387)]
 gb|EQS03777.1| protein grpE [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS11731.1| protein grpE [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS16852.1| protein grpE [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS18535.1| protein grpE [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS24911.1| protein grpE [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS34478.1| protein grpE [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS37912.1| protein grpE [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS47118.1| protein grpE [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS49654.1| protein grpE [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS53895.1| protein grpE [Escherichia coli HVH 150 (4-3258106)]
 gb|EQS61000.1| protein grpE [Escherichia coli HVH 158 (4-3224287)]
 gb|EQS65180.1| protein grpE [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS65920.1| protein grpE [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS78522.1| protein grpE [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS79101.1| protein grpE [Escherichia coli HVH 162 (4-5627982)]
 gb|EQS88243.1| protein grpE [Escherichia coli HVH 167 (4-6073565)]
 gb|EQS91745.1| protein grpE [Escherichia coli HVH 164 (4-5953081)]
 gb|EQS94844.1| protein grpE [Escherichia coli HVH 169 (4-1075578)]
 gb|EQS98699.1| protein grpE [Escherichia coli HVH 171 (4-3191958)]
 gb|EQT11132.1| protein grpE [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT13554.1| protein grpE [Escherichia coli HVH 172 (4-3248542)]
 gb|EQT21101.1| protein grpE [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT36263.1| protein grpE [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT38392.1| protein grpE [Escherichia coli HVH 182 (4-0985554)]
 gb|EQT49252.1| protein grpE [Escherichia coli HVH 185 (4-2876639)]
 gb|EQT55309.1| protein grpE [Escherichia coli HVH 186 (4-3405044)]
 gb|EQT71095.1| protein grpE [Escherichia coli HVH 190 (4-3255514)]
 gb|EQT74648.1| protein grpE [Escherichia coli HVH 189 (4-3220125)]
 gb|EQT88784.1| protein grpE [Escherichia coli HVH 193 (4-3331423)]
 gb|EQT93123.1| protein grpE [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU11453.1| protein grpE [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU15874.1| protein grpE [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU22716.1| protein grpE [Escherichia coli HVH 200 (4-4449924)]
 gb|EQU33774.1| protein grpE [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU41010.1| protein grpE [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU47369.1| protein grpE [Escherichia coli HVH 205 (4-3094677)]
 gb|EQU47518.1| protein grpE [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU54646.1| protein grpE [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU59291.1| protein grpE [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU73395.1| protein grpE [Escherichia coli HVH 209 (4-3062651)]
 gb|EQU73448.1| protein grpE [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU84555.1| protein grpE [Escherichia coli HVH 215 (4-3008371)]
 gb|EQU93267.1| protein grpE [Escherichia coli HVH 216 (4-3042952)]
 gb|EQV00020.1| protein grpE [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV07630.1| protein grpE [Escherichia coli HVH 221 (4-3136817)]
 gb|EQV07801.1| protein grpE [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV18926.1| protein grpE [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV25619.1| protein grpE [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV31850.1| protein grpE [Escherichia coli KOEGE 30 (63a)]
 gb|EQV45001.1| protein grpE [Escherichia coli KOEGE 33 (68a)]
 gb|EQV50758.1| protein grpE [Escherichia coli KOEGE 40 (102a)]
 gb|EQV53836.1| protein grpE [Escherichia coli KOEGE 43 (105a)]
 gb|EQV55877.1| protein grpE [Escherichia coli KOEGE 44 (106a)]
 gb|EQV66214.1| protein grpE [Escherichia coli KOEGE 61 (174a)]
 gb|EQV66407.1| protein grpE [Escherichia coli KOEGE 56 (169a)]
 gb|EQV68652.1| protein grpE [Escherichia coli KOEGE 58 (171a)]
 gb|EQV78662.1| protein grpE [Escherichia coli KOEGE 68 (182a)]
 gb|EQV83175.1| protein grpE [Escherichia coli KOEGE 70 (185a)]
 gb|EQV85106.1| protein grpE [Escherichia coli KOEGE 62 (175a)]
 gb|EQW00176.1| protein grpE [Escherichia coli KOEGE 73 (195a)]
 gb|EQW00020.1| protein grpE [Escherichia coli KOEGE 77 (202a)]
 gb|EQW07133.1| protein grpE [Escherichia coli KOEGE 118 (317a)]
 gb|EQW11223.1| protein grpE [Escherichia coli KOEGE 131 (358a)]
 gb|EQW16380.1| protein grpE [Escherichia coli UMEA 3014-1]
 gb|EQW18283.1| protein grpE [Escherichia coli UMEA 3022-1]
 gb|EQW31122.1| protein grpE [Escherichia coli UMEA 3052-1]
 gb|EQW40774.1| protein grpE [Escherichia coli UMEA 3053-1]
 gb|EQW42707.1| protein grpE [Escherichia coli UMEA 3065-1]
 gb|EQW49910.1| protein grpE [Escherichia coli UMEA 3087-1]
 gb|EQW54134.1| protein grpE [Escherichia coli UMEA 3097-1]
 gb|EQW65134.1| protein grpE [Escherichia coli UMEA 3108-1]
 gb|EQW68078.1| protein grpE [Escherichia coli UMEA 3113-1]
 gb|EQW78355.1| protein grpE [Escherichia coli UMEA 3121-1]
 gb|EQW78439.1| protein grpE [Escherichia coli UMEA 3117-1]
 gb|EQW86171.1| protein grpE [Escherichia coli UMEA 3124-1]
 gb|EQW92178.1| protein grpE [Escherichia coli UMEA 3139-1]
 gb|EQX00195.1| protein grpE [Escherichia coli UMEA 3152-1]
 gb|EQX04199.1| protein grpE [Escherichia coli UMEA 3155-1]
 gb|EQX09538.1| protein grpE [Escherichia coli UMEA 3159-1]
 gb|EQX13401.1| protein grpE [Escherichia coli UMEA 3161-1]
 gb|EQX19027.1| protein grpE [Escherichia coli UMEA 3160-1]
 gb|EQX33885.1| protein grpE [Escherichia coli UMEA 3172-1]
 gb|EQX42103.1| protein grpE [Escherichia coli UMEA 3175-1]
 gb|EQX43055.1| protein grpE [Escherichia coli UMEA 3173-1]
 gb|EQX50215.1| protein grpE [Escherichia coli UMEA 3174-1]
 gb|EQX55348.1| protein grpE [Escherichia coli UMEA 3176-1]
 gb|EQX55923.1| protein grpE [Escherichia coli UMEA 3178-1]
 gb|EQX65267.1| protein grpE [Escherichia coli UMEA 3185-1]
 gb|EQX74416.1| protein grpE [Escherichia coli UMEA 3180-1]
 gb|EQX75304.1| protein grpE [Escherichia coli UMEA 3193-1]
 gb|EQX82770.1| protein grpE [Escherichia coli UMEA 3199-1]
 gb|EQX86781.1| protein grpE [Escherichia coli UMEA 3200-1]
 gb|EQX93697.1| protein grpE [Escherichia coli UMEA 3201-1]
 gb|EQY10232.1| protein grpE [Escherichia coli UMEA 3208-1]
 gb|EQY18437.1| protein grpE [Escherichia coli UMEA 3212-1]
 gb|EQY21133.1| protein grpE [Escherichia coli UMEA 3216-1]
 gb|EQY27727.1| protein grpE [Escherichia coli UMEA 3217-1]
 gb|EQY31772.1| protein grpE [Escherichia coli UMEA 3220-1]
 gb|EQY38873.1| protein grpE [Escherichia coli UMEA 3221-1]
 gb|EQY42407.1| protein grpE [Escherichia coli UMEA 3230-1]
 gb|EQY43118.1| protein grpE [Escherichia coli UMEA 3222-1]
 gb|EQY54679.1| protein grpE [Escherichia coli UMEA 3244-1]
 gb|EQY54740.1| protein grpE [Escherichia coli UMEA 3233-1]
 gb|EQY58430.1| protein grpE [Escherichia coli UMEA 3240-1]
 gb|EQY66268.1| protein grpE [Escherichia coli UMEA 3264-1]
 gb|EQY69691.1| protein grpE [Escherichia coli UMEA 3257-1]
 gb|EQY76206.1| protein grpE [Escherichia coli UMEA 3268-1]
 gb|EQY87230.1| protein grpE [Escherichia coli UMEA 3314-1]
 gb|EQY88410.1| protein grpE [Escherichia coli UMEA 3317-1]
 gb|EQY97814.1| protein grpE [Escherichia coli UMEA 3329-1]
 gb|EQY99987.1| protein grpE [Escherichia coli UMEA 3337-1]
 gb|EQZ00262.1| protein grpE [Escherichia coli UMEA 3318-1]
 gb|EQZ10559.1| protein grpE [Escherichia coli UMEA 3341-1]
 gb|EQZ13042.1| protein grpE [Escherichia coli UMEA 3355-1]
 gb|EQZ17824.1| protein grpE [Escherichia coli UMEA 3391-1]
 gb|EQZ23640.1| protein grpE [Escherichia coli UMEA 3490-1]
 gb|EQZ32588.1| protein grpE [Escherichia coli UMEA 3585-1]
 gb|EQZ34921.1| protein grpE [Escherichia coli UMEA 3592-1]
 gb|EQZ38614.1| protein grpE [Escherichia coli UMEA 3609-1]
 gb|EQZ38904.1| protein grpE [Escherichia coli UMEA 3617-1]
 gb|EQZ51864.1| protein grpE [Escherichia coli UMEA 3656-1]
 gb|EQZ63838.1| protein grpE [Escherichia coli UMEA 3682-1]
 gb|EQZ73780.1| protein grpE [Escherichia coli UMEA 3687-1]
 gb|EQZ75538.1| protein grpE [Escherichia coli UMEA 3694-1]
 gb|EQZ89358.1| protein grpE [Escherichia coli UMEA 3707-1]
 gb|EQZ89420.1| protein grpE [Escherichia coli UMEA 3703-1]
 gb|EQZ94356.1| protein grpE [Escherichia coli UMEA 3705-1]
 gb|ERA04633.1| protein grpE [Escherichia coli UMEA 3805-1]
 gb|ERA17041.1| protein grpE [Escherichia coli UMEA 3889-1]
 gb|ERA31965.1| protein grpE [Escherichia coli UMEA 3955-1]
 gb|ERA35461.1| protein grpE [Escherichia coli UMEA 4075-1]
 gb|ERA44781.1| protein grpE [Escherichia coli UMEA 4207-1]
 gb|ERA48604.1| protein grpE [Escherichia coli UMEA 4076-1]
 gb|ERA58317.1| heat shock protein GrpE [Escherichia coli 95NR1]
 gb|ERA66949.1| protein grpE [Escherichia coli HVH 155 (4-4509048)]
 gb|ERA70883.1| protein grpE [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA72442.1| protein grpE [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA79284.1| protein grpE [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA84669.1| protein grpE [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA93522.1| protein grpE [Escherichia coli HVH 228 (4-7787030)]
 gb|ERA99619.1| protein grpE [Escherichia coli KOEGE 3 (4a)]
 gb|ERB05794.1| protein grpE [Escherichia coli KOEGE 7 (16a)]
 gb|ERB14263.1| protein grpE [Escherichia coli UMEA 3144-1]
 gb|ERB19661.1| protein grpE [Escherichia coli UMEA 3151-1]
 gb|ERB20964.1| protein grpE [Escherichia coli UMEA 3150-1]
 gb|ERB26862.1| protein grpE [Escherichia coli UMEA 3271-1]
 gb|ERB33783.1| protein grpE [Escherichia coli UMEA 3292-1]
 gb|ERB73007.1| protein grpE [Escherichia coli B102]
 gb|ERB77502.1| protein grpE [Escherichia coli B107]
 gb|ERB87329.1| protein grpE [Escherichia coli B26-1]
 gb|ERB88574.1| protein grpE [Escherichia coli B26-2]
 gb|ERC56293.1| protein grpE [Escherichia coli TW07509]
 gb|ERC59131.1| protein grpE [Escherichia coli 08BKT055439]
 gb|ERC64863.1| protein grpE [Escherichia coli Bd5610_99]
 gb|ERC77617.1| protein grpE [Escherichia coli T234_00]
 gb|ERC81807.1| protein grpE [Escherichia coli 14A]
 gb|ERC84509.1| protein grpE [Escherichia coli T924_01]
 gb|ERC94224.1| protein grpE [Escherichia coli 2886-75]
 gb|ERC98335.1| protein grpE [Escherichia coli B103]
 gb|ERC98394.1| protein grpE [Escherichia coli B104]
 gb|ERD09220.1| protein grpE [Escherichia coli B105]
 gb|ERD13830.1| protein grpE [Escherichia coli B106]
 gb|ERD13905.1| protein grpE [Escherichia coli B108]
 gb|ERD25915.1| protein grpE [Escherichia coli B109]
 gb|ERD44067.1| protein grpE [Escherichia coli B15]
 gb|ERD48866.1| protein grpE [Escherichia coli B17]
 gb|ERD58134.1| protein grpE [Escherichia coli B40-2]
 gb|ERD60208.1| protein grpE [Escherichia coli B40-1]
 gb|ERD62697.1| protein grpE [Escherichia coli B49-2]
 gb|ERD71822.1| protein grpE [Escherichia coli B5-2]
 gb|ERD76405.1| protein grpE [Escherichia coli B83]
 gb|ERD79854.1| protein grpE [Escherichia coli B84]
 gb|ERD86748.1| protein grpE [Escherichia coli B85]
 gb|ERD91752.1| protein grpE [Escherichia coli B86]
 gb|ERE03320.1| protein grpE [Escherichia coli 08BKT77219]
 gb|ERE03848.1| heat shock protein GrpE [Escherichia coli 95JB1]
 gb|ERE13422.1| protein grpE [Escherichia coli 09BKT024447]
 gb|ERE17360.1| protein grpE [Escherichia coli T1282_01]
 gb|ERE32800.1| protein grpE [Escherichia coli Tx1686]
 gb|ERF53446.1| protein grpE [Escherichia coli UMEA 3652-1]
 gb|AGW09788.1| heat shock protein GrpE [Escherichia coli LY180]
 gb|ERO91670.1| protein grpE [Escherichia coli BWH 24]
 gb|ERO97582.1| protein grpE [Escherichia coli BIDMC 19C]
 gb|ESA28412.1| Heat shock protein GrpE [Escherichia coli SCD1]
 gb|ESA69934.1| co-chaperone GrpE [Escherichia coli 110957]
 gb|ESA71132.1| co-chaperone GrpE [Escherichia coli 113290]
 gb|ESA82810.1| co-chaperone GrpE [Escherichia coli 907357]
 gb|ESA90906.1| co-chaperone GrpE [Escherichia coli 907779]
 gb|ESA93833.1| co-chaperone GrpE [Escherichia coli 907713]
 gb|ESA99155.1| co-chaperone GrpE [Escherichia coli 909945-2]
 gb|ESC98504.1| co-chaperone GrpE [Escherichia coli 907446]
 gb|ESD01301.1| co-chaperone GrpE [Escherichia coli 907391]
 gb|ESD08614.1| co-chaperone GrpE [Escherichia coli 113302]
 gb|ESD10602.1| co-chaperone GrpE [Escherichia coli 907700]
 gb|ESD23388.1| co-chaperone GrpE [Escherichia coli 907701]
 gb|ESD23655.1| co-chaperone GrpE [Escherichia coli 907710]
 gb|ESD26283.1| co-chaperone GrpE [Escherichia coli 907715]
 gb|ESD32067.1| co-chaperone GrpE [Escherichia coli 907889]
 gb|ESD35402.1| co-chaperone GrpE [Escherichia coli 908519]
 gb|ESD36999.1| co-chaperone GrpE [Escherichia coli 907892]
 gb|ESD57584.1| co-chaperone GrpE [Escherichia coli 908521]
 gb|ESD58224.1| co-chaperone GrpE [Escherichia coli 908524]
 gb|ESD63858.1| co-chaperone GrpE [Escherichia coli 908522]
 gb|ESD64832.1| co-chaperone GrpE [Escherichia coli 908541]
 gb|ESD75719.1| co-chaperone GrpE [Escherichia coli 908555]
 gb|ESD83771.1| co-chaperone GrpE [Escherichia coli 908573]
 gb|ESD95300.1| co-chaperone GrpE [Escherichia coli 908616]
 gb|ESD97400.1| co-chaperone GrpE [Escherichia coli 908585]
 gb|ESE06315.1| co-chaperone GrpE [Escherichia coli 908658]
 gb|ESE06349.1| co-chaperone GrpE [Escherichia coli 908624]
 gb|ESE09146.1| co-chaperone GrpE [Escherichia coli 908632]
 gb|ESE14834.1| co-chaperone GrpE [Escherichia coli 908691]
 gb|ESE34894.1| co-chaperone GrpE [Escherichia coli A25922R]
 gb|ESE37845.1| co-chaperone GrpE [Escherichia coli A35218R]
 gb|AGY85350.1| heat shock protein GrpE [Escherichia coli JJ1886]
 gb|ESK02599.1| protein grpE [Escherichia coli HVH 98 (4-5799287)]
 gb|ESK05379.1| protein grpE [Escherichia coli UMEA 3336-1]
 gb|ESK13048.1| protein grpE [Escherichia coli HVH 50 (4-2593475)]
 gb|ESK16017.1| protein grpE [Escherichia coli UMEA 3426-1]
 gb|ESK16895.1| protein grpE [Escherichia coli UMEA 3290-1]
 gb|ESK27411.1| protein grpE [Escherichia coli UMEA 3693-1]
 gb|ESK28640.1| protein grpE [Escherichia coli UMEA 3342-1]
 gb|ESK34616.1| protein grpE [Escherichia coli UMEA 3323-1]
 gb|ESL20266.1| protein grpE [Escherichia coli BIDMC 39]
 gb|ESL36241.1| protein grpE [Escherichia coli BIDMC 37]
 gb|ESL38578.1| protein grpE [Escherichia coli BIDMC 38]
 gb|ESP16550.1| protein grpE [Escherichia coli HVH 136 (4-5970458)]
 gb|ESP21334.1| protein grpE [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP37570.1| protein grpE [Escherichia coli HVH 152 (4-3447545)]
 gb|ESP43800.1| protein grpE [Escherichia coli HVH 108 (4-6924867)]
 gb|ESP44216.1| protein grpE [Escherichia coli UMEA 3148-1]
 gb|ESS93437.1| Heat shock protein GrpE [Escherichia coli CE549]
 gb|AHA66580.1| GrpE protein [Shigella dysenteriae 1617]
 gb|EST63397.1| heat shock protein HSP70 cofactor [Escherichia coli ECC-Z]
 gb|EST68209.1| heat shock protein HSP70 cofactor [Escherichia coli P4-NR]
 gb|EST69213.1| heat shock protein HSP70 cofactor [Escherichia coli P4-96]
 gb|EST77290.1| heat shock protein HSP70 cofactor [Escherichia coli ECA-727]
 gb|EST82768.1| heat shock protein HSP70 cofactor [Escherichia coli ECC-1470]
 gb|EST84077.1| heat shock protein HSP70 cofactor [Escherichia coli ECA-0157]
 gb|ESU77732.1| GrpE protein [Shigella dysenteriae WRSd3]
 gb|ESU84281.1| GrpE protein [Shigella dysenteriae WRSd5]
 gb|ETD58033.1| heat shock protein GrpE [Escherichia coli ATCC BAA-2209]
 gb|ETE08934.1| heat shock protein GrpE [Escherichia coli LAU-EC8]
 gb|ETE18007.1| heat shock protein GrpE [Escherichia coli LAU-EC6]
 gb|ETE25213.1| heat shock protein GrpE [Escherichia coli LAU-EC7]
 gb|ETE36908.1| heat shock protein GrpE [Escherichia coli LAU-EC9]
 gb|ETF17303.1| protein grpE [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF17492.1| protein grpE [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF26932.1| protein grpE [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF34487.1| protein grpE [Escherichia coli UMEA 3489-1]
 gb|ETI79694.1| heat shock protein GrpE [Escherichia coli ATCC BAA-2196]
 gb|ETJ28243.1| Protein grpE [Escherichia coli DORA_A_5_14_21]
 gb|ETJ59420.1| heat shock protein GrpE [Escherichia coli ATCC BAA-2193]
 gb|ETJ70371.1| heat shock protein GrpE [Escherichia coli ATCC 35150]
 gb|ETJ78329.1| heat shock protein GrpE [Escherichia coli ATCC BAA-2192]
 emb|CDK53442.1| Heat shock protein GrpE [Escherichia coli IS5]
 emb|CDK81968.1| Heat shock protein GrpE [Escherichia coli IS25]
 emb|CDL30287.1| Heat shock protein GrpE [Escherichia coli ISC7]
 emb|CDK76603.1| Heat shock protein GrpE [Klebsiella pneumoniae IS22]
 emb|CDK57833.1| Heat shock protein GrpE [Escherichia coli IS9]
 emb|CDL03717.1| Heat shock protein GrpE [Escherichia coli IS35]
 emb|CDK86693.1| Heat shock protein GrpE [Escherichia coli IS29]
 gb|AHG15937.1| Heat shock protein GrpE [Escherichia coli O145:H28 str. RM13516]
 gb|AHG10103.1| Heat shock protein GrpE [Escherichia coli O145:H28 str. RM13514]
 gb|ETX80075.1| protein grpE [Escherichia coli BIDMC 43b]
 gb|ETX84621.1| protein grpE [Escherichia coli BIDMC 43a]
 gb|ETX90113.1| protein grpE [Escherichia coli BIDMC 20B]
 gb|ETX94383.1| protein grpE [Escherichia coli BIDMC 20A]
 gb|ETX98523.1| protein grpE [Escherichia coli BIDMC 19B]
 gb|ETY07505.1| protein grpE [Escherichia coli BIDMC 19A]
 gb|ETY12097.1| protein grpE [Escherichia coli BIDMC 17B]
 gb|ETY16732.1| protein grpE [Escherichia coli BIDMC 17A]
 gb|ETY25304.1| protein grpE [Escherichia coli BIDMC 15]
 gb|ETY31509.1| protein grpE [Escherichia coli BIDMC 9]
 gb|ETY31576.1| protein grpE [Escherichia coli BIDMC 3]
 gb|ETY38284.1| protein grpE [Escherichia coli BIDMC 2B]
 gb|ETY42286.1| protein grpE [Escherichia coli BWH 40]
 gb|ETY46030.1| protein grpE [Escherichia coli BWH 34]
 gb|ETY65627.1| protein grpE [Escherichia coli BIDMC 6]
 emb|CDL49733.1| Heat shock protein GrpE [Escherichia coli ISC41]
 gb|EWC55367.1| heat shock protein [Escherichia coli EC096/10]
 gb|EWY51366.1| heat shock protein GrpE [Escherichia coli MP1]
 gb|AHM32217.1| heat shock protein GrpE [Escherichia coli]
 gb|AHM33522.1| heat shock protein GrpE [Escherichia coli]
 gb|AHM38119.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB42356.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB47839.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB52258.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB56840.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB59529.1| heat shock protein GrpE [Escherichia coli]
 gb|EYB64696.1| heat shock protein GrpE [Escherichia coli]
 gb|EYD82762.1| protein grpE [Escherichia coli 1-176-05_S1_C1]
 gb|EYD84691.1| protein grpE [Escherichia coli 1-176-05_S3_C1]
 gb|EYD97472.1| protein grpE [Escherichia coli 1-110-08_S4_C3]
 gb|EYD98695.1| protein grpE [Escherichia coli 1-110-08_S4_C2]
 gb|EYE11815.1| protein grpE [Escherichia coli 1-110-08_S3_C3]
 gb|EYE20213.1| protein grpE [Escherichia coli 1-110-08_S3_C2]
 gb|EYE22451.1| protein grpE [Escherichia coli 1-110-08_S1_C3]
 gb|EYE23081.1| protein grpE [Escherichia coli 1-110-08_S3_C1]
 gb|EYE34659.1| protein grpE [Escherichia coli 1-110-08_S1_C1]
 gb|EYE35860.1| protein grpE [Escherichia coli 1-110-08_S1_C2]
 gb|EYT09081.1| protein grpE [Escherichia coli K02]
 gb|EYU74788.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU84770.1| heat shock protein GrpE [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU88958.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYU97443.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYV14633.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV18641.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV23466.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV29535.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV30605.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV38765.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV38806.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV42743.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV53915.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYV57083.1| heat shock protein GrpE [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYV59490.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV65754.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV79351.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5806]
 gb|EYV87326.1| heat shock protein GrpE [Escherichia coli O6:H16 str. 99-3165]
 gb|EYV88269.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F7350]
 gb|EYW16831.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2114]
 gb|EYW29529.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2112]
 gb|EYW30876.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2111]
 gb|EYW38152.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2113]
 gb|EYW43352.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2109]
 gb|EYW46711.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2108]
 gb|EYW49760.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2107]
 gb|EYW60617.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2106]
 gb|EYW64115.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2105]
 gb|EYW70461.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2104]
 gb|EYW73536.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2103]
 gb|EYW75186.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2101]
 gb|EYW82610.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2099]
 gb|EYW87568.1| heat shock protein GrpE [Escherichia coli O111:NM str. 08-4487]
 gb|EYW87781.1| heat shock protein GrpE [Escherichia coli O145:NM str. 08-4270]
 gb|EYW94643.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX02601.1| heat shock protein GrpE [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX07396.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX08717.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX17810.1| heat shock protein GrpE [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX24378.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2097]
 gb|EYX24898.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2098]
 gb|EYX31254.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2096]
 gb|EYX34390.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2093]
 gb|EYX43160.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2094]
 gb|EYX45114.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2092]
 gb|EYX50051.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2091]
 gb|EYX55828.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2011EL-2090]
 gb|EYX68363.1| heat shock protein GrpE [Escherichia coli O104:H4 str.
           2011EL-1675A]
 gb|EYX70831.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX71727.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX92367.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYY04970.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY11354.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY40605.1| heat shock protein GrpE [Escherichia coli O157:H7 str.
           2010C-4979C1]
 gb|EYY50218.1| heat shock protein GrpE [Escherichia coli O165:H25 str. 2010C-4874]
 gb|EYY61736.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY65536.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY72354.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY75120.1| heat shock protein GrpE [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY76352.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY88130.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYY94433.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYZ07348.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ13804.1| heat shock protein GrpE [Escherichia coli O145:NM str.
           2010C-4557C2]
 gb|EYZ26027.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ37748.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ41297.1| heat shock protein GrpE [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ54274.1| heat shock protein GrpE [Escherichia coli O55:H7 str. 06-3555]
 gb|EYZ60937.1| heat shock protein GrpE [Escherichia coli O79:H7 str. 06-3501]
 gb|EYZ68077.1| heat shock protein GrpE [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ70309.1| heat shock protein GrpE [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ72376.1| heat shock protein GrpE [Escherichia coli O145:NM str. 06-3484]
 gb|EYZ78625.1| heat shock protein GrpE [Escherichia coli O118:H16 str. 06-3256]
 gb|EYZ90208.1| heat shock protein GrpE [Escherichia coli O111:NM str. 04-3211]
 gb|EZA01349.1| heat shock protein GrpE [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA02768.1| heat shock protein GrpE [Escherichia coli O111:NM str. 03-3484]
 gb|EZA18062.1| heat shock protein GrpE [Escherichia coli O28ac:NM str. 02-3404]
 gb|EZA19078.1| heat shock protein GrpE [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA27924.1| heat shock protein GrpE [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA35865.1| heat shock protein GrpE [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA38833.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA69500.1| heat shock protein GrpE [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA70416.1| heat shock protein GrpE [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA80815.1| heat shock protein GrpE [Escherichia coli O25:NM str. E2539C1]
 gb|EZA83714.1| heat shock protein GrpE [Escherichia coli O111:H8 str. F6627]
 gb|EZA95026.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F6749]
 gb|EZB00239.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F6750]
 gb|EZB05181.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F6751]
 gb|EZB13904.1| heat shock protein GrpE [Escherichia coli O157:H7 str. F7377]
 gb|EZB23777.1| heat shock protein GrpE [Escherichia coli O169:H41 str. F9792]
 gb|EZB25425.1| heat shock protein GrpE [Escherichia coli O157:H7 str. G5303]
 gb|EZB37484.1| heat shock protein GrpE [Escherichia coli O157:H7 str. H2498]
 gb|EZB43374.1| heat shock protein GrpE [Escherichia coli O157:H7 str. H2495]
 gb|EZB51733.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1792]
 gb|EZB51751.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1793]
 gb|EZB52467.1| heat shock protein GrpE [Escherichia coli O15:H18 str. K1516]
 gb|EZB68593.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1795]
 gb|EZB68850.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1796]
 gb|EZB72208.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K1845]
 gb|EZB84508.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2188]
 gb|EZB96739.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2191]
 gb|EZC02149.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2324]
 gb|EZC02170.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2192]
 gb|EZC11030.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2581]
 gb|EZC13729.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2622]
 gb|EZC20255.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2845]
 gb|EZC22261.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K2854]
 gb|EZC36243.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K4396]
 gb|EZC67457.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5453]
 gb|EZC69856.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5448]
 gb|EZC75532.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5449]
 gb|EZC77037.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5460]
 gb|EZC84475.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5467]
 gb|EZC90234.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5607]
 gb|EZC93111.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5609]
 gb|EZC94482.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5602]
 gb|EZD01168.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K5852]
 gb|EZD13095.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K6590]
 gb|EZD23028.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6723]
 gb|EZD25281.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6722]
 gb|EZD35588.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6728]
 gb|EZD41103.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6890]
 gb|EZD45621.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6895]
 gb|EZD49948.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6897]
 gb|EZD52424.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6904]
 gb|EZD53329.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6898]
 gb|EZD64645.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6908]
 gb|EZD68575.1| heat shock protein GrpE [Escherichia coli O111:NM str. K6915]
 gb|EZD70531.1| heat shock protein GrpE [Escherichia coli O157:H7 str. K7140]
 gb|EZD81930.1| heat shock protein GrpE [Escherichia coli O39:NM str. F8704-2]
 gb|EZD82075.1| heat shock protein GrpE [Escherichia coli O157:NM str. 08-4540]
 gb|EZD92490.1| heat shock protein GrpE [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZD99447.1| heat shock protein GrpE [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE17264.1| heat shock protein GrpE [Escherichia coli O123:H11 str. 2009C-3307]
 gb|EZE20913.1| heat shock protein GrpE [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE33394.1| heat shock protein GrpE [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE36703.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE46872.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE52858.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE52939.1| heat shock protein GrpE [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZE81058.1| heat shock protein GrpE [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZE92309.1| heat shock protein GrpE [Escherichia coli O145:NM str. 2010C-3508]
 gb|EZG45918.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG51600.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG56090.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG60062.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG68574.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG73539.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG79064.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG80278.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG92283.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZG94592.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZG95124.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZH06567.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH07687.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH10438.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH21042.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH22383.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH26519.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH38046.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH38988.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH48641.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH53728.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH57604.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZJ22133.1| protein grpE [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ28035.1| protein grpE [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ53187.1| protein grpE [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ68923.1| protein grpE [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ70352.1| protein grpE [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ84286.1| protein grpE [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ92277.1| protein grpE [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ94468.1| protein grpE [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ96726.1| protein grpE [Escherichia coli 1-250-04_S1_C3]
 gb|EZK06814.1| protein grpE [Escherichia coli 1-176-05_S1_C3]
 gb|EZK12887.1| protein grpE [Escherichia coli 2-005-03_S1_C3]
 gb|EZK17847.1| protein grpE [Escherichia coli 1-176-05_S1_C2]
 gb|EZK20569.1| protein grpE [Escherichia coli 2-011-08_S1_C2]
 gb|EZK29122.1| protein grpE [Escherichia coli 1-182-04_S1_C1]
 gb|EZK31440.1| protein grpE [Escherichia coli 2-005-03_S1_C2]
 gb|EZK42627.1| protein grpE [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ20980.1| heat shock protein GrpE [Escherichia coli O111:H8 str. 2009EL-2169]
 gb|EZQ23855.1| heat shock protein GrpE [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ27226.1| heat shock protein GrpE [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ37158.1| heat shock protein GrpE [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ39621.1| heat shock protein GrpE [Escherichia coli O111:H8 str. 2011C-3453]
 gb|EZQ41391.1| heat shock protein GrpE [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ51384.1| heat shock protein GrpE [Escherichia coli O157: str. 2010EL-2044]
 gb|EZQ57207.1| protein grpE [Escherichia coli BIDMC 82]
 gb|AHY66265.1| Heat shock protein GrpE [Escherichia coli O145:H28 str. RM12761]
 gb|AHY71922.1| Heat shock protein GrpE [Escherichia coli O145:H28 str. RM12581]
 gb|KCW95058.1| heat shock protein GrpE [Escherichia coli]
 gb|KDA57158.1| protein grpE [Escherichia coli 2-011-08_S1_C1]
 gb|KDA62660.1| protein grpE [Escherichia coli 2-052-05_S1_C1]
 gb|KDA67670.1| protein grpE [Escherichia coli 1-182-04_S1_C2]
 gb|KDA72779.1| protein grpE [Escherichia coli 2-005-03_S3_C2]
 gb|KDA78784.1| protein grpE [Escherichia coli 2-011-08_S3_C2]
 gb|KDA89129.1| protein grpE [Escherichia coli 1-176-05_S4_C2]
 emb|CDP74257.1| Protein GrpE [Escherichia coli]
 emb|CDP66924.1| Protein GrpE [Escherichia coli D6-113.11]
 emb|CDP77157.1| Protein GrpE [Escherichia coli D6-117.29]
 gb|KDF66311.1| protein grpE [Escherichia coli BIDMC 59]
 gb|KDF71203.1| protein grpE [Escherichia coli BIDMC 58]
 gb|KDF86027.1| protein grpE [Escherichia coli BIDMC 62]
 gb|KDF86995.1| protein grpE [Escherichia coli BIDMC 63]
 gb|KDF89539.1| protein grpE [Escherichia coli BIDMC 64]
 gb|KDF99165.1| protein grpE [Escherichia coli BIDMC 70]
 gb|KDG04326.1| protein grpE [Escherichia coli BIDMC 71]
 gb|KDG20625.1| protein grpE [Escherichia coli BIDMC 74]
 gb|KDG25570.1| protein grpE [Escherichia coli BIDMC 75]
 gb|KDG27063.1| protein grpE [Escherichia coli BIDMC 76]
 gb|KDG40076.1| protein grpE [Escherichia coli BIDMC 78]
 gb|KDG41457.1| protein grpE [Escherichia coli BIDMC 79]
 gb|KDG42022.1| protein grpE [Escherichia coli BIDMC 77]
 gb|KDG48584.1| protein grpE [Escherichia coli CHS 68]
 gb|KDG54403.1| protein grpE [Escherichia coli CHS 77]
 gb|KDG60991.1| protein grpE [Escherichia coli MGH 57]
 gb|KDG61145.1| protein grpE [Escherichia coli CHS 69]
 gb|KDG70167.1| protein grpE [Escherichia coli UCI 51]
 gb|KDG74878.1| protein grpE [Escherichia coli MGH 58]
 gb|KDG77465.1| protein grpE [Escherichia coli UCI 53]
 gb|KDG92466.1| protein grpE [Escherichia coli UCI 66]
 gb|KDM69319.1| heat shock protein GrpE [Escherichia coli]
 gb|KDM78393.1| heat shock protein GrpE [Escherichia coli]
 gb|KDM81404.1| heat shock protein GrpE [Escherichia coli O145:H28 str. 4865/96]
 emb|CDN83251.1| GrpE protein [Escherichia coli O25b:H4-ST131]
 gb|KDO89718.1| heat shock protein GrpE [Escherichia coli]
 gb|KDP15563.1| heat shock protein GrpE [Escherichia coli]
 gb|KDT00010.1| protein grpE [Escherichia coli 2-011-08_S1_C3]
 gb|KDT05544.1| protein grpE [Escherichia coli 2-011-08_S4_C1]
 gb|KDT11752.1| protein grpE [Escherichia coli 2-052-05_S1_C3]
 gb|KDT18548.1| protein grpE [Escherichia coli 2-011-08_S4_C3]
 gb|KDT18577.1| protein grpE [Escherichia coli 2-052-05_S3_C1]
 gb|KDT30762.1| protein grpE [Escherichia coli 3-105-05_S1_C1]
 gb|KDT33241.1| protein grpE [Escherichia coli 3-105-05_S3_C1]
 gb|KDT41462.1| protein grpE [Escherichia coli 3-105-05_S4_C2]
 gb|KDT45302.1| protein grpE [Escherichia coli 3-105-05_S3_C2]
 gb|KDT53312.1| protein grpE [Escherichia coli 3-105-05_S4_C3]
 gb|KDT59316.1| protein grpE [Escherichia coli 3-267-03_S3_C1]
 gb|KDT63547.1| protein grpE [Escherichia coli 3-373-03_S3_C1]
 gb|KDT70841.1| protein grpE [Escherichia coli 3-373-03_S3_C3]
 gb|KDT78239.1| protein grpE [Escherichia coli 3-373-03_S1_C2]
 gb|KDT82148.1| protein grpE [Escherichia coli 3-475-03_S4_C1]
 gb|KDT83234.1| protein grpE [Escherichia coli 3-475-03_S1_C1]
 gb|KDT93091.1| protein grpE [Escherichia coli 3-105-05_S4_C1]
 gb|KDT98426.1| protein grpE [Escherichia coli 3-267-03_S3_C2]
 gb|KDU02317.1| protein grpE [Escherichia coli 3-267-03_S1_C2]
 gb|KDU07567.1| protein grpE [Escherichia coli 3-373-03_S3_C2]
 gb|KDU07867.1| protein grpE [Escherichia coli 3-105-05_S3_C3]
 gb|KDU23086.1| protein grpE [Escherichia coli 3-267-03_S4_C2]
 gb|KDU36162.1| protein grpE [Escherichia coli 3-073-06_S4_C1]
 gb|KDU37865.1| protein grpE [Escherichia coli 3-373-03_S1_C3]
 gb|KDU45005.1| protein grpE [Escherichia coli 3-373-03_S1_C1]
 gb|KDU51229.1| protein grpE [Escherichia coli 3-475-03_S4_C2]
 gb|KDU59269.1| protein grpE [Escherichia coli 4-203-08_S1_C1]
 gb|KDU68431.1| protein grpE [Escherichia coli 4-203-08_S4_C3]
 gb|KDV17035.1| heat shock protein GrpE [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV17313.1| heat shock protein GrpE [Escherichia coli O111:NM str. 01-3076]
 gb|KDV29792.1| heat shock protein GrpE [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV31671.1| heat shock protein GrpE [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV64109.1| heat shock protein GrpE [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV66854.1| heat shock protein GrpE [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV69522.1| heat shock protein GrpE [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDV82081.1| protein grpE [Escherichia coli 2-052-05_S3_C3]
 gb|KDV84989.1| protein grpE [Escherichia coli 2-052-05_S4_C3]
 gb|KDW00654.1| protein grpE [Escherichia coli 2-156-04_S3_C1]
 gb|KDW01565.1| protein grpE [Escherichia coli 2-156-04_S1_C3]
 gb|KDW07134.1| protein grpE [Escherichia coli 2-156-04_S3_C3]
 gb|KDW18739.1| protein grpE [Escherichia coli 2-177-06_S1_C1]
 gb|KDW19108.1| protein grpE [Escherichia coli 2-156-04_S4_C1]
 gb|KDW30732.1| protein grpE [Escherichia coli 2-156-04_S3_C2]
 gb|KDW31070.1| protein grpE [Escherichia coli 2-177-06_S1_C2]
 gb|KDW39243.1| protein grpE [Escherichia coli 2-177-06_S1_C3]
 gb|KDW48831.1| protein grpE [Escherichia coli 2-210-07_S1_C3]
 gb|KDW54380.1| protein grpE [Escherichia coli 2-005-03_S3_C1]
 gb|KDW54769.1| protein grpE [Escherichia coli 1-392-07_S3_C2]
 gb|KDW64046.1| protein grpE [Escherichia coli 2-005-03_S3_C3]
 gb|KDW71973.1| protein grpE [Escherichia coli 2-005-03_S4_C1]
 gb|KDW85884.1| protein grpE [Escherichia coli 2-210-07_S4_C1]
 gb|KDW91034.1| protein grpE [Escherichia coli 2-210-07_S1_C2]
 gb|KDW96779.1| protein grpE [Escherichia coli 2-210-07_S3_C2]
 gb|KDW99375.1| protein grpE [Escherichia coli 1-392-07_S3_C1]
 gb|KDX08408.1| protein grpE [Escherichia coli 2-177-06_S4_C3]
 gb|KDX18347.1| protein grpE [Escherichia coli 2-210-07_S3_C3]
 gb|KDX29277.1| protein grpE [Escherichia coli 1-250-04_S1_C2]
 gb|KDX31126.1| protein grpE [Escherichia coli 1-250-04_S1_C1]
 gb|KDX40194.1| protein grpE [Escherichia coli 2-156-04_S4_C3]
 gb|KDX46370.1| protein grpE [Escherichia coli 2-177-06_S3_C2]
 gb|KDX55526.1| protein grpE [Escherichia coli 2-210-07_S3_C1]
 gb|KDX57355.1| protein grpE [Escherichia coli 2-210-07_S4_C2]
 gb|KDX64558.1| protein grpE [Escherichia coli 2-210-07_S4_C3]
 gb|KDX69870.1| protein grpE [Escherichia coli 2-222-05_S1_C1]
 gb|KDX73307.1| protein grpE [Escherichia coli 2-222-05_S1_C2]
 gb|KDX81985.1| protein grpE [Escherichia coli 2-222-05_S1_C3]
 gb|KDX83376.1| protein grpE [Escherichia coli 2-222-05_S3_C3]
 gb|KDX91467.1| protein grpE [Escherichia coli 2-316-03_S3_C1]
 gb|KDX92362.1| protein grpE [Escherichia coli 2-222-05_S4_C2]
 gb|KDX96901.1| protein grpE [Escherichia coli 2-316-03_S3_C2]
 gb|KDY00542.1| protein grpE [Escherichia coli 2-316-03_S3_C3]
 gb|KDY09248.1| protein grpE [Escherichia coli 2-316-03_S4_C1]
 gb|KDY14557.1| protein grpE [Escherichia coli 2-316-03_S4_C2]
 gb|KDY23868.1| protein grpE [Escherichia coli 2-427-07_S1_C2]
 gb|KDY35221.1| protein grpE [Escherichia coli 2-427-07_S3_C3]
 gb|KDY37128.1| protein grpE [Escherichia coli 2-427-07_S3_C1]
 gb|KDY40058.1| protein grpE [Escherichia coli 2-427-07_S4_C1]
 gb|KDY45644.1| protein grpE [Escherichia coli 2-427-07_S4_C2]
 gb|KDY50605.1| protein grpE [Escherichia coli 2-460-02_S3_C1]
 gb|KDY57650.1| protein grpE [Escherichia coli 2-460-02_S3_C2]
 gb|KDY58522.1| protein grpE [Escherichia coli 2-460-02_S3_C3]
 gb|KDY63984.1| protein grpE [Escherichia coli 2-460-02_S4_C2]
 gb|KDY73165.1| protein grpE [Escherichia coli 2-460-02_S4_C3]
 gb|KDY76437.1| protein grpE [Escherichia coli 2-474-04_S1_C1]
 gb|KDY85243.1| protein grpE [Escherichia coli 2-474-04_S3_C1]
 gb|KDY86546.1| protein grpE [Escherichia coli 2-427-07_S1_C3]
 gb|KDY91496.1| protein grpE [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ00731.1| protein grpE [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ13511.1| protein grpE [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ21141.1| protein grpE [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ24377.1| protein grpE [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ31146.1| protein grpE [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ36000.1| protein grpE [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ41261.1| protein grpE [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ48028.1| protein grpE [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ58962.1| protein grpE [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ60827.1| protein grpE [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ61366.1| protein grpE [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ72655.1| protein grpE [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ80163.1| protein grpE [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ80840.1| protein grpE [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ85335.1| protein grpE [Escherichia coli 3-105-05_S1_C3]
 gb|KDZ92704.1| protein grpE [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ09664.1| protein grpE [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ23751.1| protein grpE [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ25483.1| protein grpE [Escherichia coli 2-316-03_S1_C2]
 gb|KEJ29959.1| protein grpE [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ38496.1| protein grpE [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ45541.1| protein grpE [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ48969.1| protein grpE [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ56087.1| protein grpE [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ73768.1| protein grpE [Escherichia coli 5-366-08_S1_C3]
 gb|KEK74155.1| protein grpE [Escherichia coli 3-475-03_S3_C1]
 gb|KEK81955.1| protein grpE [Escherichia coli 3-475-03_S3_C2]
 gb|KEK82311.1| protein grpE [Escherichia coli 3-475-03_S1_C2]
 gb|KEK90763.1| protein grpE [Escherichia coli 4-203-08_S1_C2]
 gb|KEK92444.1| protein grpE [Escherichia coli 4-203-08_S3_C3]
 gb|KEK92739.1| protein grpE [Escherichia coli 4-203-08_S1_C3]
 gb|KEL06462.1| protein grpE [Escherichia coli 4-203-08_S3_C2]
 gb|KEL09026.1| protein grpE [Escherichia coli 4-203-08_S4_C2]
 gb|KEL18570.1| protein grpE [Escherichia coli 4-203-08_S3_C1]
 gb|KEL29969.1| protein grpE [Escherichia coli 5-172-05_S4_C2]
 gb|KEL32514.1| protein grpE [Escherichia coli 5-366-08_S4_C2]
 gb|KEL40337.1| protein grpE [Escherichia coli 5-172-05_S4_C1]
 gb|KEL41768.1| protein grpE [Escherichia coli 5-172-05_S3_C3]
 gb|KEL46100.1| protein grpE [Escherichia coli 6-175-07_S1_C1]
 gb|KEL56387.1| protein grpE [Escherichia coli 5-172-05_S3_C1]
 gb|KEL58124.1| protein grpE [Escherichia coli 5-172-05_S1_C3]
 gb|KEL62643.1| protein grpE [Escherichia coli 5-172-05_S4_C3]
 gb|KEL63509.1| protein grpE [Escherichia coli 5-366-08_S1_C1]
 gb|KEL77145.1| protein grpE [Escherichia coli 5-366-08_S3_C3]
 gb|KEL82918.1| protein grpE [Escherichia coli 5-366-08_S3_C2]
 gb|KEL91508.1| protein grpE [Escherichia coli 6-175-07_S3_C1]
 gb|KEL94261.1| protein grpE [Escherichia coli 5-366-08_S3_C1]
 gb|KEM00525.1| protein grpE [Escherichia coli 6-175-07_S3_C3]
 gb|KEM05844.1| protein grpE [Escherichia coli 6-175-07_S4_C2]
 gb|KEM07475.1| protein grpE [Escherichia coli 6-175-07_S4_C1]
 gb|KEM20402.1| protein grpE [Escherichia coli 6-319-05_S3_C1]
 gb|KEM32991.1| protein grpE [Escherichia coli 6-319-05_S4_C2]
 gb|KEM40045.1| protein grpE [Escherichia coli 6-537-08_S1_C1]
 gb|KEM47126.1| protein grpE [Escherichia coli 6-175-07_S4_C3]
 gb|KEM60563.1| protein grpE [Escherichia coli 6-319-05_S3_C3]
 gb|KEM62009.1| protein grpE [Escherichia coli 7-233-03_S1_C2]
 gb|KEM62111.1| protein grpE [Escherichia coli 6-319-05_S4_C3]
 gb|KEM71736.1| protein grpE [Escherichia coli 7-233-03_S3_C1]
 gb|KEM75614.1| protein grpE [Escherichia coli 6-537-08_S3_C1]
 gb|KEM82743.1| protein grpE [Escherichia coli 6-537-08_S3_C3]
 gb|KEM89321.1| protein grpE [Escherichia coli 2-222-05_S4_C1]
 gb|KEM90860.1| protein grpE [Escherichia coli 6-537-08_S4_C1]
 gb|KEM99445.1| protein grpE [Escherichia coli 7-233-03_S1_C3]
 gb|KEN03381.1| protein grpE [Escherichia coli 7-233-03_S3_C3]
 gb|KEN11942.1| protein grpE [Escherichia coli 7-233-03_S4_C2]
 gb|KEN17037.1| protein grpE [Escherichia coli 6-537-08_S3_C2]
 gb|KEN23844.1| protein grpE [Escherichia coli 8-415-05_S1_C1]
 gb|KEN23939.1| protein grpE [Escherichia coli 7-233-03_S3_C2]
 gb|KEN32446.1| protein grpE [Escherichia coli 8-415-05_S3_C3]
 gb|KEN38781.1| protein grpE [Escherichia coli 8-415-05_S3_C1]
 gb|KEN41063.1| protein grpE [Escherichia coli 7-233-03_S4_C1]
 gb|KEN47454.1| protein grpE [Escherichia coli 6-537-08_S1_C2]
 gb|KEN54318.1| protein grpE [Escherichia coli 7-233-03_S4_C3]
 gb|KEN54971.1| protein grpE [Escherichia coli 6-537-08_S1_C3]
 gb|KEN66419.1| protein grpE [Escherichia coli 1-392-07_S4_C3]
 gb|KEN71136.1| protein grpE [Escherichia coli 8-415-05_S3_C2]
 gb|KEN76170.1| protein grpE [Escherichia coli 2-052-05_S3_C2]
 gb|KEN89204.1| protein grpE [Escherichia coli 2-222-05_S3_C1]
 gb|KEN96567.1| protein grpE [Escherichia coli 2-222-05_S3_C2]
 gb|KEN98715.1| protein grpE [Escherichia coli 1-392-07_S4_C1]
 gb|KEO08602.1| protein grpE [Escherichia coli 8-415-05_S1_C2]
 gb|KEO08636.1| protein grpE [Escherichia coli 2-177-06_S3_C3]
 gb|KEO15562.1| protein grpE [Escherichia coli 2-222-05_S4_C3]
 gb|KEO22668.1| protein grpE [Escherichia coli 5-366-08_S4_C1]
 gb|KEO29268.1| protein grpE [Escherichia coli 2-460-02_S1_C1]
 gb|KEO30995.1| protein grpE [Escherichia coli 1-250-04_S3_C2]
 gb|KEO38273.1| protein grpE [Escherichia coli 2-460-02_S1_C2]
 gb|AID79688.1| heat shock protein GrpE [Escherichia coli Nissle 1917]
 gb|KEO97521.1| heat shock protein GrpE [Escherichia coli]
 gb|KEP00029.1| heat shock protein GrpE [Escherichia coli]
 gb|KEP02200.1| heat shock protein GrpE [Escherichia coli]
 gb|KEP09646.1| heat shock protein GrpE [Escherichia coli]
 gb|KEP17899.1| heat shock protein GrpE [Escherichia coli]
 gb|KEP19955.1| heat shock protein GrpE [Escherichia coli]
 gb|AIF64197.1| GrpE protein [Escherichia coli B7A]
 emb|CDU34115.1| Protein GrpE [Escherichia coli D6-113.11]
 emb|CDU41448.1| Protein GrpE [Escherichia coli]
 gb|AIG69934.1| Heat shock protein GrpE [Escherichia coli O157:H7 str. EDL933]
 gb|KFD75383.1| heat shock protein GrpE [Escherichia coli]
 gb|KFF37280.1| heat shock protein GrpE [Escherichia coli]
 gb|KFF52796.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH76205.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH84192.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH86243.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH90859.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH96588.1| heat shock protein GrpE [Escherichia coli]
 gb|KFH98460.1| heat shock protein GrpE [Escherichia coli]
 gb|AIL17270.1| grpE family protein [Escherichia coli ATCC 25922]
 gb|AIL36923.1| GrpE protein [Shigella flexneri 2003036]
 gb|AIL41870.1| GrpE protein [Shigella flexneri Shi06HN006]
 gb|KFV21707.1| heat shock protein GrpE [Escherichia coli]
 gb|KFV27627.1| heat shock protein GrpE [Escherichia coli]
 gb|KFV29238.1| heat shock protein GrpE [Escherichia coli]
 gb|KFV35498.1| heat shock protein GrpE [Escherichia coli]
 gb|KFZ99875.1| grpE family protein [Shigella flexneri]
 gb|KGI46783.1| Heat shock protein GrpE [Escherichia coli]
 gb|KGM60197.1| Protein GrpE [Escherichia coli G3/10]
 gb|KGM65876.1| Protein GrpE [Escherichia coli]
 gb|KGM70898.1| Protein GrpE [Escherichia coli]
 gb|KGM74901.1| Protein GrpE [Escherichia coli]
 gb|KGM83074.1| Protein GrpE [Escherichia coli]
 gb|KGM84467.1| Protein GrpE [Escherichia coli]
 gb|KGP09511.1| heat shock protein GrpE [Escherichia coli]
 gb|KGP14795.1| heat shock protein GrpE [Escherichia coli]
 gb|KGP17609.1| heat shock protein GrpE [Escherichia coli]
 gb|KGP39804.1| heat shock protein GrpE [Escherichia coli]
 gb|KGP48508.1| heat shock protein GrpE [Escherichia coli]
 gb|KGP50632.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT06355.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT13495.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT19681.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT20646.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT22790.1| heat shock protein GrpE [Escherichia coli]
 gb|KGT30188.1| heat shock protein GrpE [Escherichia coli]
 emb|CDX08091.1| heat shock protein GrpE,Heat shock protein B25.3,heat shock protein
           GrpE,GrpE [Shigella flexneri]
 gb|AIX64495.1| heat shock protein GrpE [Escherichia coli]
 gb|KHD33907.1| heat shock protein GrpE [Escherichia coli]
 gb|KHD48686.1| heat shock protein GrpE [Escherichia coli]
 gb|KHD50477.1| heat shock protein GrpE [Escherichia coli]
 gb|KHD55273.1| heat shock protein GrpE [Escherichia coli]
 gb|KHG72161.1| heat shock protein GrpE [Escherichia coli]
 gb|KHG74238.1| heat shock protein GrpE [Escherichia coli]
 gb|KHG77058.1| heat shock protein GrpE [Escherichia coli]
 gb|KHG92737.1| heat shock protein GrpE [Escherichia coli]
 gb|KHG96677.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH00083.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH07433.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH16533.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH17798.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH28588.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH29229.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH37777.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH42583.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH45076.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH51287.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH57896.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH59605.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH66292.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH74242.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH74372.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH77373.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH87995.1| heat shock protein GrpE [Escherichia coli]
 gb|KHH90892.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI03420.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI08070.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI10550.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI18165.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI22073.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI29903.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI35353.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI40129.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI49613.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI51431.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI55788.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI59218.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI68339.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI71455.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI75847.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI76539.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI84769.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI93589.1| heat shock protein GrpE [Escherichia coli]
 gb|KHI98759.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ01418.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ06024.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ10952.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ13476.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ23254.1| heat shock protein GrpE [Escherichia coli]
 gb|KHJ29236.1| heat shock protein GrpE [Escherichia coli]
 gb|KHO56913.1| heat shock protein GrpE [Escherichia coli]
 emb|CEK06388.1| heat shock protein [Escherichia coli O26:H11]
 gb|AJB52719.1| heat shock protein GrpE [Escherichia coli]
 emb|CCQ30013.2| heat shock protein [Escherichia coli]
 gb|KIE68484.1| heat shock protein GrpE [Escherichia coli]
 gb|KIE72461.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG28415.1| heat shock protein GrpE [Escherichia coli C691-71 (14b)]
 gb|KIG34795.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG36729.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG48884.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG50576.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG59138.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG74914.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG77734.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG81570.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG86203.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG88989.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG92218.1| heat shock protein GrpE [Escherichia coli]
 gb|KIG96998.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH07239.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH18206.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH21605.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH25040.1| heat shock protein GrpE [Escherichia coli]
 gb|KIH36119.1| heat shock protein GrpE [Escherichia coli]
 gb|KII02941.1| heat shock protein GrpE [Escherichia coli]
 gb|AJF57466.1| heat shock protein [Escherichia coli 1303]
 gb|AJF77778.1| heat shock protein GrpE [Escherichia coli]
 gb|KIN84339.1| heat shock protein GrpE [Escherichia coli]
 gb|AJG09609.1| heat shock protein [Escherichia coli ECC-1470]
 gb|KIO39763.1| heat shock protein GrpE [Escherichia coli O139:H28 str. E24377A]
 gb|AJH11297.1| heat shock protein GrpE [Escherichia coli]
 gb|KIO85144.1| co-chaperone GrpE [Escherichia coli 97.0264]
 gb|KIQ39933.1| heat shock protein GrpE [Escherichia coli]
 gb|KIQ44595.1| heat shock protein GrpE [Escherichia coli]
 gb|AJO84635.1| heat shock protein GrpE [Escherichia coli]
 gb|KIY26674.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ13137.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ58467.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ58844.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ60984.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ70424.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ78490.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ80988.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ85933.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ86445.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ94357.1| heat shock protein GrpE [Escherichia coli]
 gb|KIZ96748.1| heat shock protein GrpE [Escherichia coli]
 gb|KJA05351.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD60476.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD66568.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD73849.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD74231.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD74504.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD86991.1| heat shock protein GrpE [Escherichia coli]
 gb|KJD94203.1| heat shock protein GrpE [Escherichia coli]
 gb|KJG96383.1| heat shock protein GrpE [Escherichia coli]
 gb|KJI01573.1| heat shock protein GrpE [Escherichia coli]
 gb|KJI12091.1| heat shock protein GrpE [Escherichia coli]
 gb|KJI19434.1| heat shock protein GrpE [Escherichia coli]
 gb|KJJ46361.1| heat shock protein GrpE [Escherichia coli]
 gb|KJJ75827.1| heat shock protein [Escherichia coli]
 gb|KJW46339.1| heat shock protein GrpE [Escherichia coli]
 gb|KJW54370.1| heat shock protein GrpE [Escherichia coli]
 gb|KJW57159.1| heat shock protein GrpE [Escherichia coli]
 gb|KJW75858.1| heat shock protein GrpE [Escherichia coli]
 gb|AKA91706.1| protein GrpE [Escherichia coli VR50]
 gb|KKA59371.1| co-chaperone GrpE [Escherichia coli 9.1649]
 gb|KKF79063.1| heat shock protein GrpE [Escherichia coli O157:H7]
 gb|KKJ13262.1| heat shock protein GrpE [Escherichia coli MRSN 10204]
 gb|AKE83157.1| heat shock protein GrpE [Escherichia coli O104:H4 str. C227-11]
 gb|KKK02127.1| heat shock protein GrpE [Escherichia coli NB8]
 gb|KKK31875.1| heat shock protein GrpE [Escherichia coli]
 gb|KKO24129.1| heat shock protein GrpE [Escherichia coli]
 gb|KKO26639.1| heat shock protein GrpE [Escherichia coli]
 gb|KKO33390.1| heat shock protein GrpE [Escherichia coli]
 gb|KKO38381.1| heat shock protein GrpE [Escherichia coli]
 gb|AKF21752.1| heat shock protein GrpE [Escherichia coli]
 gb|KKY46540.1| heat shock protein GrpE [Escherichia coli O157:H7]
 gb|KLD46515.1| heat shock protein GrpE [Escherichia coli]
 gb|KLD53584.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG29476.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG42822.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG46393.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG65072.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG68894.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG73227.1| heat shock protein GrpE [Escherichia coli]
 gb|KLG80608.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH02697.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH10765.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH15545.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH18733.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH29680.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH33862.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH40757.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH46419.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH47918.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH53781.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH60566.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH62158.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH81143.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH86875.1| heat shock protein GrpE [Escherichia coli]
 gb|KLH87296.1| heat shock protein GrpE [Escherichia coli]
 gb|AKI67795.1| heat shock protein GrpE [Shigella boydii]
 gb|AKK55186.1| heat shock protein GrpE [Shigella flexneri G1663]
 gb|AKM36168.1| heat shock protein [Escherichia coli PCN061]
 gb|KLU94624.1| heat shock protein GrpE [Escherichia coli]
 gb|KLW98792.1| protein GrpE [Escherichia coli]
 gb|KLX04111.1| protein GrpE [Escherichia coli]
 gb|KLX05444.1| protein GrpE [Escherichia coli]
 gb|KLX16461.1| protein GrpE [Escherichia coli]
 gb|KLX22305.1| protein GrpE [Escherichia coli]
 gb|KLX27759.1| protein GrpE [Escherichia coli]
 gb|KLX33552.1| protein GrpE [Escherichia coli]
 gb|KLX33973.1| protein GrpE [Escherichia coli]
 gb|KLX47751.1| protein GrpE [Escherichia coli]
 gb|KLX49288.1| protein GrpE [Escherichia coli]
 gb|KLX53091.1| protein GrpE [Escherichia coli]
 gb|KLX59272.1| protein GrpE [Escherichia coli]
 gb|KLX70449.1| protein GrpE [Escherichia coli]
 gb|KLX74489.1| protein GrpE [Escherichia coli]
 gb|KLX75390.1| protein GrpE [Escherichia coli]
 gb|KLX87578.1| protein GrpE [Escherichia coli]
 gb|KLX92951.1| protein GrpE [Escherichia coli]
 gb|KLX95908.1| protein GrpE [Escherichia coli]
 gb|KLY00215.1| protein GrpE [Escherichia coli]
 gb|KME68639.1| protein GrpE [Escherichia coli]
 gb|AKN48536.1| heat shock protein GrpE [Escherichia coli]
 gb|AKP85423.1| heat shock protein [Escherichia coli ACN001]
 emb|CEP58442.1| heat shock protein GrpE [Shigella flexneri 2a]
 gb|KMV38614.1| heat shock protein GrpE [Escherichia coli]
 gb|KMV47930.1| heat shock protein GrpE [Escherichia coli]
 gb|KMV48660.1| heat shock protein GrpE [Escherichia coli]
 gb|KMV61795.1| heat shock protein GrpE [Escherichia coli]
 gb|KNA38989.1| GrpE protein [Escherichia coli M114]
 emb|CSP92376.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD36398.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD33836.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS19065.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP39407.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ61872.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ77496.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP63089.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG66722.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD29113.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP74750.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG42313.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ57972.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF20151.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP86913.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE49590.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD17178.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ45302.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ52199.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN98049.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS33225.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI00826.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP65264.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS02942.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO41443.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR11042.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR07969.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE75912.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE42588.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE90512.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN92314.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE62558.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ22111.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN88330.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR90604.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO03350.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP35034.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG55032.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF67050.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF89422.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO32404.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF53256.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ90063.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP57833.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP36306.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR14139.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ25285.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF17267.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR89280.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD23510.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR95464.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR16828.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ45226.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF06753.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG24190.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF17984.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG18411.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG38573.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST42296.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF63158.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP02026.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF01362.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ55317.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS74396.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF08204.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP84535.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ62490.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO54512.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST71738.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO92147.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG26360.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR05463.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP67459.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG57986.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN84003.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS02993.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR54265.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS37651.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN36216.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ83756.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO46532.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN53951.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP31988.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP55922.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE47476.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO07822.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO46409.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP42474.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO30414.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL11323.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST75824.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS32352.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE63290.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF48425.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN69134.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO58734.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP64763.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP22255.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN81579.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP45104.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU21906.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ47215.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO97569.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP21758.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK14059.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST66855.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP78836.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN52988.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG24674.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ27982.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ96307.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ02177.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK61813.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK41256.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR97649.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST30891.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS73758.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ29680.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST49361.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW78260.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP15598.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN44115.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF18416.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM28594.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF56668.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTP74849.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF90229.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV71303.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST53216.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST31333.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW52795.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL65728.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG04900.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF81398.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW38890.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO09873.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL64167.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP09931.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST42885.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ32285.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO81303.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU23306.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE33749.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP95845.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS81758.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST39748.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU01343.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF93454.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO54212.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS26127.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS21838.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW36131.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG08701.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG73356.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN65261.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP98201.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP19947.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM84027.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ00530.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW86532.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE41759.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW17426.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC61530.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF54256.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC74721.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX86398.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG17239.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ83395.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA33745.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW77675.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL53182.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS09559.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST55204.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV69112.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTP77349.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG09834.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS52032.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS04542.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST07533.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG04241.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM75937.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST85338.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS98189.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN70234.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK08856.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL99127.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ27736.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV68175.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST86301.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH11434.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW33628.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW30847.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW04328.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM24346.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX00987.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ14529.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST48504.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX26469.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS54022.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ02311.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU98335.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR42385.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL38557.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW72755.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS45980.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY67062.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ90339.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO34063.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF90445.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX66972.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW24306.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ88807.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK87916.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST26523.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW11712.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL46342.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU28035.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTP74896.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI86388.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO24216.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW84737.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH10895.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY60306.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK99608.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST15819.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA10113.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL35923.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW58942.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV82292.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA05097.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG00372.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU36712.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY27677.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL41551.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ34691.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX47663.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK97824.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSE54540.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS74238.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN64406.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM47934.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST00536.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW25962.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW35147.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK25981.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY74861.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSQ76682.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK51769.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL08702.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY94325.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI51040.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ46676.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV99344.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK46766.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI97237.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL22328.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB61524.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU66816.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS15303.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN17860.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR86556.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK82217.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU71859.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI85055.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU07366.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL17871.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK99687.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL38738.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST14572.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL03225.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX89515.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU21274.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ19578.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK50926.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX97417.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW19771.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL95782.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY10831.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG21720.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB06281.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV64906.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS48672.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI09485.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS01161.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL22939.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL92300.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST95124.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW34472.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB91981.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ43865.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ96709.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF69074.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK49179.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV34546.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW66389.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY80114.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW33813.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY03338.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI70867.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK76272.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK21297.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ10764.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ69752.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY78480.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG07191.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG63892.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW24003.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN29996.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR28406.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC19148.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC65390.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ07451.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV70770.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA11323.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ23050.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB91268.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW44062.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY77743.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW58853.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN05429.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA00784.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY64751.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF92336.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ64329.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH43246.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ91502.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST98267.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSF44999.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI94666.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM73218.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTE24680.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM43231.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW26927.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ60017.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS57615.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ08076.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH05851.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI77160.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV64224.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM15291.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV89239.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN77491.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST19219.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW23656.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM83875.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI27692.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV85177.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY69766.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY77882.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY96148.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY17772.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ67092.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP39748.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC27205.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO88004.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ82022.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY53664.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM60498.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW85000.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH29680.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB94429.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY73376.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTE05745.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV66441.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST94097.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX39566.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV35467.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA24734.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW42419.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSO39165.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR55549.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX89174.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR24135.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ81168.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI25601.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB93071.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI15783.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX51052.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI39862.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX90787.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY89524.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC15145.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ56501.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI10621.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX62456.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY06266.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN47239.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSP65396.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI20495.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV12438.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK78309.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK27423.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD20263.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV72258.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ59859.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB80745.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV72576.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY47660.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX57418.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI35761.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS85125.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB99441.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSS76819.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW01160.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC05850.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI73677.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN02780.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI22229.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ75113.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH60662.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA32089.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM28257.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM26586.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ22534.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK46088.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ78520.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ15703.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM68338.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC32878.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB82380.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTE45066.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC58054.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB88710.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC51314.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL72170.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY64074.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA01229.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY98470.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH57596.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC34865.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX99978.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV16149.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ83335.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC38523.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI26914.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST30887.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST67782.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM94863.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC85880.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU97260.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV55332.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ13237.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ15679.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY70455.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST99812.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB99517.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ51382.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH54182.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSU25625.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD02498.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY78108.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSX68990.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH77907.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG89490.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI88416.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH23591.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV71000.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG64299.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK66837.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSZ26466.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC45932.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN22153.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK10939.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY93171.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK07788.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV21170.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW05275.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG80952.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV60439.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI41309.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI09726.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSV91827.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSW95432.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY06492.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH39917.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG81011.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSG77220.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB27298.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB16726.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA11871.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB10572.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA59331.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA44025.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI28049.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI31684.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN61268.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST23831.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH82780.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN56901.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY93453.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH79846.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM72696.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSR68005.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN11474.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA68944.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN22370.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN17444.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM85342.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB47341.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI24002.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM66320.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB65794.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN26793.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI20961.1| heat shock protein GrpE [Shigella sonnei]
 emb|CST31194.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN43382.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA32968.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN25144.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA87680.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB16725.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA40999.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN32978.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK15632.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK26494.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI05952.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSM82176.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSJ70099.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB88128.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSN27029.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB92813.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA82805.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB22221.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH29937.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA78541.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB61919.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA87923.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC50405.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSH85413.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSI55664.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA49858.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA99577.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB39621.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA61803.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTB98471.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTA82472.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK58409.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK59990.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSL00485.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTC32451.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK94552.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK98109.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSK68761.1| heat shock protein GrpE [Shigella sonnei]
 emb|CSY91762.1| heat shock protein GrpE [Shigella sonnei]
 gb|KNF13265.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF13736.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF26055.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF26245.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF37025.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF45241.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF61799.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF68922.1| heat shock protein GrpE [Escherichia coli]
 gb|KNF79216.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG06485.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG12972.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG19079.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG19176.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG31235.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG32523.1| heat shock protein GrpE [Escherichia coli]
 gb|KNG36681.1| heat shock protein GrpE [Escherichia coli]
 gb|KNY57778.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY60527.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY70889.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY73145.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY81840.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNY95792.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNZ08714.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNZ10686.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNZ16669.1| heat -hock protein GrpE [Escherichia coli]
 gb|KNZ19256.1| heat -hock protein GrpE [Escherichia coli]
 gb|KOA00413.1| heat shock protein GrpE [Escherichia coli]
 gb|KOA23797.1| heat shock protein GrpE [Escherichia coli]
 gb|KOA27676.1| heat shock protein GrpE [Escherichia coli]
 gb|KOA30118.1| heat shock protein GrpE [Escherichia coli]
 emb|CTX24352.1| heat shock protein [Escherichia coli]
 emb|CTR54775.1| heat shock protein [Escherichia coli]
 emb|CTR32005.1| heat shock protein [Escherichia coli]
 emb|CTU38338.1| heat shock protein [Escherichia coli]
 emb|CTU53215.1| heat shock protein [Escherichia coli]
 emb|CTR40252.1| heat shock protein [Escherichia coli]
 emb|CTU98215.1| heat shock protein [Escherichia coli]
 emb|CTS49780.1| heat shock protein [Escherichia coli]
 emb|CTR41692.1| heat shock protein [Escherichia coli]
 emb|CTR22160.1| heat shock protein [Escherichia coli]
 emb|CTV27855.1| heat shock protein [Escherichia coli]
 emb|CTV10087.1| heat shock protein [Escherichia coli]
 emb|CTT54574.1| heat shock protein [Escherichia coli]
 emb|CTV00750.1| heat shock protein [Escherichia coli]
 emb|CTT94442.1| heat shock protein [Escherichia coli]
 emb|CTT74548.1| heat shock protein [Escherichia coli]
 emb|CTS82141.1| heat shock protein [Escherichia coli]
 emb|CTU27790.1| heat shock protein [Escherichia coli]
 emb|CTT72833.1| heat shock protein [Escherichia coli]
 emb|CTV32768.1| heat shock protein [Escherichia coli]
 emb|CTS17889.1| heat shock protein [Escherichia coli]
 emb|CTX07697.1| heat shock protein [Escherichia coli]
 emb|CTU34368.1| heat shock protein [Escherichia coli]
 emb|CTW41655.1| heat shock protein [Escherichia coli]
 emb|CTS65635.1| heat shock protein [Escherichia coli]
 emb|CTT06420.1| heat shock protein [Escherichia coli]
 emb|CTW60458.1| heat shock protein [Escherichia coli]
 emb|CTU07837.1| heat shock protein [Escherichia coli]
 emb|CTS71064.1| heat shock protein [Escherichia coli]
 emb|CTS54892.1| heat shock protein [Escherichia coli]
 emb|CTU34932.1| heat shock protein [Escherichia coli]
 emb|CTS75792.1| heat shock protein [Escherichia coli]
 emb|CTW63636.1| heat shock protein [Escherichia coli]
 emb|CTW26515.1| heat shock protein [Escherichia coli]
 emb|CTT09754.1| heat shock protein [Escherichia coli]
 emb|CTS92664.1| heat shock protein [Escherichia coli]
 emb|CTT61010.1| heat shock protein [Escherichia coli]
 emb|CTR99397.1| heat shock protein [Escherichia coli]
 emb|CTW11656.1| heat shock protein [Escherichia coli]
 emb|CTW60641.1| heat shock protein [Escherichia coli]
 emb|CTW05742.1| heat shock protein [Escherichia coli]
 emb|CTV76353.1| heat shock protein [Escherichia coli]
 emb|CTW47982.1| heat shock protein [Escherichia coli]
 emb|CTT07545.1| heat shock protein [Escherichia coli]
 emb|CTV64920.1| heat shock protein [Escherichia coli]
 emb|CTW83891.1| heat shock protein [Escherichia coli]
 emb|CTT43009.1| heat shock protein [Escherichia coli]
 emb|CTV91352.1| heat shock protein [Escherichia coli]
 emb|CTT02310.1| heat shock protein [Escherichia coli]
 emb|CTT51858.1| heat shock protein [Escherichia coli]
 emb|CTT34355.1| heat shock protein [Escherichia coli]
 emb|CTW46605.1| heat shock protein [Escherichia coli]
 emb|CTW15071.1| heat shock protein [Escherichia coli]
 emb|CTT28876.1| heat shock protein [Escherichia coli]
 emb|CTU34770.1| heat shock protein [Escherichia coli]
 emb|CTW17675.1| heat shock protein [Escherichia coli]
 emb|CTT42160.1| heat shock protein [Escherichia coli]
 emb|CTT31927.1| heat shock protein [Escherichia coli]
 emb|CTV10932.1| heat shock protein [Escherichia coli]
 emb|CTS67385.1| heat shock protein [Escherichia coli]
 emb|CTS98596.1| heat shock protein [Escherichia coli]
 emb|CTU63506.1| heat shock protein [Escherichia coli]
 emb|CTT11578.1| heat shock protein [Escherichia coli]
 emb|CTT03726.1| heat shock protein [Escherichia coli]
 emb|CTW46427.1| heat shock protein [Escherichia coli]
 emb|CTX02019.1| heat shock protein [Escherichia coli]
 emb|CTT03752.1| heat shock protein [Escherichia coli]
 emb|CTV68726.1| heat shock protein [Escherichia coli]
 emb|CTT88079.1| heat shock protein [Escherichia coli]
 emb|CTW88180.1| heat shock protein [Escherichia coli]
 emb|CTU30631.1| heat shock protein [Escherichia coli]
 emb|CTW23726.1| heat shock protein [Escherichia coli]
 emb|CTU28353.1| heat shock protein [Escherichia coli]
 emb|CTW83015.1| heat shock protein [Escherichia coli]
 emb|CTS68245.1| heat shock protein [Escherichia coli]
 emb|CTV46721.1| heat shock protein [Escherichia coli]
 emb|CTT24948.1| heat shock protein [Escherichia coli]
 emb|CTS51494.1| heat shock protein [Escherichia coli]
 emb|CTV43944.1| heat shock protein [Escherichia coli]
 emb|CTW07130.1| heat shock protein [Escherichia coli]
 emb|CTT52929.1| heat shock protein [Escherichia coli]
 emb|CTW21007.1| heat shock protein [Escherichia coli]
 emb|CTW86766.1| heat shock protein [Escherichia coli]
 emb|CTW69320.1| heat shock protein [Escherichia coli]
 emb|CTT44977.1| heat shock protein [Escherichia coli]
 emb|CTU99734.1| heat shock protein [Escherichia coli]
 emb|CTT79309.1| heat shock protein [Escherichia coli]
 emb|CTV85228.1| heat shock protein [Escherichia coli]
 emb|CTT67371.1| heat shock protein [Escherichia coli]
 emb|CTW31335.1| heat shock protein [Escherichia coli]
 emb|CTW33808.1| heat shock protein [Escherichia coli]
 emb|CTW47632.1| heat shock protein [Escherichia coli]
 emb|CTW63512.1| heat shock protein [Escherichia coli]
 emb|CTT33040.1| heat shock protein [Escherichia coli]
 emb|CTS11620.1| heat shock protein [Escherichia coli]
 emb|CTW96543.1| heat shock protein [Escherichia coli]
 emb|CTU17483.1| heat shock protein [Escherichia coli]
 emb|CTU04392.1| heat shock protein [Escherichia coli]
 emb|CTW27271.1| heat shock protein [Escherichia coli]
 emb|CTT39721.1| heat shock protein [Escherichia coli]
 emb|CTV68699.1| heat shock protein [Escherichia coli]
 emb|CTT33650.1| heat shock protein [Escherichia coli]
 emb|CTV12723.1| heat shock protein [Escherichia coli]
 emb|CTY91732.1| heat shock protein [Escherichia coli]
 emb|CTZ30083.1| heat shock protein [Escherichia coli]
 emb|CTY46764.1| heat shock protein [Escherichia coli]
 emb|CTZ58515.1| heat shock protein [Escherichia coli]
 emb|CTZ46510.1| heat shock protein [Escherichia coli]
 emb|CTY72245.1| heat shock protein [Escherichia coli]
 emb|CTZ15278.1| heat shock protein [Escherichia coli]
 emb|CTZ78177.1| heat shock protein [Escherichia coli]
 emb|CTZ46476.1| heat shock protein [Escherichia coli]
 emb|CTZ78505.1| heat shock protein [Escherichia coli]
 emb|CTZ20568.1| heat shock protein [Escherichia coli]
 emb|CTZ75900.1| heat shock protein [Escherichia coli]
 emb|CTZ58033.1| heat shock protein [Escherichia coli]
 emb|CTZ21066.1| heat shock protein [Escherichia coli]
 emb|CTZ43887.1| heat shock protein [Escherichia coli]
 emb|CTY25814.1| heat shock protein [Escherichia coli]
 emb|CTZ11147.1| heat shock protein [Escherichia coli]
 emb|CTY76995.1| heat shock protein [Escherichia coli]
 emb|CTY83271.1| heat shock protein [Escherichia coli]
 emb|CTZ35927.1| heat shock protein [Escherichia coli]
 emb|CTY40297.1| heat shock protein [Escherichia coli]
 emb|CTZ22365.1| heat shock protein [Escherichia coli]
 emb|CTZ84438.1| heat shock protein [Escherichia coli]
 emb|CTY43184.1| heat shock protein [Escherichia coli]
 emb|CTZ29243.1| heat shock protein [Escherichia coli]
 emb|CTZ92113.1| heat shock protein [Escherichia coli]
 emb|CTX30932.1| heat shock protein [Escherichia coli]
 emb|CTZ61020.1| heat shock protein [Escherichia coli]
 emb|CTZ82403.1| heat shock protein [Escherichia coli]
 emb|CTZ83393.1| heat shock protein [Escherichia coli]
 emb|CTY85994.1| heat shock protein [Escherichia coli]
 emb|CTZ43611.1| heat shock protein [Escherichia coli]
 emb|CTZ37224.1| heat shock protein [Escherichia coli]
 emb|CTZ75347.1| heat shock protein [Escherichia coli]
 emb|CTY91165.1| heat shock protein [Escherichia coli]
 emb|CTZ96858.1| heat shock protein [Escherichia coli]
 emb|CTY19383.1| heat shock protein [Escherichia coli]
 emb|CTZ08497.1| heat shock protein [Escherichia coli]
 emb|CTZ36329.1| heat shock protein [Escherichia coli]
 emb|CTZ89896.1| heat shock protein [Escherichia coli]
 emb|CTZ96371.1| heat shock protein [Escherichia coli]
 emb|CUA16178.1| heat shock protein [Escherichia coli]
 emb|CUA14581.1| heat shock protein [Escherichia coli]
 emb|CUA03695.1| heat shock protein [Escherichia coli]
 emb|CUA15269.1| heat shock protein [Escherichia coli]
 emb|CUA63952.1| heat shock protein [Escherichia coli]
 emb|CUA51610.1| heat shock protein [Escherichia coli]
 emb|CUA62745.1| heat shock protein [Escherichia coli]
 emb|CUA53057.1| heat shock protein [Escherichia coli]
 emb|CUA36941.1| heat shock protein [Escherichia coli]
 emb|CUA35953.1| heat shock protein [Escherichia coli]
 emb|CUA49315.1| heat shock protein [Escherichia coli]
 gb|KOR01675.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ03800.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ06521.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ07722.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ22195.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ24131.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ25185.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ34719.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ42195.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ48912.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ50858.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ55806.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ57537.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ67745.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ70703.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ78135.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ85072.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ90327.1| heat shock protein GrpE [Escherichia coli]
 gb|KOZ96602.1| heat shock protein GrpE [Escherichia coli]
 emb|CUJ92718.1| Heat shock protein B25.3 [Achromobacter sp. ATCC35328]
 gb|KPH29537.1| heat shock protein GrpE [Escherichia coli]
 gb|KPH32275.1| heat shock protein GrpE [Escherichia coli]
 gb|KPH39159.1| heat shock protein GrpE [Escherichia coli]
 gb|KPH41317.1| heat shock protein GrpE [Escherichia coli]
 emb|CTX88088.1| heat shock protein [Escherichia coli]
 emb|CTY05025.1| heat shock protein [Escherichia coli]
 emb|CTX82164.1| heat shock protein [Escherichia coli]
 emb|CTX49045.1| heat shock protein [Escherichia coli]
 emb|CTY11536.1| heat shock protein [Escherichia coli]
 emb|CTY09689.1| heat shock protein [Escherichia coli]
 emb|CTY00728.1| heat shock protein [Escherichia coli]
 emb|CTY20614.1| heat shock protein [Escherichia coli]
 emb|CTY64935.1| heat shock protein [Escherichia coli]
 emb|CTX37256.1| heat shock protein [Escherichia coli]
 emb|CTY02325.1| heat shock protein [Escherichia coli]
 emb|CTX84268.1| heat shock protein [Escherichia coli]
 emb|CTD40182.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD83891.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD90704.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTX57596.1| heat shock protein [Escherichia coli]
 emb|CTD53278.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTD40568.1| heat shock protein GrpE [Shigella sonnei]
 emb|CTX50647.1| heat shock protein [Escherichia coli]
 emb|CTY52290.1| heat shock protein [Escherichia coli]
 gb|ALH91897.1| molecular chaperone GrpE [Escherichia coli O157:H7]
 gb|KPO04300.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO13318.1| heat -hock protein GrpE [Escherichia coli]
 gb|KPO18450.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO21069.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO23401.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO36725.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO43571.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO45270.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO59033.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO72409.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO73984.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO78962.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO84717.1| heat shock protein GrpE [Escherichia coli]
 gb|KPO90677.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP10899.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP12429.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP19086.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP30754.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP34959.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP36411.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP36857.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP40425.1| heat shock protein GrpE [Escherichia coli]
 gb|KPP50651.1| heat shock protein GrpE [Escherichia coli]
 gb|KQB24357.1| molecular chaperone GrpE [Escherichia coli]
 gb|KQC23774.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQI74824.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQI78649.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQI83478.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQI94984.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ03282.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ08996.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ12525.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ22596.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ23388.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ27630.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ36840.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ37002.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQJ47122.1| heat -hock protein GrpE [Escherichia coli]
 gb|ALL94722.1| molecular chaperone GrpE [Escherichia coli]
 gb|KQL77214.1| GrpE protein [Escherichia coli]
 gb|KRQ08672.1| molecular chaperone GrpE [Escherichia coli O157:H7]
 gb|KRR50604.1| heat shock protein [Escherichia coli VL2732]
 gb|KRR51839.1| heat shock protein [Escherichia coli K71]
 gb|KRR56441.1| heat shock protein [Escherichia coli VL2874]
 gb|ALN46681.1| molecular chaperone GrpE [Escherichia coli]
 gb|KRT19662.1| molecular chaperone GrpE [Escherichia coli]
 gb|KRV66629.1| molecular chaperone GrpE [Escherichia coli]
 gb|KRV97818.1| molecular chaperone GrpE [Escherichia coli]
 gb|KRW05513.1| molecular chaperone GrpE [Escherichia coli]
 gb|KST28661.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KST29864.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALQ58345.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSW91072.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSX56271.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSX83552.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY11012.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY13600.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY34654.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY56702.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY78424.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSY89626.1| molecular chaperone GrpE [Escherichia coli]
 gb|KSZ14230.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALT50450.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG76354.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG76919.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG77293.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG83960.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG84257.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG90248.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUG97390.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH02759.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH05125.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH12629.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH14531.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH21362.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH23493.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH25147.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUH29563.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALV70034.1| heat shock protein GrpE [Escherichia coli]
 gb|ALX53455.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALX58658.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALX63535.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALY14107.1| heat shock protein [Escherichia coli]
 emb|CUW80430.1| heat shock protein [Escherichia coli]
 gb|KUR37133.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUR41198.1| molecular chaperone GrpE [Escherichia coli]
 gb|ALZ56840.1| Heat shock protein GrpE [Shigella sonnei]
 gb|KUR85862.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUR96310.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUR96623.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS11895.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS25575.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS32219.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS36476.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS48419.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS52317.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS70413.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS84312.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS88661.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS91178.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT04044.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT11188.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT18381.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT25815.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT33280.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT35620.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT43035.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT54068.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT66152.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT68560.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT74767.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT79822.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT83156.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT85890.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT89902.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU00466.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU03294.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU05328.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU08441.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU13436.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU20112.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU20547.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU30922.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU33830.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU37991.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU48447.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU58773.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU60339.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU62610.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU66483.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU73603.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU87903.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU89885.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU91285.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU95868.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV05102.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV07209.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV14207.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV15333.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV21047.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV37693.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV37794.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV40981.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV49022.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV49278.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV51472.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV57258.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV66768.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV78827.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV81383.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV84218.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV91960.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV98507.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW05086.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW08952.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW14874.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW17989.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW30065.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW33916.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW34455.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW38143.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW43174.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW62652.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW64441.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW67769.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW75591.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW76364.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW84243.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW85786.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX01018.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX04936.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX05393.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX10435.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX18805.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX23974.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX30524.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX31886.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX32416.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX38307.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX48765.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX48965.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX54106.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX59389.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX70460.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX77578.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX92042.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX94514.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX95871.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUY00399.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUY05914.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUY12852.1| molecular chaperone GrpE [Escherichia coli]
 gb|KVI18745.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMB53268.1| molecular chaperone GrpE [Escherichia coli]
 gb|KWW03958.1| molecular chaperone GrpE [Escherichia fergusonii]
 gb|KWW04123.1| molecular chaperone GrpE [Escherichia fergusonii]
 gb|KWW04650.1| molecular chaperone GrpE [Escherichia fergusonii]
 gb|KXC10704.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMG18404.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|AMH23327.1| molecular chaperone GrpE [Escherichia coli B]
 gb|AMH27643.1| molecular chaperone GrpE [Escherichia coli B]
 gb|KXG59055.1| heat shock protein GrpE [Escherichia coli]
 gb|KXG63189.1| heat shock protein GrpE [Escherichia coli]
 gb|KXG63869.1| heat shock protein GrpE [Escherichia coli]
 gb|KXG71132.1| heat shock protein GrpE [Escherichia coli]
 gb|AMF90807.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KXG93582.1| co-chaperone GrpE [Escherichia coli]
 gb|KXH01307.1| co-chaperone GrpE [Escherichia coli]
 gb|KXH99527.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXI00022.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXI02896.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXI05813.1| molecular chaperone GrpE [Escherichia coli]
 gb|AML05757.1| molecular chaperone GrpE [Escherichia coli]
 gb|AML10548.1| molecular chaperone GrpE [Escherichia coli]
 gb|AML15485.1| molecular chaperone GrpE [Escherichia coli]
 gb|AML20443.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK81919.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK86587.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK88709.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK91001.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK95266.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL02227.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL10583.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL17172.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL29190.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL29220.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL57987.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL60716.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL69991.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL71347.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL71423.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL74448.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL93007.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM00989.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM03299.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM05403.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM06098.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM11924.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM24948.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM34837.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM37614.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM38976.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM47364.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM50233.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM59191.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM60229.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM72371.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM74320.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM77185.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM90104.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM93260.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXM98489.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN05190.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN13292.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN13935.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN17804.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN17878.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN24580.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN33059.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN42652.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXN56215.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP16579.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP16875.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP17856.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP29475.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP30270.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP40723.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP43198.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP44301.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP45056.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP58145.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP62723.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP71210.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP71655.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP73950.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP79789.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP80255.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXP85480.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ00316.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ00468.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ00561.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ07159.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ13966.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ17119.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ27217.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ30934.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ39650.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ41075.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ44297.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ52800.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ57463.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ62831.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ63900.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ66821.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ76847.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ78988.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ79397.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ90461.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ91553.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXQ98858.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR04502.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR05335.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR14592.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR17019.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR20336.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR29959.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR30140.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR30803.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR38874.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR41737.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR50230.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR51097.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR51477.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR63863.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR70288.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR72069.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR83196.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR84334.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXR95823.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXS00309.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMM37510.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMM78310.1| molecular chaperone GrpE [Shigella flexneri 1a]
 emb|CUU94842.1| heat shock protein [Escherichia coli]
 gb|AMN58989.1| heat shock protein GrpE [Shigella flexneri 2a]
 gb|AMN63827.1| heat shock protein GrpE [Shigella flexneri 4c]
 emb|CUX84299.1| heat shock protein [Escherichia coli]
 gb|AMQ52317.1| molecular chaperone GrpE [Escherichia coli JJ1887]
 gb|AMR24189.1| nucleotide exchange factor GrpE [Shigella sp. PAMC 28760]
 gb|KYL39118.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYN51569.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYN54304.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYO67592.1| heat shock protein GrpE [Escherichia coli]
 gb|KYO69883.1| heat shock protein GrpE [Escherichia coli]
 gb|KYR05859.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR09030.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR20717.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR23609.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR33695.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR36651.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR39623.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR53491.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR53899.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR55112.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR59624.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR70192.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR75804.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR85351.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYR92450.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS06148.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS25094.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS25547.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS31695.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS36486.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS39442.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS41951.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS41982.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS52354.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS52914.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS68016.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS73920.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS79091.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS95907.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS96854.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYS99200.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT14040.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT17964.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT25558.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT27748.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KYT33238.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT42896.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT54536.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT59263.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT61390.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT77335.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT78879.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT85146.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT87492.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT91162.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT92837.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYT97681.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU06245.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU08524.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU20606.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU21716.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU32464.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU38989.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU46483.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU50172.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU56189.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU63002.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU71021.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU71693.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU87099.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU90222.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYU94637.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV02757.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV04764.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV14850.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV15562.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV22540.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV23429.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV28577.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV36412.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV43460.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV46431.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV49025.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV60015.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV68289.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV83685.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV85958.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYV96192.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW03837.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW09967.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW14529.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW22172.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW40010.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW48071.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW51020.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW59952.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW61395.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW74204.1| molecular chaperone GrpE [Escherichia coli]
 gb|KYW75017.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMU83167.1| heat shock protein GrpE [Escherichia coli str. Sanji]
 gb|KZA00314.1| molecular chaperone GrpE [Escherichia coli]
 gb|KZA00436.1| molecular chaperone GrpE [Escherichia coli]
 gb|AMW47781.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AMX14828.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AMX30131.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AMX35346.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AMX40596.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZF30192.1| molecular chaperone GrpE [Escherichia coli APEC O2]
 gb|KZH06570.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH07701.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH21012.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH24154.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH26191.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH34676.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH38366.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH40407.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH45532.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH47662.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH54121.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH62668.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH66071.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH67473.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH75696.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH87400.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH88491.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH94695.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI03935.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI03961.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI09886.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI16900.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI19665.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI22265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI47766.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI55625.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI58357.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI63291.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI71418.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI75339.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI78362.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI88512.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI88885.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI91455.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI95753.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI96707.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ07943.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ14765.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ15535.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ22227.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ29055.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ37867.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ41205.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ44569.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ47860.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ52520.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ53314.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ56440.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ67632.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ71449.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ79663.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ84706.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ94965.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ98781.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZO64913.1| heat shock protein GrpE [Escherichia coli]
 gb|KZO70025.1| heat shock protein GrpE [Escherichia coli]
 gb|KZO74393.1| heat shock protein GrpE [Escherichia coli]
 gb|KZO75737.1| heat shock protein GrpE [Escherichia coli]
 gb|KZO83684.1| heat shock protein GrpE [Escherichia coli]
 gb|KZO85677.1| heat shock protein GrpE [Escherichia coli]
 gb|KZP39809.1| heat shock protein GrpE [Escherichia coli]
 gb|KZP40194.1| heat shock protein GrpE [Escherichia coli]
 gb|OAC02620.1| heat shock protein [Escherichia coli]
 gb|OAC03884.1| heat shock protein [Escherichia coli]
 gb|OAC11673.1| heat shock protein [Escherichia coli]
 gb|OAC12826.1| heat shock protein [Escherichia coli]
 gb|OAC19905.1| heat shock protein [Escherichia coli]
 gb|OAC23251.1| heat shock protein [Escherichia coli]
 gb|OAC30265.1| heat shock protein [Escherichia coli]
 gb|OAC34397.1| heat shock protein [Escherichia coli]
 gb|OAC43388.1| heat shock protein [Escherichia coli]
 gb|OAE59037.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAE70636.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAF22259.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF31066.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF34598.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF37960.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF45887.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF49355.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF51019.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAF92744.1| Protein grpE [Escherichia coli PCN079]
 gb|OAF93372.1| Protein grpE [Escherichia coli PCN009]
 gb|OAI33237.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANE58859.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANE63620.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAJ78624.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAM46609.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SBL06840.1| Heat shock protein GrpE [Klebsiella oxytoca]
 gb|OAN08045.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OAO37653.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO42704.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO43202.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO52690.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO59985.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO65449.1| heat shock protein GrpE [Escherichia coli]
 gb|OAO74134.1| heat shock protein GrpE [Escherichia coli]
 gb|ANG70022.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|ANG75517.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|ANG81202.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OAR90989.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAR99910.1| molecular chaperone GrpE [Escherichia coli]
 gb|OAS94355.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAV57486.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANJ34100.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANJ39060.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAY16687.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANK02916.1| grpE [Escherichia coli O25b:H4]
 emb|CTQ82972.1| heat shock protein [Escherichia coli]
 gb|ANK54259.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANM83349.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANK33388.1| molecular chaperone GrpE [Escherichia coli]
 gb|OBU91991.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANP08536.1| molecular chaperone GrpE [Escherichia coli]
 gb|ANP19446.1| heat -hock protein GrpE [Escherichia coli]
 gb|ANP33583.1| molecular chaperone GrpE [Escherichia coli]
 gb|ANO79208.1| molecular chaperone GrpE [Escherichia coli]
 gb|ANQ02009.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANO28702.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANR82338.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OBZ37707.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OBZ39904.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OBZ48844.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCC32142.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OCC34048.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OCC36442.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OCC45485.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC45906.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OCC46411.1| molecular chaperone GrpE [Shigella sonnei]
 gb|OCC57854.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC63113.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC63479.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC71928.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC75458.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC79011.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC82824.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC90396.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCC91300.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD00127.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD03413.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD06170.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD14134.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD14887.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD16092.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD25536.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD27497.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD29721.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD40164.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD43947.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD44032.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD49500.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD53787.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD57066.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD62848.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD69663.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD72196.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD78664.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD78993.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD84336.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD86449.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD93209.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCD96195.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE04774.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE07643.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE08846.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE19178.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE21634.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE23536.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE29108.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE30717.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE36432.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE43998.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE44504.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE46415.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE55205.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE60864.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE62895.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE63308.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE68695.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE72548.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE84352.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE84370.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE88521.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE91355.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCE96356.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF00136.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF00968.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF03633.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF14493.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF14883.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OCF18544.1| nucleotide exchange factor GrpE [Shigella sonnei]
 emb|SCA72421.1| heat shock protein HSP70 cofactor [Escherichia coli]
 gb|OCJ86241.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCJ90921.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCJ93353.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCJ96381.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCK05460.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANV96808.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCK70454.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANW30784.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ANW41562.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OCQ14421.1| heat shock protein GrpE [Escherichia coli]
 gb|OCQ24097.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCQ46747.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS57772.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS77248.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS78368.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOD10252.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODA86800.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODB46152.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODG67570.1| nucleotide exchange factor GrpE [Shigella sp. FC1661]
 gb|ODG76848.1| nucleotide exchange factor GrpE [Shigella sp. FC1764]
 gb|ODG88961.1| nucleotide exchange factor GrpE [Shigella sp. FC1882]
 gb|ODH19246.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODH20607.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODH37750.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODH43129.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODJ15877.1| nucleotide exchange factor GrpE [Shigella sp. FC1180]
 gb|ODJ16063.1| nucleotide exchange factor GrpE [Shigella sp. FC1172]
 gb|ODJ22419.1| nucleotide exchange factor GrpE [Shigella sp. FC2383]
 gb|ODJ27832.1| nucleotide exchange factor GrpE [Shigella sp. FC2833]
 gb|ODJ36305.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODJ41551.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOM44330.1| Heat shock protein GrpE [Escherichia coli]
 gb|AOM71020.1| heat shock protein GrpE [Escherichia coli]
 gb|ODQ02401.1| nucleotide exchange factor GrpE [Shigella sp. FC1544]
 gb|ODQ08478.1| nucleotide exchange factor GrpE [Shigella sp. FC1056]
 gb|ODQ15047.1| nucleotide exchange factor GrpE [Shigella sp. FC1139]
 gb|OEB95728.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEG24276.1| nucleotide exchange factor GrpE [Shigella sp. FC2117]
 gb|OEG24348.1| nucleotide exchange factor GrpE [Shigella sp. FC2175]
 gb|OEG24377.1| nucleotide exchange factor GrpE [Shigella sp. FC2125]
 gb|OEG48211.1| nucleotide exchange factor GrpE [Shigella sp. FC2710]
 gb|OEG49852.1| nucleotide exchange factor GrpE [Shigella sp. FC2531]
 gb|OEG50354.1| nucleotide exchange factor GrpE [Shigella sp. FC2541]
 gb|OEG53932.1| nucleotide exchange factor GrpE [Shigella sp. FC3196]
 gb|OEG65533.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOR20900.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI07603.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI09961.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI10188.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI19752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI28919.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI30256.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI34842.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI48230.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI62274.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI65816.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEI90174.1| nucleotide exchange factor GrpE [Shigella sp. FC1708]
 gb|OEI90248.1| nucleotide exchange factor GrpE [Shigella sp. FC1567]
 gb|OEJ06682.1| nucleotide exchange factor GrpE [Shigella sp. FC1737]
 gb|OEL39777.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL44445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL47330.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL69634.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL81219.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL82818.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL94497.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL95674.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEL98352.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM07057.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM22855.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM24943.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM28614.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM40130.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM45081.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM47166.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM47317.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM55529.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM57807.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM67578.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM68482.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM74493.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM76195.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM79902.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM90951.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEM91885.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN04216.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN10185.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN12754.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN14237.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN19380.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN26520.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN31467.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN48038.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN53370.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN63469.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN76795.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN78012.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN82390.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN83984.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEN89260.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEO04156.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEO08320.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OEO23017.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOT31697.1| Heat shock protein GrpE [Escherichia coli]
 gb|AOV20443.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV25799.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV31150.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV36537.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV41929.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV47293.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AOV52689.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OFE24783.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOX51060.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AOX56463.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OHW34317.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SER27872.1| molecular chaperone GrpE [Escherichia coli]
 gb|APA25359.1| molecular chaperone GrpE [Escherichia coli]
 gb|OII50463.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII55259.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APA40995.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII81665.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII90109.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII90471.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII96026.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OII98115.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ68039.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ72308.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ88684.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ93549.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJF87226.1| molecular chaperone GrpE [Escherichia coli]
 emb|SHD58286.1| heat shock protein [Escherichia coli]
 gb|APE54380.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APE59331.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APE64208.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APE69046.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APE78817.1| Heat shock protein GrpE [Escherichia coli]
 gb|APE91025.1| Heat shock protein GrpE [Escherichia coli]
 gb|OJH23524.1| nucleotide exchange factor GrpE [Escherichia coli NA114]
 gb|APG35471.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APH99666.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API10823.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API16420.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API22073.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API27564.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API33221.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|API38802.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK16374.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK18359.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK21760.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK28429.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK34252.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK40218.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK41395.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK47030.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK49121.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK57561.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK65360.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK71248.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK74819.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK77713.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK82751.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK95438.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJK99833.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL01707.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL02019.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL20829.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL28322.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL38665.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL41594.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL51538.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL57311.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL58128.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL64672.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL71307.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL74671.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL83912.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJL86200.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM00619.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM05422.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM06015.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM22268.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM27767.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM30368.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM37232.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM50815.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM56575.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM59106.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM65945.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM73292.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM75783.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM81595.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM86193.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJM99691.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN05584.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN11808.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN18941.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN24093.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN32130.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN34560.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN41719.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN51810.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN54102.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN55728.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN63577.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN70507.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN73492.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN83556.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN84234.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN90195.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJN97359.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO06035.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO12928.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO23006.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO29324.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO32162.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO43742.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO47729.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO49853.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO58944.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO62495.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO62685.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO71388.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO75959.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO81602.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO84052.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO88461.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJO98446.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP03793.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP08456.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP14165.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP17073.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP24823.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP32977.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP33408.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP35873.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP41260.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP41880.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP52430.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP55830.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP59123.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP63577.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP67917.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP73376.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP82085.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP84556.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP87757.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP96428.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJP97922.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ08507.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ12610.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ17178.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ22330.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ26812.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ29386.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ30473.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ41768.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ41863.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ47848.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ52017.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ56356.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ67595.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ68485.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ71398.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ72074.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ82773.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ84109.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJQ91785.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR02181.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR10517.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR12835.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR13269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR27262.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR31587.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR32752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR41566.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR48865.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR54601.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR58784.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR65790.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR71779.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR76938.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR78620.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR87210.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR88442.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR89404.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJR97064.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS06466.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS07292.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS18866.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS31570.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS34617.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS42202.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS45894.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS54147.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS61620.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS64143.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS71881.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJS86758.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OJZ27859.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APJ71429.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ76363.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ83244.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ86128.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ93533.1| heat shock protein GrpE [Escherichia coli]
 gb|APJ97365.1| heat shock protein GrpE [Escherichia coli]
 gb|APK02756.1| heat shock protein GrpE [Escherichia coli]
 gb|APK05407.1| heat shock protein GrpE [Escherichia coli]
 gb|APK11865.1| heat shock protein GrpE [Escherichia coli]
 gb|APK16618.1| heat shock protein GrpE [Escherichia coli]
 gb|APK20269.1| heat shock protein GrpE [Escherichia coli]
 gb|APK26162.1| heat shock protein GrpE [Escherichia coli]
 gb|APK32690.1| heat shock protein GrpE [Escherichia coli]
 gb|APK40190.1| heat shock protein GrpE [Escherichia coli]
 gb|APK47796.1| heat shock protein GrpE [Escherichia coli]
 gb|APK52486.1| heat shock protein GrpE [Escherichia coli]
 gb|APK59151.1| heat shock protein GrpE [Escherichia coli]
 gb|APK60029.1| heat shock protein GrpE [Escherichia coli]
 gb|APK65763.1| heat shock protein GrpE [Escherichia coli]
 gb|APK72806.1| heat shock protein GrpE [Escherichia coli]
 gb|APK75680.1| heat shock protein GrpE [Escherichia coli]
 gb|APK80909.1| heat shock protein GrpE [Escherichia coli]
 gb|APK85301.1| heat shock protein GrpE [Escherichia coli]
 gb|APK89845.1| heat shock protein GrpE [Escherichia coli]
 gb|APL04252.1| heat shock protein GrpE [Escherichia coli]
 gb|APL14034.1| heat shock protein GrpE [Escherichia coli]
 gb|APL17725.1| heat shock protein GrpE [Escherichia coli]
 gb|APL21723.1| heat shock protein GrpE [Escherichia coli]
 gb|APL27462.1| heat shock protein GrpE [Escherichia coli]
 gb|APL36576.1| heat shock protein GrpE [Escherichia coli]
 gb|APL41728.1| heat shock protein GrpE [Escherichia coli]
 gb|APL56628.1| heat shock protein GrpE [Escherichia coli]
 gb|APL60937.1| heat shock protein GrpE [Escherichia coli]
 gb|APL65077.1| heat shock protein GrpE [Escherichia coli]
 gb|APL71364.1| heat shock protein GrpE [Escherichia coli]
 gb|APL76244.1| heat shock protein GrpE [Escherichia coli]
 gb|APL78950.1| heat shock protein GrpE [Escherichia coli]
 gb|APL88314.1| heat shock protein GrpE [Escherichia coli]
 gb|OKA58096.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKB74410.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKB79819.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKB83694.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKB92040.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKB94762.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKL79457.1| protein GrpE [Escherichia coli]
 gb|OKL96697.1| protein GrpE [Escherichia coli]
 gb|OKO56896.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKP62420.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKS72213.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKS97303.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT07159.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT07322.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT11848.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT12975.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT21765.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT31617.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT33002.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT38238.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT46736.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT51792.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT54194.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT59563.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT64980.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT79593.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT88674.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT92820.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT95724.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKT98568.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU02879.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU25757.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU27263.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU40586.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU42041.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU42452.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU52441.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU53339.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU63318.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU68347.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU68965.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU72440.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU82121.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKU97876.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV07831.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV27129.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV35761.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV35859.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV54818.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV55492.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV69444.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV70371.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV71973.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV73208.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV87634.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV88703.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV90445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKV99693.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW06973.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW18697.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW34247.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW35051.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW37284.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW43171.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW47822.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW52413.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW62102.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKW64708.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX00297.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX06064.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX07947.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX14145.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX15912.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX22150.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX24056.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX37738.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX45767.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX58414.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX59493.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX66358.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OKX72136.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLL61707.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APT01635.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLN78618.1| heat shock protein GrpE [Escherichia coli]
 gb|OLO95074.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APT61389.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLR31801.1| heat shock protein GrpE [Escherichia coli O25b:H4-ST131]
 gb|OLR84589.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLS71673.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLS75530.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLS84003.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLS88305.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLY56341.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OLY88245.1| nucleotide exchange factor GrpE [Escherichia coli O157:H43]
 gb|OMG98951.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OMH03630.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OMH07517.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|APW91794.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OMI44103.1| heat shock protein GrpE [Escherichia coli N37058PS]
 gb|OMI51420.1| heat shock protein GrpE [Escherichia coli N40607]
 gb|OMI54292.1| heat shock protein GrpE [Escherichia coli N37122PS]
 gb|OMI66941.1| heat shock protein GrpE [Escherichia coli N37139PS]
 gb|OMI67134.1| heat shock protein GrpE [Escherichia coli N36410PS]
 gb|OMI69227.1| heat shock protein GrpE [Escherichia coli N36254PS]
 emb|SIY28213.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX86085.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD72960.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC84635.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB91264.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD28437.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY55445.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK33266.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY41842.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI08462.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD54837.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC00615.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC99508.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD32943.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX71047.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB71484.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC47785.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD14175.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC98191.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC61151.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY27280.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC78564.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC06100.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY14563.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ06102.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY48569.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH08253.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB56293.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI60603.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC02332.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI12434.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY12185.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI12485.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC05284.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB97460.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC26700.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC33925.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC04667.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC76345.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI62431.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD30921.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC42856.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI33487.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY40974.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC68303.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ96822.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX59481.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY36640.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX90231.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY03710.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX61649.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ77412.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ00775.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY14707.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB18263.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA88838.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK27848.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD93198.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY41550.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA55296.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH06101.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI59427.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG47823.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI63035.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY53872.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC01958.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI03477.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI94143.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH62672.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX66435.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB80992.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH20758.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI55942.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD17206.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC81957.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB07868.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG94356.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA56271.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH70907.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH43744.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ99051.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK46564.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA77662.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY03716.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG71639.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA89285.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA46929.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB08745.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH25853.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH81180.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ90919.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA21626.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK65586.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB05589.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ36016.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC01687.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF92745.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY56926.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX87383.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA65328.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ90510.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI29176.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ73335.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY21573.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA73381.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY47550.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI65023.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ92095.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK71721.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY18826.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC25982.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH95320.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK49824.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH47050.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK75429.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY54942.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY18456.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ25412.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ77552.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK73520.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK77694.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ00120.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY27883.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ88988.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ53983.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY11731.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ45005.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI81180.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ08738.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY02305.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA23836.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA03254.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI97366.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY57301.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG90453.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ62482.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC16027.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY92147.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC11774.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY64370.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD04816.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ61118.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI96418.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI06860.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK19671.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY10584.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK61936.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ02744.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY34013.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ86657.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK18580.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA49917.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ90580.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY00830.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY49598.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ13365.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ17658.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC29872.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK18310.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ64196.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH47149.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG84039.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ91902.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB61086.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB81395.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY09478.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ02557.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK45047.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY70528.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY04887.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH17605.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX60512.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ41690.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA06715.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA46267.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH11383.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH54764.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ54894.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ33046.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK65472.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI22789.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC65885.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA21451.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY14216.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY74744.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF38267.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ66525.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ65609.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ92525.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK67491.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF93859.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB12566.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA53650.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB44234.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ37806.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI55399.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK49661.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY66588.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA05599.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ86111.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH53772.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB10827.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ61317.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH08422.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK17431.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJI39698.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA05482.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG91970.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB87356.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC18312.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC65433.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ00075.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF61017.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ59941.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK58948.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG86272.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF98028.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD67657.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF47651.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB58991.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF86037.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG96982.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJB25907.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK49069.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ62780.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC05962.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG45884.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF94147.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC94952.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK19595.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH26250.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ75219.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA18734.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG79439.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH30346.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF72062.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC24761.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK33126.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX68944.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH46027.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF17119.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF56929.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF44479.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG85358.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG52427.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC01031.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH28440.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK57384.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY32968.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE36456.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIX65731.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJC85637.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY67199.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF89476.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY73401.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE44584.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG98312.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF64551.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG71532.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH36977.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIZ73665.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ05306.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH26503.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE27186.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA14132.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE15097.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH94135.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE38001.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG45059.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF09441.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE53982.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE22104.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF21392.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH38094.1| heat shock protein GrpE [Shigella sonnei]
 emb|SIY14690.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG47644.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJJ61702.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK46416.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJA06542.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJH09591.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK68764.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE22907.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD63671.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE33546.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE98659.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD55379.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD79186.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD64431.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE04777.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF27617.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG86506.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD87815.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE67876.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE17297.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG42769.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF46415.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJG52717.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE37315.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF14308.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE22107.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE86435.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE53732.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE64611.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF04492.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF02438.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE26839.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJK52705.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE78890.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD65937.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE12960.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD69309.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJF29226.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJD75914.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE73147.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJE84579.1| heat shock protein GrpE [Shigella sonnei]
 gb|ONG30258.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SJK89576.1| heat shock protein [Escherichia coli]
 gb|ONK33843.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ONK35717.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SJM09942.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJM10023.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJM10046.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJM10001.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJM10361.1| heat shock protein GrpE [Shigella sonnei]
 emb|SJM11123.1| heat shock protein GrpE [Shigella sonnei]
 gb|ONN29070.1| molecular chaperone GrpE [Escherichia coli]
 emb|SJM24333.1| heat shock protein GrpE [Shigella sonnei]
 gb|OOC66024.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOC69942.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOC74444.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOG30834.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOH57789.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOH59292.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOH65111.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI13764.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI27557.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI31518.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI33548.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI43985.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI51302.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI57250.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI60316.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI65646.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI66915.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI74444.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI81032.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI86970.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI89651.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI94675.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ00336.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ02648.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ07417.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ16087.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ18902.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ26805.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ34928.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ40144.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ45382.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ48920.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ55782.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ64883.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ72419.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ73307.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ78633.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ85449.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ89616.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK00809.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK10270.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK25186.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK29809.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK32359.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK47225.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOM84265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OON46863.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQU00352.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOO76701.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OOO80921.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OOO89150.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|OOO90392.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|OOO91047.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|OOO99561.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP00680.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP02702.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP13680.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP21508.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP22207.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP27615.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP31296.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OOP35922.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OOP41332.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|AQV19406.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV24616.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV33286.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV38500.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV41367.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV47832.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV55820.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV62809.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV70094.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV72929.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV77804.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV84087.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQV91519.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQW01116.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQW08275.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQW13010.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQW16295.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOV68611.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOW22445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOW23000.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQW74189.1| nucleotide exchange factor GrpE [Escherichia coli M8]
 gb|OPH57059.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OPH64258.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OPH69044.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|AQZ76257.1| heat shock protein GrpE [Escherichia coli]
 gb|ARA06658.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARA19059.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARA30391.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARA38168.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARA62942.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OQK70298.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|ARD52440.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARE46638.1| nucleotide exchange factor GrpE [Escherichia coli C]
 dbj|BAX17000.1| heat shock protein GrpE [Escherichia coli]
 dbj|BAX21943.1| heat shock protein GrpE [Escherichia coli]
 gb|ORC98190.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD01850.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD04843.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD11713.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD12390.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD26293.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD37648.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD68114.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD71899.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD84283.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD87636.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARH98256.1| heat shock protein [Escherichia coli]
 gb|ORR81168.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORR81580.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORR89456.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORR92880.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORR94015.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS03929.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS06544.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS08849.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS17005.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS20534.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS22277.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS31108.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS34431.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS35091.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS44670.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS59147.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS60746.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS75219.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS82862.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORS89646.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT00399.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT02088.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT06223.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT19396.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT28978.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT33021.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORT38206.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SMB24527.1| Heat shock protein GrpE [Escherichia coli]
 emb|SMB24522.1| Heat shock protein GrpE [Escherichia coli]
 gb|OSB93309.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSC08080.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSC14793.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARJ95233.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSK01079.1| heat shock protein [Escherichia coli SHECO001]
 gb|OSK12895.1| co-chaperone GrpE [Escherichia coli FVEC1465]
 gb|OSK24809.1| co-chaperone GrpE [Escherichia coli TA144]
 gb|OSK25583.1| co-chaperone GrpE [Escherichia coli B574]
 gb|OSK37038.1| co-chaperone GrpE [Escherichia coli B671]
 gb|OSK42687.1| co-chaperone GrpE [Escherichia coli B108]
 gb|OSK60237.1| co-chaperone GrpE [Escherichia coli E560]
 gb|OSK64001.1| co-chaperone GrpE [Escherichia coli B921]
 gb|OSK67934.1| co-chaperone GrpE [Escherichia coli E1114]
 gb|OSK73319.1| co-chaperone GrpE [Escherichia coli H223]
 gb|OSK75727.1| co-chaperone GrpE [Escherichia coli H001]
 gb|OSK83800.1| co-chaperone GrpE [Escherichia coli H378]
 gb|OSK93036.1| co-chaperone GrpE [Escherichia coli TA447]
 gb|OSK96473.1| co-chaperone GrpE [Escherichia coli E1002]
 gb|OSL17382.1| co-chaperone GrpE [Escherichia coli B175]
 gb|OSL26332.1| co-chaperone GrpE [Escherichia coli TA255]
 gb|OSL27637.1| co-chaperone GrpE [Escherichia coli H617]
 gb|OSL36751.1| co-chaperone GrpE [Escherichia coli TA464]
 gb|OSL76014.1| co-chaperone GrpE [Escherichia coli TA014]
 gb|OSL82448.1| co-chaperone GrpE [Escherichia coli TA249]
 gb|OSL99529.1| co-chaperone GrpE [Escherichia coli R424]
 gb|OSM83942.1| heat shock protein [Escherichia coli SHECO003]
 gb|OSM89541.1| heat shock protein [Escherichia coli SHECO002]
 gb|OSP28861.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSQ41146.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARM78790.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSY84645.1| molecular chaperone GrpE [Escherichia coli]
 gb|ARQ25150.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTA10787.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB23538.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB23975.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB31699.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB34005.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB40431.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB44666.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB54898.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB58786.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB61212.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB68134.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB80627.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB88387.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTB97768.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC01507.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC16311.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC20343.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC26752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC31947.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC32919.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC46269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC47185.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC51755.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC67839.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC69585.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC76472.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC83977.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTC84128.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD03909.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD06221.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD15855.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD24158.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD30846.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD31921.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD34325.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD46585.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD48145.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD56379.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD69181.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD78834.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD88110.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD89375.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTD95361.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE04860.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE05487.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE14799.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE32646.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE33413.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE45621.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE46874.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE57924.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE64937.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE77874.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE85870.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTE89495.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARR34080.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARR40242.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|ARR62022.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARR65056.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV06407.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV14840.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV17564.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV18568.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV36488.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OTV43167.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUD11474.1| nucleotide exchange factor GrpE [Escherichia coli M4]
 gb|ARS04764.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OUF51799.1| protein GrpE [Escherichia coli]
 gb|OUF63665.1| protein GrpE [Escherichia coli]
 gb|OUF66925.1| protein GrpE [Escherichia coli]
 gb|OUF70058.1| protein GrpE [Escherichia coli]
 gb|OUF78009.1| protein GrpE [Escherichia coli]
 gb|OUF80450.1| protein GrpE [Escherichia coli]
 gb|OUF84983.1| protein GrpE [Escherichia coli]
 gb|OUF93128.1| protein GrpE [Escherichia coli]
 gb|OUF97649.1| protein GrpE [Escherichia coli]
 gb|OUG01045.1| protein GrpE [Escherichia coli]
 gb|OUG04573.1| protein GrpE [Escherichia coli]
 gb|OUG11037.1| protein GrpE [Escherichia coli]
 gb|OUG13420.1| protein GrpE [Escherichia coli]
 gb|OUG17573.1| protein GrpE [Escherichia coli]
 gb|OUG22533.1| protein GrpE [Escherichia coli]
 gb|OUG31381.1| protein GrpE [Escherichia coli]
 gb|OUJ64373.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUJ78114.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUJ91183.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUK55167.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUK60127.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUK88681.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUK89904.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUK90445.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUL12812.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ART17856.1| heat shock protein GrpE [Escherichia coli]
 gb|ART25640.1| heat shock protein GrpE [Escherichia coli]
 gb|ART43106.1| phage lambda replication; host DNA synthesis; heat shock protein;
           protein repair [Escherichia coli]
 gb|OUP43094.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUR48347.1| protein GrpE [Escherichia coli]
 gb|OUR54899.1| protein GrpE [Escherichia coli]
 gb|ARV28662.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARV47920.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OUZ44925.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ45303.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ52092.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ58288.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OUZ62835.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ63337.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OUZ71461.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ74095.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ80102.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ84933.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ88084.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OUZ92320.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OUZ96198.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OVB09722.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB15140.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB29859.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB37579.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB41900.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB44573.1| heat shock protein GrpE [Escherichia coli]
 gb|OVB58938.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC99161.1| heat shock protein GrpE [Escherichia coli]
 gb|OVC99910.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD12061.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD14766.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD21370.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD29845.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD39160.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD44897.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD47329.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD47501.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD55451.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD62619.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD66016.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD77928.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD78194.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD82481.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD90738.1| heat shock protein GrpE [Escherichia coli]
 gb|OVD97167.1| heat shock protein GrpE [Escherichia coli]
 gb|OVE00541.1| heat shock protein GrpE [Escherichia coli]
 gb|OVE25042.1| heat shock protein GrpE [Escherichia coli]
 gb|ARW88919.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARW91632.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARX13226.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARX27300.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARX29468.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARX55462.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OVG01583.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OVG43577.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OVJ55688.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OVY45851.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWB87515.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWB95468.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC00998.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC02100.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC19795.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC30865.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC32760.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC37039.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC37497.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC40720.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC46868.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC64388.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC73192.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC76588.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC83270.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC87815.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC91758.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC94323.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWC97219.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD01272.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD07190.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD07538.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD12379.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD21462.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD30693.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD33567.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD36278.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD45084.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD46611.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD50754.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD56213.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD56471.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD59779.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD67625.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD68221.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD76498.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD80534.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD81479.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD85911.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWD98053.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE08128.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE10931.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE13996.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE21027.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE23518.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE31207.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE36082.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE39325.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE48257.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE51379.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE58748.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE66619.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE68755.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE75082.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE77856.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE88402.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF10656.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF12802.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF21619.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWF25502.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARZ85005.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ARZ86879.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASA41760.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG40884.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG51776.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG53473.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG55901.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG63897.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG72172.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG74785.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG77210.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG82587.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG86241.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG94752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG98816.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWG98978.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWH09145.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWH10504.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWH22723.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWH22846.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASB79289.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASC15726.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWP90967.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWR16384.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OWR40361.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWS79158.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASE49082.1| nucleotide exchange factor GrpE [Escherichia coli O157]
 gb|ASF03418.1| nucleotide exchange factor GrpE [Escherichia coli O104:H4]
 gb|ASG48650.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWW50238.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWX90283.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWY49460.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASI15432.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASI49601.1| Heat shock protein GrpE [Escherichia coli]
 gb|ASJ29699.1| heat shock protein GrpE [Escherichia coli]
 gb|OXB28718.1| Protein grpE [Shigella flexneri 2a str. 301]
 gb|ASL33341.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASL57977.1| Heat shock protein GrpE [Escherichia coli]
 gb|OXJ45334.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ46133.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ54970.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ56230.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ71093.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ72745.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ78256.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ78594.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ87663.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ90974.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXJ98714.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK03710.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK19522.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK19751.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK25523.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK26960.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK35741.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK38704.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK46405.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK55213.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK58723.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK71377.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK81066.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK92039.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK95901.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASN32809.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|ASN34821.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|ASN41296.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXL46270.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXL58147.1| heat shock protein GrpE [Escherichia coli]
 gb|OXL62407.1| heat shock protein GrpE [Escherichia coli]
 gb|OXL65718.1| heat shock protein GrpE [Escherichia coli]
 gb|OXL77140.1| heat shock protein GrpE [Escherichia coli]
 gb|OXL77419.1| heat shock protein GrpE [Escherichia coli]
 gb|ASO78009.1| heat shock protein HSP70 cofactor [Escherichia coli]
 gb|ASO84410.1| heat shock protein HSP70 cofactor [Escherichia coli]
 gb|ASO89208.1| heat shock protein HSP70 cofactor [Escherichia coli]
 gb|ASO93939.1| heat shock protein HSP70 cofactor [Escherichia coli]
 gb|OXU86509.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXU94808.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASQ54182.1| nucleotide exchange factor GrpE [Shigella flexneri 4c]
 gb|ASQ57998.1| nucleotide exchange factor GrpE [Shigella flexneri 4c]
 gb|ASQ62464.1| nucleotide exchange factor GrpE [Shigella flexneri 1a]
 gb|ASQ68144.1| heat shock protein [Escherichia coli NCCP15648]
 gb|ASQ81163.1| nucleotide exchange factor GrpE [Shigella flexneri 1a]
 gb|OXV14656.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXV34573.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXW57342.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW62130.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW62489.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXW70935.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW75158.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW77853.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXW84756.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW89603.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OXW92319.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXW97745.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXX01955.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXX06208.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXX11885.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|OXX15784.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OXZ50159.1| protein GrpE [Escherichia coli]
 gb|OXZ55535.1| protein GrpE [Escherichia coli]
 gb|OXZ55859.1| protein GrpE [Escherichia coli]
 gb|OXZ65516.1| protein GrpE [Escherichia coli]
 gb|OXZ75803.1| protein GrpE [Escherichia coli]
 gb|OXZ77061.1| protein GrpE [Escherichia coli]
 gb|OXZ78939.1| protein GrpE [Escherichia coli]
 gb|OXZ86385.1| protein GrpE [Escherichia coli]
 gb|OXZ87058.1| protein GrpE [Escherichia coli]
 gb|OXZ91768.1| protein GrpE [Escherichia coli]
 gb|OXZ98545.1| protein GrpE [Escherichia coli]
 gb|OYA00405.1| protein GrpE [Escherichia coli]
 gb|OYA03348.1| protein GrpE [Escherichia coli]
 gb|OYA13841.1| protein GrpE [Escherichia coli]
 gb|OYA18144.1| protein GrpE [Escherichia coli]
 gb|OYA18260.1| protein GrpE [Escherichia coli]
 gb|OYA22826.1| protein GrpE [Escherichia coli]
 gb|OYA26630.1| protein GrpE [Escherichia coli]
 gb|OYA38315.1| protein GrpE [Escherichia coli]
 gb|OYA40396.1| protein GrpE [Escherichia coli]
 gb|OYA43557.1| protein GrpE [Escherichia coli]
 gb|OYA51752.1| protein GrpE [Escherichia coli]
 gb|OYA52644.1| protein GrpE [Escherichia coli]
 gb|OYA61513.1| protein GrpE [Escherichia coli]
 gb|OYA69443.1| protein GrpE [Escherichia coli]
 gb|OYA78363.1| protein GrpE [Escherichia coli]
 gb|OYA82064.1| protein GrpE [Escherichia coli]
 gb|OYA87660.1| protein GrpE [Escherichia coli]
 gb|OYA93135.1| protein GrpE [Escherichia coli]
 gb|OYB01980.1| protein GrpE [Escherichia coli]
 gb|OYB03870.1| protein GrpE [Escherichia coli]
 gb|OYB08404.1| protein GrpE [Escherichia coli]
 gb|OYB08588.1| protein GrpE [Escherichia coli]
 gb|OYB16159.1| protein GrpE [Escherichia coli]
 gb|OYB21649.1| protein GrpE [Escherichia coli]
 gb|OYB21764.1| protein GrpE [Escherichia coli]
 gb|OYB28347.1| protein GrpE [Escherichia coli]
 gb|OYB35114.1| protein GrpE [Escherichia coli]
 gb|OYB36344.1| protein GrpE [Escherichia coli]
 gb|OYB40483.1| protein GrpE [Escherichia coli]
 gb|OYB53965.1| protein GrpE [Escherichia coli]
 gb|OYB55748.1| protein GrpE [Escherichia coli]
 gb|OYB58823.1| protein GrpE [Escherichia coli]
 gb|OYB66806.1| protein GrpE [Escherichia coli]
 gb|OYB70046.1| protein GrpE [Escherichia coli]
 gb|OYB72800.1| protein GrpE [Escherichia coli]
 gb|OYB79251.1| protein GrpE [Escherichia coli]
 gb|OYB79871.1| protein GrpE [Escherichia coli]
 gb|OYB86510.1| protein GrpE [Escherichia coli]
 gb|OYB87609.1| protein GrpE [Escherichia coli]
 gb|OYB94442.1| protein GrpE [Escherichia coli]
 gb|OYB98738.1| protein GrpE [Escherichia coli]
 gb|OYC06850.1| protein GrpE [Escherichia coli]
 gb|OYC09353.1| protein GrpE [Escherichia coli]
 gb|OYC17959.1| protein GrpE [Escherichia coli]
 gb|OYC18146.1| protein GrpE [Escherichia coli]
 gb|OYC22072.1| protein GrpE [Escherichia coli]
 gb|OYC28947.1| protein GrpE [Escherichia coli]
 gb|OYC31156.1| protein GrpE [Escherichia coli]
 gb|OYC34135.1| protein GrpE [Escherichia coli]
 gb|OYC41657.1| protein GrpE [Escherichia coli]
 gb|OYC48341.1| protein GrpE [Escherichia coli]
 gb|OYC52122.1| protein GrpE [Escherichia coli]
 gb|OYC59913.1| protein GrpE [Escherichia coli]
 gb|OYC67767.1| protein GrpE [Escherichia coli]
 gb|OYC72035.1| protein GrpE [Escherichia coli]
 gb|OYC76408.1| protein GrpE [Escherichia coli]
 gb|OYC82812.1| protein GrpE [Escherichia coli]
 gb|OYC85347.1| protein GrpE [Escherichia coli]
 gb|OYD28469.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYE14556.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYE15206.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYE51530.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYE80746.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYF29847.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYF62067.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYF84070.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG08395.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG63250.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG73184.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYG78285.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG80994.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG88152.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG88276.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYG91141.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI00738.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI07580.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI16464.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI34589.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI42030.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYI44697.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI49414.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI56275.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI66658.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI68403.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI73584.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYI76209.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYI90086.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ08203.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYJ15830.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ23203.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ26613.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ40205.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ43307.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYJ60737.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ66302.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYJ68443.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYJ75806.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYK30816.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYK31331.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYK45861.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYK46048.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYK46363.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYK57521.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYK57996.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYK64342.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL16676.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL23195.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL29940.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL35656.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYL37530.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL50791.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYL67381.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYL84314.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|OYN30364.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|OYN42001.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYN44467.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AST64949.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYQ52180.1| nucleotide exchange factor GrpE [Shigella sonnei]
 emb|SNW11613.1| heat shock protein [Escherichia coli]
 gb|OZG33997.1| nucleotide exchange factor GrpE [Escherichia coli O157:H7]
 gb|OZM89734.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZM95856.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZN02057.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZN05404.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO51930.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO57275.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO62000.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO67000.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO71972.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO76861.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO86909.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZO91779.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZP01228.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZP06277.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZP11265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZP16215.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZP32717.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZR93666.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZS00078.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZS03458.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZS09189.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZS13976.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX63195.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX67335.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX73655.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX79371.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX82195.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX88452.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX93945.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZX95193.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZY03387.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZY08029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZY13624.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZY20335.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OZY23303.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB64712.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB75124.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB79133.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB88118.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB89843.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAB95644.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAC00059.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAC05553.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAL30282.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAL33227.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAL35878.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAL41819.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAL56697.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ59138.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ69817.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ70659.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ79218.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ81918.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ90676.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAQ92987.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAR04235.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS49479.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS51451.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS58032.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS61500.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS68549.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS73472.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS79662.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS82145.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAS86495.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|CTP96254.1| Heat shock protein GrpE [Escherichia coli]
 gb|ASX04929.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT75070.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT79083.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT84597.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT93770.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT94450.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAT96751.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAU09789.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAU10599.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAU24351.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAU25219.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAX49731.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAX57858.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASZ42584.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASZ47065.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAY71302.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PAY77197.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PAY83117.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PAY83540.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PAY84613.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PAY98320.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PAZ62842.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ63035.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PAZ84387.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB14692.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBK10173.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBK16317.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBK18058.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBK21740.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBK39838.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB77363.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB82026.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB91967.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATB97019.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATC01735.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATC08752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATC11448.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATC16447.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN48947.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN55465.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN61547.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN73837.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN76029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN83725.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN89874.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBN90022.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO07045.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PBO53342.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO53613.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO55198.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO62738.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO63658.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO71205.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO75509.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO78188.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBO86556.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PBO94379.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PBQ37477.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ42178.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ52946.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ55784.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ60500.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ67011.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ74300.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ75910.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ81056.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ86369.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ91415.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ96640.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBQ98587.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR07244.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR10498.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR21236.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR22770.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR28269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR36403.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR39407.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR49858.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR62805.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR68100.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR74913.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR80403.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR86138.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBR93530.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS02480.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS06356.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS22628.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS52710.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS56552.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS64457.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS68501.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS70349.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS74715.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS79911.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS87263.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS90451.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBS94085.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT00424.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT07293.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT12420.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT13001.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT18116.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT21520.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT34426.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT40510.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT42513.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT46892.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT57260.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT59243.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT62881.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT69547.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT71035.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT78797.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT83564.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT85856.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT90439.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT97819.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBT99636.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU04159.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU13722.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU23565.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU33020.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU38540.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU46143.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU48571.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU51196.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU57644.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU76424.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU80258.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU87335.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU93155.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PBU93900.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCD47473.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG21386.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG26697.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG31934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG38391.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG41912.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG47083.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCG52571.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATG04537.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATG11366.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM07483.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM10458.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM12946.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM20539.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM22906.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCM29950.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO23988.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO31177.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO54346.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO59097.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO83299.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO86771.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO96783.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCP01155.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCQ50221.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCQ85063.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCQ86883.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCQ92040.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCR52456.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCR57716.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCR62538.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCR69537.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCR73223.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS37143.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS47615.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS49269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS56382.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS63768.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS64984.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS74676.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS75308.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS88229.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS89273.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS94262.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCT15479.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCT19947.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCT33023.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATH68937.1| nucleotide exchange factor GrpE [Shigella flexneri 1c]
 gb|ATH87451.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|ATI07573.1| nucleotide exchange factor GrpE [Escherichia coli M12]
 gb|PDM42801.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDM88186.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDM96362.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDN04491.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDN91889.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDN95699.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDN99674.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO06519.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO13915.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO17123.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO26398.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO30464.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO35371.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO37650.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO45385.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO50152.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO54272.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO57582.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO64499.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDO67271.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDS10908.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDS12188.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDS15968.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDT93217.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDT98463.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU03934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU09478.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU15279.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU19698.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU24952.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU30536.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU36185.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU42543.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU48823.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU54851.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU59928.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU65175.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU70801.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU76017.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU81490.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU86914.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU93270.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDU99857.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV09664.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV15093.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV22329.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV27103.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV43087.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV58053.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV62690.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV73078.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV74529.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV80277.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PDV92141.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PEH62679.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PEH93184.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PEI01377.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PEI18022.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGF63009.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGF68638.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGF75715.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGF86452.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGF95068.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG04833.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG23858.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG43404.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG44382.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG60671.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG68600.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PGG68924.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHG87280.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHG93269.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHH31341.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATM09429.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATM27525.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATM83976.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHK61208.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHK70510.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL24909.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL38158.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL43767.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL52464.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL58027.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL66695.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL72323.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL98081.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHN13695.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATO78713.1| nucleotide exchange factor GrpE [Escherichia coli O91 str. RM7190]
 gb|PHU43469.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PHU47985.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PHU52374.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PHU56889.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PHU61022.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PHU65406.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PHU70732.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PHU74187.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PHU78451.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PHU83793.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PHU87168.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PHU92641.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PHU96716.1| nucleotide exchange factor GrpE [Shigella boydii]
 emb|SLM07838.1| heat shock protein GrpE [Escherichia coli O127:H6]
 emb|SNU20347.1| heat shock protein GrpE [Escherichia coli O127:H6]
 gb|ATP25610.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHW93890.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHW99243.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIA81575.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM16125.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM29174.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM45986.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM58829.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM61482.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATU34046.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATV09825.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATV49995.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATV74410.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIS74209.1| heat shock protein GrpE [Escherichia coli O55:H7 str. USDA 5905]
 gb|ATW96801.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX11261.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX15933.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX21560.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX44600.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX47414.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX53796.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX56271.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF59539.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF63825.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF67871.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF70333.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF74329.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF81479.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF84002.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF89791.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF93751.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJF96878.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG05752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG06635.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG11236.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG19283.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG22201.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG29437.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG32992.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJG73916.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATY22901.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJH96668.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJI56609.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJI61296.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJN76720.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJO18417.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATX34658.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATZ39026.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJR37816.1| heat shock protein GrpE [Escherichia coli O55:H7 str. TB182A]
 gb|PJR43392.1| heat shock protein GrpE [Escherichia coli O157:H7 str. EC1825]
 gb|PJW24327.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW28514.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW34392.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW39028.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW50278.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW55293.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW59622.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW66643.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW68380.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW73062.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW77989.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW98531.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJX02866.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ATZ33789.1| molecular chaperone GrpE [Escherichia coli]
 gb|PJX79969.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJX86928.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJX91482.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJX99190.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY04861.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY05950.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY15318.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY26976.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY32251.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY38407.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY43437.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY50330.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY53214.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY59339.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJY90866.1| nucleotide exchange factor GrpE [Shigella sonnei]
 emb|SMZ44156.1| Heat shock protein GrpE [Escherichia coli]
 gb|AUA47841.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD52428.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD55969.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD67050.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD67367.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD74403.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD81806.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKD93747.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE02889.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE08573.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE78718.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE83534.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE88041.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE96557.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKE98661.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKF00019.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKF12940.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKF52888.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKG05887.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKI95017.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ08438.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ10934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ16510.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ22922.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ26497.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ31029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ40389.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ46302.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKJ49762.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKQ93893.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKR61550.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKR67584.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKR75163.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKZ11363.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKZ31734.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PKZ48231.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLA86788.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLA98552.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLB56894.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLB61839.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLB69984.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLB72252.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLB75662.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUJ90047.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUJ97095.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUK00056.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUK10419.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUK15648.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUK20769.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLJ80911.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLJ82766.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLJ83752.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLK01370.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLK01656.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLK09577.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLK12498.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PLR07346.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUF91872.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUL62587.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUL69115.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUN46670.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PMD76919.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PMD88643.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PMD94307.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PME06461.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|SOQ97070.1| heat shock protein [Escherichia coli]
 emb|SOQ92514.1| heat shock protein [Escherichia coli]
 emb|SOQ99754.1| heat shock protein [Escherichia coli]
 emb|SOQ86446.1| heat shock protein [Escherichia coli]
 emb|SOQ63490.1| heat shock protein [Escherichia coli]
 emb|SOQ65264.1| heat shock protein [Escherichia coli]
 emb|SOQ78042.1| heat shock protein [Escherichia coli]
 emb|SOQ82698.1| heat shock protein [Escherichia coli]
 emb|SOQ73830.1| heat shock protein [Escherichia coli]
 emb|SOR05729.1| heat shock protein [Escherichia coli]
 gb|AUO33408.1| protein GrpE [Escherichia coli]
 gb|AUO39373.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUO58767.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNC13971.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND42717.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUQ38297.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND68072.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND74716.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND79931.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND86059.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNL69924.1| nucleotide exchange factor GrpE [Escherichia coli O157]
 gb|PNM72230.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PNN25931.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNO47454.1| nucleotide exchange factor GrpE [Shigella sonnei]
 gb|PNO94703.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNP02317.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PNP63314.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUP45801.1| molecular chaperone GrpE [Escherichia coli]
 gb|AUS37293.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNR11222.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNR16377.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNR23810.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUT08086.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUN91281.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNY42676.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNY51907.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PNY65248.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUV22990.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUV32945.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POF66540.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POF69592.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUU30864.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|POH99139.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POI00756.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POI08939.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUX01502.1| Heat shock protein GrpE [Escherichia coli]
 gb|POO36415.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUY04528.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POR91167.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|POR95332.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|POS17497.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS34568.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS39088.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS43576.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS58875.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS97823.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS98085.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POS98281.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POT10888.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POT12003.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POT12036.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POU27734.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POV25137.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUZ90141.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POZ10265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVB44658.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPA51629.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE08884.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE15577.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE15955.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE23171.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE40238.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE44109.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE52603.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE93032.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVE94864.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVG00267.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPO16196.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPP01528.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV43794.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV44593.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV52877.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV56263.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV65710.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV67471.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV76718.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV83134.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV86760.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV92492.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV98010.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPV99244.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW06654.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW14545.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW15076.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW21824.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW31187.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW37268.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW39784.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW45373.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW51511.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW63796.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW67522.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW68253.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW76902.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW80821.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW84603.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW92042.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW94068.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPW94333.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX08574.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX11547.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX12051.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX21265.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX23761.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX30816.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX34403.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX40556.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX47379.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX47866.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX56179.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPX57083.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY58222.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY72589.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY73394.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY81458.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY84689.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY90548.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY97234.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY97554.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPY97655.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ06507.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ16063.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ19415.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ24075.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ39653.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPZ53575.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA01117.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA01234.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA15960.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA17029.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA20803.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA29542.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA33422.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA39776.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA52025.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA65717.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQA69769.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQH07342.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQI95188.1| nucleotide exchange factor GrpE [Escherichia fergusonii]
 gb|PQI97935.1| nucleotide exchange factor GrpE [Escherichia fergusonii]
 gb|PQK18620.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK27809.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK28106.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK36731.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK38525.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK43971.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK56592.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK61276.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQK66004.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVJ14267.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQM84384.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQM85098.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQM94799.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQM99662.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN10125.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|PQN11467.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|PQN12684.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN18157.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN25278.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN32998.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN33299.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PQN40220.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN40667.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|PQN54081.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|PQN58471.1| nucleotide exchange factor GrpE [Shigella boydii]
 gb|PQN58959.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN62291.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN65303.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN74792.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN80693.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN86518.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN88186.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQN97520.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQO02071.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQO03060.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQO05875.1| nucleotide exchange factor GrpE [Shigella dysenteriae]
 gb|PQO16236.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQO19644.1| nucleotide exchange factor GrpE [Shigella flexneri]
 gb|PQO73930.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQO78286.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQO84969.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQO90859.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQP11900.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQP32039.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVJ76567.1| protein GrpE [Escherichia coli]
 gb|PQV19538.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQV24218.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQV32090.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRB30729.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRC14383.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVL30531.1| nucleotide exchange factor GrpE [Escherichia coli O104:H4]
 gb|AVM05498.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRO96689.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP13246.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP26282.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP32064.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP33835.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRP47302.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVN00220.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVN08785.1| protein GrpE [Escherichia coli]
 gb|AVL07531.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AVN38731.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PRW53705.1| protein GrpE [Escherichia coli]
 gb|PSB94850.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF28359.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF41698.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF47116.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF50737.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF58933.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF66063.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF73886.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF76050.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF80339.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF87432.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF94340.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSF94934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG02078.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG06932.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG11357.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG15943.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG21273.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG25344.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG30722.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG35276.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG39569.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG45199.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG49292.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG55392.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG59206.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG70676.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PSG76030.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_053271178.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>gb|ODQ13691.1| nucleotide exchange factor GrpE [Shigella sp. FC569]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_021578969.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ERA07731.1| protein grpE [Escherichia coli UMEA 3821-1]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_001701929.1| nucleotide exchange factor GrpE [Escherichia coli]
 emb|CCJ45166.1| phage lambda replication [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>ref|WP_001332400.1| MULTISPECIES: nucleotide exchange factor GrpE [Escherichia]
 sp|Q1R8B1.1|GRPE_ECOUT RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7MIV1.1|GRPE_ECO45 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 sp|B7MYA6.1|GRPE_ECO81 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor
 gb|ABE08403.1| GrpE protein [Escherichia coli UTI89]
 emb|CAR04053.1| heat shock protein [Escherichia coli S88]
 emb|CAR09072.1| heat shock protein [Escherichia coli ED1a]
 gb|EEH86098.1| protein grpE [Escherichia sp. 3_2_53FAA]
 gb|ADE88692.1| co-chaperone GrpE [Escherichia coli IHE3034]
 gb|ADN70141.1| heat shock protein GrpE [Escherichia coli UM146]
 gb|EFU44291.1| co-chaperone GrpE [Escherichia coli MS 110-3]
 gb|EGB47064.1| GrpE protein [Escherichia coli H252]
 gb|EGB52746.1| GrpE protein [Escherichia coli H263]
 gb|EHG00072.1| heat shock protein HSP70 cofactor [Escherichia coli cloneA_i1]
 gb|EHN94607.1| grpE [Escherichia coli H397]
 gb|EIL77450.1| heat shock protein GrpE [Escherichia coli HM605]
 gb|ELB99203.1| protein grpE [Escherichia coli KTE4]
 gb|ELC08067.1| protein grpE [Escherichia coli KTE5]
 gb|ELD09438.1| protein grpE [Escherichia coli KTE205]
 gb|ELE09464.1| protein grpE [Escherichia coli KTE55]
 gb|ELE22291.1| protein grpE [Escherichia coli KTE58]
 gb|ELE24561.1| protein grpE [Escherichia coli KTE57]
 gb|ELE31779.1| protein grpE [Escherichia coli KTE62]
 gb|ELF90741.1| protein grpE [Escherichia coli KTE22]
 gb|ELG13163.1| protein grpE [Escherichia coli KTE59]
 gb|ELG23430.1| protein grpE [Escherichia coli KTE65]
 gb|ELG53515.1| protein grpE [Escherichia coli KTE118]
 gb|ELG64042.1| protein grpE [Escherichia coli KTE123]
 gb|ELH91215.1| protein grpE [Escherichia coli KTE227]
 gb|ELI00040.1| protein grpE [Escherichia coli KTE229]
 gb|ELI58116.1| protein grpE [Escherichia coli KTE129]
 gb|ELJ09232.1| protein grpE [Escherichia coli KTE157]
 gb|ELJ39182.1| protein grpE [Escherichia coli KTE176]
 gb|ELJ51331.1| protein grpE [Escherichia coli KTE179]
 gb|ELJ52134.1| protein grpE [Escherichia coli KTE180]
 gb|ELJ69666.1| protein grpE [Escherichia coli KTE85]
 gb|EOU31398.1| protein grpE [Escherichia coli KTE7]
 gb|EOU34709.1| protein grpE [Escherichia coli KTE3]
 gb|EOU75189.1| protein grpE [Escherichia coli KTE27]
 gb|EOV33619.1| protein grpE [Escherichia coli KTE219]
 gb|EOW96141.1| protein grpE [Escherichia coli KTE182]
 gb|EOX11260.1| protein grpE [Escherichia coli KTE240]
 gb|EOX29100.1| protein grpE [Escherichia coli KTE186]
 gb|EQN07010.1| protein grpE [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN11905.1| protein grpE [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN17060.1| protein grpE [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN57688.1| protein grpE [Escherichia coli HVH 19 (4-7154984)]
 gb|EQN83953.1| protein grpE [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN92050.1| protein grpE [Escherichia coli HVH 26 (4-5703913)]
 gb|EQO10470.1| protein grpE [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO21694.1| protein grpE [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO30644.1| protein grpE [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO60208.1| protein grpE [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO83876.1| protein grpE [Escherichia coli HVH 48 (4-2658593)]
 gb|EQP17100.1| protein grpE [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP50890.1| protein grpE [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP60644.1| protein grpE [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP83778.1| protein grpE [Escherichia coli HVH 80 (4-2428830)]
 gb|EQQ39189.1| protein grpE [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ48242.1| protein grpE [Escherichia coli HVH 104 (4-6977960)]
 gb|EQQ72646.1| protein grpE [Escherichia coli HVH 107 (4-5860571)]
 gb|EQR18625.1| protein grpE [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR46887.1| protein grpE [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR52251.1| protein grpE [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR58335.1| protein grpE [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR87525.1| protein grpE [Escherichia coli HVH 137 (4-2124971)]
 gb|EQT14016.1| protein grpE [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT27374.1| protein grpE [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT76660.1| protein grpE [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT81143.1| protein grpE [Escherichia coli HVH 192 (4-3054470)]
 gb|EQU05234.1| protein grpE [Escherichia coli HVH 196 (4-4530470)]
 gb|EQU10727.1| protein grpE [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU23362.1| protein grpE [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU33203.1| protein grpE [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU68719.1| protein grpE [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU78059.1| protein grpE [Escherichia coli HVH 213 (4-3042928)]
 gb|EQU92363.1| protein grpE [Escherichia coli HVH 217 (4-1022806)]
 gb|EQV06826.1| protein grpE [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV26845.1| protein grpE [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV42254.1| protein grpE [Escherichia coli KOEGE 32 (66a)]
 gb|EQW31371.1| protein grpE [Escherichia coli UMEA 3041-1]
 gb|EQW60287.1| protein grpE [Escherichia coli UMEA 3088-1]
 gb|EQW84510.1| protein grpE [Escherichia coli UMEA 3122-1]
 gb|EQX10052.1| protein grpE [Escherichia coli UMEA 3140-1]
 gb|EQX25373.1| protein grpE [Escherichia coli UMEA 3162-1]
 gb|EQX99062.1| protein grpE [Escherichia coli UMEA 3203-1]
 gb|EQY01200.1| protein grpE [Escherichia coli UMEA 3206-1]
 gb|EQY14482.1| protein grpE [Escherichia coli UMEA 3215-1]
 gb|EQZ54181.1| protein grpE [Escherichia coli UMEA 3662-1]
 gb|EQZ77106.1| protein grpE [Escherichia coli UMEA 3702-1]
 gb|ERA19714.1| protein grpE [Escherichia coli UMEA 3834-1]
 gb|ERA20473.1| protein grpE [Escherichia coli UMEA 3893-1]
 gb|ERA89144.1| protein grpE [Escherichia coli HVH 210 (4-3042480)]
 gb|ERB33074.1| protein grpE [Escherichia coli UMEA 3298-1]
 emb|CDH66222.1| Heat shock protein B25.3 [Escherichia coli PMV-1]
 gb|ESE18133.1| co-chaperone GrpE [Escherichia coli 908675]
 gb|ESE24613.1| co-chaperone GrpE [Escherichia coli 910096-2]
 gb|ESP17372.1| protein grpE [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP27703.1| protein grpE [Escherichia coli HVH 148 (4-3192490)]
 gb|ESP30935.1| protein grpE [Escherichia coli HVH 178 (4-3189163)]
 gb|ETF31427.1| protein grpE [Escherichia coli HVH 214 (4-3062198)]
 gb|ETY56217.1| protein grpE [Escherichia coli BIDMC 49b]
 gb|ETY59126.1| protein grpE [Escherichia coli BIDMC 49a]
 gb|EYV88386.1| heat shock protein GrpE [Escherichia coli O86:H34 str. 99-3124]
 gb|EZA18463.1| heat shock protein GrpE [Escherichia coli O81:NM str. 02-3012]
 gb|KDG00558.1| protein grpE [Escherichia coli BIDMC 65]
 gb|KDG14502.1| protein grpE [Escherichia coli BIDMC 72]
 gb|KDG17185.1| protein grpE [Escherichia coli BIDMC 73]
 gb|KFB95498.1| GrpE family heat shock protein [Escherichia coli DSM 30083 = JCM
           1649 = ATCC 11775]
 gb|AJB35743.1| heat shock protein GrpE [Escherichia coli APEC IMT5155]
 gb|KIE71394.1| heat shock protein GrpE [Escherichia coli]
 gb|KIE75727.1| heat shock protein GrpE [Escherichia coli RS218]
 gb|AJM74800.1| heat shock protein GrpE [Escherichia coli RS218]
 gb|KJG97030.1| heat shock protein GrpE [Escherichia coli]
 gb|AKK34194.1| heat shock protein GrpE [Escherichia coli APEC O18]
 gb|AKK43719.1| heat shock protein GrpE [Escherichia coli]
 gb|KLX82785.1| protein GrpE [Escherichia coli]
 gb|KLX99670.1| protein GrpE [Escherichia coli]
 gb|KMV57742.1| heat shock protein GrpE [Escherichia coli]
 gb|KNY03318.1| heat shock protein GrpE [Escherichia coli]
 gb|ALD24101.1| heat -hock protein GrpE [Escherichia coli]
 gb|ALD38978.1| heat -hock protein GrpE [Escherichia coli]
 gb|ALD29261.1| heat -hock protein GrpE [Escherichia coli]
 gb|ALD34276.1| heat -hock protein GrpE [Escherichia coli]
 gb|KQI95182.1| heat -hock protein GrpE [Escherichia coli]
 gb|KSY96429.1| molecular chaperone GrpE [Escherichia coli]
 emb|CRL89748.1| heat shock protein [Escherichia coli]
 gb|KUR89336.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS27792.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS42812.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS55610.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS58740.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUS97409.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT02502.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUT52652.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUU73176.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUV57666.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUW86642.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX01545.1| molecular chaperone GrpE [Escherichia coli]
 gb|KUX75053.1| molecular chaperone GrpE [Escherichia coli]
 gb|KVI13182.1| molecular chaperone GrpE [Escherichia coli]
 gb|KVI18195.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXK97642.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL24571.1| molecular chaperone GrpE [Escherichia coli]
 gb|KXL33949.1| molecular chaperone GrpE [Escherichia coli]
 gb|KZG97988.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZH74310.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI25325.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI43363.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZI43399.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZJ73526.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|KZK02288.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OAT61242.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS62808.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS63275.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OCS76889.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ODB51441.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OHV06179.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIU73506.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIU73944.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY18173.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY29663.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY36014.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY47714.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY47944.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY59961.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY60934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY61399.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY61675.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY72107.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY73097.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY74279.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY91171.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIY95852.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ00007.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ02476.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ06089.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ15431.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ15868.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ19461.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ30280.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OIZ33320.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ONK49302.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI12184.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOI16257.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ57571.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ93922.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOJ98606.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OOK18817.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AQX97835.1| nucleotide exchange factor GrpE [Escherichia coli NU14]
 gb|OPI29691.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI35630.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI43199.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI44902.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI47533.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI56913.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI60856.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI61032.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI74598.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI77794.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI78744.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI93767.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI94706.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPI97132.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ03548.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ04973.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ08127.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ18629.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ25033.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ25832.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ26894.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ29761.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ41459.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ52539.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OPJ52967.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD21986.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ORD59363.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OSL04241.1| co-chaperone GrpE [Escherichia coli H296]
 gb|OSL10662.1| co-chaperone GrpE [Escherichia coli H305]
 gb|OUR45141.1| protein GrpE [Escherichia coli]
 gb|OWB93403.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE84852.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OWE88075.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK67378.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OXK68920.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|OYA34192.1| protein GrpE [Escherichia coli]
 gb|OYA67578.1| protein GrpE [Escherichia coli]
 gb|OYK72934.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|ASW60737.1| phage lambda replication [Escherichia coli]
 gb|PBO90990.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCO74907.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PCS40556.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PHL29966.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM06593.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM11406.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PIM21076.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PJW85719.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUG65667.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUG94389.1| protein repair [Escherichia coli]
 gb|PKZ79068.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUM06992.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PND97460.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POH76228.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL44598.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL49685.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL55411.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL55856.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL65518.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL69651.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL73474.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL82088.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL84153.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL91636.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL94053.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|POL94094.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|AUY43653.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PPE25584.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQV23205.1| nucleotide exchange factor GrpE [Escherichia coli]
 gb|PQV35946.1| nucleotide exchange factor GrpE [Escherichia coli]
          Length = 197

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 14  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 73

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 74  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 133

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 134 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 192


>gb|OSK84778.1| co-chaperone GrpE [Escherichia coli B367]
          Length = 205

 Score =  343 bits (881), Expect = e-119
 Identities = 178/179 (99%), Positives = 179/179 (100%)
 Frame = +1

Query: 1   PEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLR 180
           PEEIIMDQHEEIEAVEPEASAEQVDPRDEK+ANLEAQLAEAQTRERDGILRVKAEMENLR
Sbjct: 22  PEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLR 81

Query: 181 RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 360
           RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV
Sbjct: 82  RRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDV 141

Query: 361 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 537
           VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV
Sbjct: 142 VRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTV 200