BLASTX nr result
ID: Acanthopanax21_contig00001449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00001449 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT48468.1| hypothetical protein CQW23_12676 [Capsicum baccatum] 99 1e-22 >gb|PHT48468.1| hypothetical protein CQW23_12676 [Capsicum baccatum] Length = 163 Score = 99.0 bits (245), Expect = 1e-22 Identities = 52/69 (75%), Positives = 57/69 (82%) Frame = +1 Query: 397 LQTDFLPYTPADADFLPLKEIIEKTANPTHAVNGCPT*SISNPAGGLRALLRTKVLKQSD 576 ++T FLPYTPADA FLPLK+I EKTANPTH VNGC T SISNP GLRALLRTK L +SD Sbjct: 27 MKTGFLPYTPADAYFLPLKKI-EKTANPTHVVNGCLTLSISNPDRGLRALLRTKALNKSD 85 Query: 577 PNPSPAQVK 603 N SP+QVK Sbjct: 86 LNLSPSQVK 94