BLASTX nr result
ID: Acanthopanax21_contig00001309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00001309 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 91 1e-20 gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodiu... 81 5e-17 gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium... 58 2e-08 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 90.5 bits (223), Expect = 1e-20 Identities = 43/56 (76%), Positives = 49/56 (87%), Gaps = 1/56 (1%) Frame = +3 Query: 141 SLLKYINNI*-RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMKLWFHSAPLWK 305 S+ +NN+ RVAGIEPASLAWKA+GYSRRRFS +VSNSKPNMKLWFHSAPLW+ Sbjct: 2 SIRLVLNNVNKRVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodium distachyon] Length = 59 Score = 80.9 bits (198), Expect = 5e-17 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = +3 Query: 171 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMKLWFHSAPLW 302 RVAGIEPASLAWKARGYSRR I+NVSNSKPNMK FHSAPLW Sbjct: 3 RVAGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLW 46 >gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 58.2 bits (139), Expect = 2e-08 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +3 Query: 171 RVAGIEPASLAWKARGYSRRRFSIFNVSNSKPNMK 275 RV GIEP LAWKARGYS R IFNVSNSKPNMK Sbjct: 16 RVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPNMK 50