BLASTX nr result
ID: Acanthopanax21_contig00001307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00001307 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109497.1| hypothetical protein Poptr_cp018 [Populus tr... 95 2e-22 ref|YP_004733660.1| photosystem II protein Z (chloroplast) [Hydr... 92 9e-22 dbj|BAK54116.1| LhbA protein (chloroplast) [Eleutherococcus japo... 92 9e-22 gb|ACT88050.1| LhbA protein (chloroplast) [Raukaua anomalus] 92 9e-22 ref|YP_740114.1| photosystem II protein Z (chloroplast) [Daucus ... 92 9e-22 gb|ABD73302.1| Ycf9 [Panax ginseng] 92 9e-22 gb|ACT88053.1| LhbA protein (chloroplast) [Pseudopanax crassifol... 91 1e-21 ref|YP_086963.1| photosystem II protein Z [Panax ginseng] >gi|94... 91 2e-21 ref|YP_009420891.1| photosystem II protein Z (chloroplast) [Cary... 91 2e-21 ref|YP_009382958.1| photosystem II protein Z (chloroplast) [Albi... 91 2e-21 ref|YP_009366252.1| photosystem II protein Z (plastid) [Aloysia ... 91 2e-21 emb|CUQ99985.1| psbZ (chloroplast) [Acacia acanthoclada subsp. g... 91 2e-21 ref|YP_009242764.1| PsbZ (chloroplast) [Stachys byzantina] >gi|1... 91 2e-21 gb|AMQ33297.1| PsbZ (chloroplast) [Stenogyne sessilis] 91 2e-21 ref|YP_009232741.1| PsbZ (chloroplast) [Angelica acutiloba] >gi|... 91 2e-21 ref|YP_009121170.1| PsbZ (chloroplast) [Panax notoginseng] >gi|6... 91 2e-21 ref|YP_009242060.1| PsbZ (chloroplast) [Stenogyne haliakalae] >g... 91 2e-21 ref|YP_009115412.1| photosystem II reaction center protein Z (ch... 91 2e-21 gb|ABY52000.1| photosystem II protein Z (chloroplast) [Astragalu... 91 2e-21 ref|YP_001381733.1| photosystem II protein Z (chloroplast) [Medi... 91 2e-21 >ref|YP_001109497.1| hypothetical protein Poptr_cp018 [Populus trichocarpa] gb|ABO36700.1| conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 113 Score = 94.7 bits (234), Expect = 2e-22 Identities = 51/63 (80%), Positives = 51/63 (80%), Gaps = 1/63 (1%) Frame = -3 Query: 187 KNSG-GSFGFWIWDE*VQEMRELRIPTRKTNPIHNDVPENKTFLLLDQPSGEANTTGTPI 11 KN G G F F IW VQEMRELRIPTRKTNPIHNDVPEN TFLLLDQPSGE TTGT I Sbjct: 7 KNWGRGLFHFCIW---VQEMRELRIPTRKTNPIHNDVPENTTFLLLDQPSGEEKTTGTLI 63 Query: 10 NKI 2 NKI Sbjct: 64 NKI 66 >ref|YP_004733660.1| photosystem II protein Z (chloroplast) [Hydrocotyle verticillata] ref|YP_009409123.1| photosystem II protein Z (chloroplast) [Hydrocotyle sibthorpioides] gb|ADK89690.1| photosystem II protein Z (chloroplast) [Hydrocotyle verticillata] gb|ANQ45662.1| photosystem II protein Z (chloroplast) [Hydrocotyle sibthorpioides] Length = 62 Score = 91.7 bits (226), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >dbj|BAK54116.1| LhbA protein (chloroplast) [Eleutherococcus japonicus] gb|ANS71766.1| PsbZ (chloroplast) [Eleutherococcus sessiliflorus] Length = 62 Score = 91.7 bits (226), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >gb|ACT88050.1| LhbA protein (chloroplast) [Raukaua anomalus] Length = 62 Score = 91.7 bits (226), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_740114.1| photosystem II protein Z (chloroplast) [Daucus carota] ref|YP_004733324.1| photosystem II protein Z (chloroplast) [Crithmum maritimum] ref|YP_004733840.1| photosystem II protein Z (chloroplast) [Petroselinum crispum] ref|YP_004935549.1| photosystem II protein Z (chloroplast) [Eleutherococcus senticosus] ref|YP_008814940.1| photosystem II protein Z (chloroplast) [Brassaiopsis hainla] ref|YP_008815027.1| photosystem II protein Z (chloroplast) [Metapanax delavayi] ref|YP_008815114.1| photosystem II protein Z (chloroplast) [Schefflera delavayi] ref|YP_008815201.1| photosystem II protein Z (chloroplast) [Kalopanax septemlobus] ref|YP_009122722.1| photosystem II protein Z (chloroplast) [Dendropanax dentiger] ref|YP_009155209.1| photosystem II protein Z (plastid) [Pastinaca pimpinellifolia] ref|YP_009155291.1| photosystem II protein Z (plastid) [Seseli montanum] ref|YP_009155425.1| PsbZ (chloroplast) [Panax quinquefolius] ref|YP_009159535.1| PsbZ (chloroplast) [Dendropanax morbifer] ref|YP_009161676.1| photosystem II protein Z (chloroplast) [Fatsia japonica] ref|YP_009164315.1| LhbA (chloroplast) [Bupleurum falcatum] ref|YP_009186250.1| PsbZ (chloroplast) [Ostericum grosseserratum] ref|YP_009191850.1| photosystem II protein Z (chloroplast) [Panax japonicus] ref|YP_009191937.1| photosystem II protein Z (chloroplast) [Panax vietnamensis] ref|YP_009232826.1| PsbZ (chloroplast) [Angelica dahurica] ref|YP_009232911.1| PsbZ (chloroplast) [Angelica gigas] ref|YP_009232996.1| PsbZ (chloroplast) [Ligusticum tenuissimum] ref|YP_009235876.1| photosystem II protein Z (chloroplast) [Foeniculum vulgare] ref|YP_009235961.1| photosystem II protein Z (chloroplast) [Anethum graveolens] ref|YP_009241049.1| photosystem II protein Z (chloroplast) [Schefflera heptaphylla] ref|YP_009243563.1| photosystem II protein Z (chloroplast) [Coriandrum sativum] ref|YP_009245670.1| photosystem II reaction center Z protein (chloroplast) [Carum carvi] ref|YP_009266515.1| lhbA (chloroplast) [Panax stipuleanatus] ref|YP_009331764.1| PsbZ (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338254.1| photosystem II protein Z (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338338.1| photosystem II protein Z (chloroplast) [Peucedanum insolens] ref|YP_009338423.1| photosystem II protein Z (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009338505.1| photosystem II protein Z (chloroplast) [Bupleurum latissimum] ref|YP_009363575.1| PsbZ (chloroplast) [Peucedanum japonicum] ref|YP_009363674.1| PsbZ (chloroplast) [Glehnia littoralis] ref|YP_009363490.1| PsbZ (chloroplast) [Ledebouriella seseloides] ref|YP_009367000.1| photosystem II protein Z (plastid) [Actaea racemosa] ref|YP_009387556.1| photosystem II protein Z (chloroplast) [Hansenia weberbaueriana] ref|YP_009387641.1| photosystem II protein Z (chloroplast) [Hansenia forbesii] ref|YP_009387726.1| photosystem II protein Z (chloroplast) [Hansenia oviformis] ref|YP_009387811.1| photosystem II protein Z (chloroplast) [Hansenia forrestii] ref|YP_009433418.1| LhbA (chloroplast) [Bupleurum boissieuanum] sp|Q0G9W5.1|PSBZ_DAUCA RecName: Full=Photosystem II reaction center protein Z; Short=PSII-Z gb|ABI32421.1| photosystem II protein Z (chloroplast) [Daucus carota] gb|ABU85230.1| photosystem II protein Z, partial (chloroplast) [Anethum graveolens] gb|ACT88049.1| LhbA protein (chloroplast) [Fatsia japonica] gb|ACT88051.1| LhbA protein (chloroplast) [Schefflera digitata] gb|ACT88052.1| LhbA protein (chloroplast) [Raukaua simplex] gb|ACT88073.1| LhbA protein (chloroplast) [Meryta sinclairii] gb|ACT88074.1| LhbA protein (chloroplast) [Meryta denhamii] gb|ACT88078.1| LhbA protein (chloroplast) [Meryta latifolia] gb|ADK89775.1| photosystem II protein Z (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89860.1| photosystem II protein Z (chloroplast) [Crithmum maritimum] gb|ADK89948.1| photosystem II protein Z (chloroplast) [Petroselinum crispum] dbj|BAK54083.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54084.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54085.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54086.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54087.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54088.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54089.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54090.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54091.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54092.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54093.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54094.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54095.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54096.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54097.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54098.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54099.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54100.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54101.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54102.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54103.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54104.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54105.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54106.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54107.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54108.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54109.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54110.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54111.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54112.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54113.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54114.1| LhbA protein (chloroplast) [Kalopanax septemlobus] dbj|BAK54115.1| LhbA protein (chloroplast) [Kalopanax septemlobus] gb|AEO92616.1| photosystem II protein Z (chloroplast) [Eleutherococcus senticosus] gb|AEY70731.1| photosystem 2 protein z (chloroplast) [Aethusa cynapium] gb|AEY70732.1| photosystem 2 protein z (chloroplast) [Arracacia ebracteata] gb|AEY70733.1| photosystem 2 protein z (chloroplast) [Arracacia xanthorrhiza] gb|AEY70734.1| photosystem 2 protein z (chloroplast) [Enantiophylla heydeana] gb|AEY70735.1| photosystem 2 protein z (chloroplast) [Mathiasella bupleuroides] gb|AEY70736.1| photosystem 2 protein z (chloroplast) [Ottoa oenanthoides var. oenanthoides] gb|AEY70737.1| photosystem 2 protein z (chloroplast) [Rhodosciadium argutum] gb|AGG39040.1| photosystem II protein Z (chloroplast) [Brassaiopsis hainla] gb|AGG39127.1| photosystem II protein Z (chloroplast) [Metapanax delavayi] gb|AGG39214.1| photosystem II protein Z (chloroplast) [Schefflera delavayi] gb|AGG39301.1| photosystem II protein Z (chloroplast) [Kalopanax septemlobus] gb|AGM14963.1| LhbA (chloroplast) [Panax ginseng] gb|AGM15049.1| LhbA (chloroplast) [Panax ginseng] gb|AGM15135.1| lhbA (chloroplast) [Panax ginseng] gb|AGW31896.1| lhbA (chloroplast) [Panax ginseng] gb|AIU99017.1| photosystem II protein Z (plastid) [Pastinaca pimpinellifolia] gb|AIU99099.1| photosystem II protein Z (plastid) [Seseli montanum] gb|AIX97886.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX97973.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98056.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98141.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98226.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98311.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98396.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98481.1| PsbZ (chloroplast) [Panax ginseng] gb|AIX98566.1| PsbZ (chloroplast) [Panax ginseng] gb|AIY72301.1| LhbA (chloroplast) [Bupleurum falcatum] gb|AJC99485.1| PsbZ (chloroplast) [Panax quinquefolius] gb|AJC99570.1| PsbZ (chloroplast) [Panax ginseng] gb|AJC99655.1| PsbZ (chloroplast) [Panax ginseng] gb|AJK29911.1| photosystem II protein Z (chloroplast) [Dendropanax dentiger] gb|AKB99069.1| photosystem II protein Z (chloroplast) [Panax notoginseng] gb|AKB99156.1| photosystem II protein Z (chloroplast) [Panax japonicus] gb|AKB99243.1| photosystem II protein Z (chloroplast) [Panax vietnamensis] gb|AKB99330.1| photosystem II protein Z (chloroplast) [Panax vietnamensis] gb|AKG26597.1| photosystem II protein Z (chloroplast) [Panax notoginseng] gb|AKQ20725.1| PsbZ (chloroplast) [Dendropanax morbifer] gb|AKS03613.1| photosystem II protein Z (chloroplast) [Coriandrum sativum] gb|AKS10950.1| photosystem II protein Z (chloroplast) [Fatsia japonica] gb|AKS28685.1| photosystem II reaction center Z protein (chloroplast) [Carum carvi] gb|AKU70772.1| PsbZ (chloroplast) [Panax notoginseng] gb|AKZ23375.1| photosystem II reaction center Z protein (plastid) [Cicuta maculata] gb|AKZ23376.1| photosystem II reaction center Z protein (plastid) [Conium maculatum] gb|AKZ23377.1| photosystem II reaction center Z protein (plastid) [Zizia aurea] gb|AKZ29743.1| PsbZ (chloroplast) [Panax quinquefolius] gb|ALN96849.1| PsbZ (chloroplast) [Angelica decursiva] gb|ALO71626.1| PsbZ (chloroplast) [Ostericum grosseserratum] gb|AMA97922.1| PsbZ (chloroplast) [Angelica dahurica] gb|AMA98007.1| PsbZ (chloroplast) [Angelica gigas] gb|AMA98091.1| PsbZ (chloroplast) [Ligusticum tenuissimum] gb|AMD83912.1| photosystem II protein Z (chloroplast) [Foeniculum vulgare] gb|AMD83997.1| photosystem II protein Z (chloroplast) [Anethum graveolens] gb|AMK46178.1| photosystem II protein Z (chloroplast) [Schefflera heptaphylla] gb|AMO44334.1| photosystem II protein Z (chloroplast) [Panax ginseng] gb|AMO44335.1| photosystem II protein Z (chloroplast) [Panax ginseng] gb|AMR97446.1| LhbA (chloroplast) [Panax vietnamensis] gb|KZM81219.1| photosystem II protein Z (plastid) [Daucus carota subsp. sativus] gb|ANK36349.1| photosystem II protein Z (chloroplast) [Pleurospermum camtschaticum] gb|ANK36433.1| photosystem II protein Z (chloroplast) [Peucedanum insolens] gb|ANK36518.1| photosystem II protein Z (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36600.1| photosystem II protein Z (chloroplast) [Bupleurum latissimum] gb|ANK78327.1| lhbA (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78413.1| lhbA (chloroplast) [Panax stipuleanatus] gb|ANS71853.1| PsbZ (chloroplast) [Eleutherococcus gracilistylus] gb|ANS72027.1| PsbZ (chloroplast) [Glehnia littoralis] gb|ANS72111.1| PsbZ (chloroplast) [Ledebouriella seseloides] gb|AOC32783.1| photosystem II protein Z (chloroplast) [Chuanminshen violaceum] gb|AOT84378.1| PsbZ (chloroplast) [Ledebouriella seseloides] gb|AOT84463.1| PsbZ (chloroplast) [Peucedanum japonicum] gb|AOT84562.1| PsbZ (chloroplast) [Peucedanum japonicum] gb|AOT84661.1| PsbZ (chloroplast) [Glehnia littoralis] gb|APB93600.1| photosystem II protein Z (plastid) [Daucus carota subsp. carota] gb|APB93685.1| photosystem II protein Z (plastid) [Daucus carota subsp. carota] gb|APB93770.1| photosystem II protein Z (plastid) [Daucus carota subsp. gummifer] gb|APB93855.1| photosystem II protein Z (plastid) [Daucus carota subsp. capillifolius] gb|APB93940.1| photosystem II protein Z (plastid) [Daucus carota subsp. maximus] gb|APB94025.1| photosystem II protein Z (plastid) [Daucus carota subsp. gummifer] gb|APB94110.1| photosystem II protein Z (plastid) [Daucus carota subsp. gummifer] gb|APB94195.1| photosystem II protein Z (plastid) [Daucus carota subsp. gummifer] gb|APB94280.1| photosystem II protein Z (plastid) [Daucus carota subsp. carota] gb|APB94365.1| photosystem II protein Z (plastid) [Daucus carota subsp. maximus] gb|APB94450.1| photosystem II protein Z (plastid) [Daucus syrticus] gb|APB94535.1| photosystem II protein Z (plastid) [Daucus syrticus] gb|APB94620.1| photosystem II protein Z (plastid) [Daucus rouyi] gb|APB94705.1| photosystem II protein Z (plastid) [Daucus pumilus] gb|APB94790.1| photosystem II protein Z (plastid) [Daucus aureus] gb|APB94875.1| photosystem II protein Z (plastid) [Daucus muricatus] gb|APB94960.1| photosystem II protein Z (plastid) [Daucus muricatus] gb|APB95045.1| photosystem II protein Z (plastid) [Daucus crinitus] gb|APB95130.1| photosystem II protein Z (plastid) [Daucus crinitus] gb|APB95215.1| photosystem II protein Z (plastid) [Daucus tenuisectus] gb|APB95300.1| photosystem II protein Z (plastid) [Daucus guttatus] gb|APB95385.1| photosystem II protein Z (plastid) [Daucus guttatus] gb|APB95470.1| photosystem II protein Z (plastid) [Daucus littoralis] gb|APB95555.1| photosystem II protein Z (plastid) [Daucus glochidiatus] gb|APB95640.1| photosystem II protein Z (plastid) [Daucus guttatus] gb|APB95725.1| photosystem II protein Z (plastid) [Daucus guttatus] gb|APB95810.1| photosystem II protein Z (plastid) [Daucus setulosus] gb|APB95895.1| photosystem II protein Z (plastid) [Daucus setulosus] gb|APB95980.1| photosystem II protein Z (plastid) [Daucus pusillus] gb|APB96065.1| photosystem II protein Z (plastid) [Daucus pusillus] gb|APB96150.1| photosystem II protein Z (plastid) [Daucus conchitae] gb|APB96235.1| photosystem II protein Z (plastid) [Daucus conchitae] gb|APB96319.1| photosystem II protein Z (plastid) [Daucus conchitae] gb|APB96404.1| photosystem II protein Z (plastid) [Daucus involucratus] gb|APB96489.1| photosystem II protein Z (plastid) [Daucus involucratus] gb|APB96574.1| photosystem II protein Z (plastid) [Caucalis platycarpos] gb|APB96659.1| photosystem II protein Z (plastid) [Oenanthe virgata] gb|APH07333.1| PsbZ (chloroplast) [Arracacia xanthorrhiza] gb|ARJ61740.1| photosystem II protein Z (plastid) [Eleutherococcus senticosus] gb|ART32527.1| photosystem II protein Z (chloroplast) [Hansenia weberbaueriana] gb|ART32612.1| photosystem II protein Z (chloroplast) [Hansenia forbesii] gb|ART32696.1| photosystem II protein Z (chloroplast) [Hansenia oviformis] gb|ART32782.1| photosystem II protein Z (chloroplast) [Hansenia forrestii] gb|ATD85352.1| LhbA (chloroplast) [Bupleurum boissieuanum] gb|ATI20858.1| PsbZ (chloroplast) [Panax stipuleanatus] gb|ATJ26091.1| lhbA (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26124.1| photosystem II protein Z (chloroplast) [Panax sp. VM-2017] gb|ATJ26263.1| lhbA (chloroplast) [Panax stipuleanatus] gb|ATJ26350.1| photosystem II protein Z (chloroplast) [Panax vietnamensis] gb|ATL63012.1| photosystem II protein Z (chloroplast) [Angelica nitida] gb|AVK80267.1| PsbZ (chloroplast) [Pimpinella rhomboidea var. tenuiloba] Length = 62 Score = 91.7 bits (226), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >gb|ABD73302.1| Ycf9 [Panax ginseng] Length = 62 Score = 91.7 bits (226), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >gb|ACT88053.1| LhbA protein (chloroplast) [Pseudopanax crassifolius] gb|ACT88054.1| LhbA protein (chloroplast) [Pseudopanax lessonii] gb|ACT88055.1| LhbA protein (chloroplast) [Pseudopanax lessonii] gb|ACT88056.1| LhbA protein (chloroplast) [Pseudopanax crassifolius] gb|ACT88057.1| LhbA protein (chloroplast) [Pseudopanax crassifolius] gb|ACT88058.1| LhbA protein (chloroplast) [Pseudopanax lessonii] gb|ACT88059.1| LhbA protein (chloroplast) [Pseudopanax gilliesii] gb|ACT88060.1| LhbA protein (chloroplast) [Pseudopanax ferox] gb|ACT88061.1| LhbA protein (chloroplast) [Pseudopanax linearis] gb|ACT88062.1| LhbA protein (chloroplast) [Pseudopanax linearis] gb|ACT88063.1| LhbA protein (chloroplast) [Pseudopanax chathamicus] gb|ACT88064.1| LhbA protein (chloroplast) [Pseudopanax colensoi var. colensoi] gb|ACT88065.1| LhbA protein (chloroplast) [Pseudopanax colensoi var. ternatus] gb|ACT88066.1| LhbA protein (chloroplast) [Pseudopanax colensoi var. ternatus] gb|ACT88067.1| LhbA protein (chloroplast) [Pseudopanax colensoi var. colensoi] gb|ACT88068.1| LhbA protein (chloroplast) [Pseudopanax laetus] gb|ACT88069.1| LhbA protein (chloroplast) [Pseudopanax laetus] gb|ACT88070.1| LhbA protein (chloroplast) [Neopanax macintyrei] gb|ACT88071.1| LhbA protein (chloroplast) [Neopanax arboreus] gb|ACT88072.1| LhbA protein (chloroplast) [Neopanax arboreus] gb|ACT88075.1| LhbA protein (chloroplast) [Pseudopanax discolor] gb|ACT88076.1| LhbA protein (chloroplast) [Pseudopanax linearis] gb|ACT88077.1| LhbA protein (chloroplast) [Pseudopanax colensoi var. fiordensis] gb|ACT88079.1| LhbA protein (chloroplast) [Pseudopanax ferox] gb|ACT88080.1| LhbA protein (chloroplast) [Pseudopanax ferox] gb|ACT88081.1| LhbA protein (chloroplast) [Neopanax kermadecensis] Length = 62 Score = 91.3 bits (225), Expect = 1e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILL+GVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLVGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_086963.1| photosystem II protein Z [Panax ginseng] ref|YP_588114.1| photosystem II protein Z (chloroplast) [Helianthus annuus] ref|YP_008964354.1| photosystem II reaction center Z protein [Helianthus divaricatus] ref|YP_008964439.1| photosystem II reaction center Z protein [Helianthus decapetalus] ref|YP_008964694.1| photosystem II reaction center Z protein [Helianthus strumosus] ref|YP_008964779.1| photosystem II reaction center Z protein [Helianthus maximiliani] ref|YP_008964184.1| photosystem II reaction center Z protein [Helianthus giganteus] ref|YP_008964269.1| photosystem II reaction center Z protein [Helianthus grosseserratus] ref|YP_008964524.1| photosystem II reaction center Z protein [Helianthus hirsutus] ref|YP_008964609.1| photosystem II reaction center Z protein [Helianthus tuberosus] ref|YP_009252946.1| PsbZ (chloroplast) [Helianthus debilis] ref|YP_009255872.1| LhbA (chloroplast) [Helianthus argophyllus] sp|Q68S09.1|PSBZ_PANGI RecName: Full=Photosystem II reaction center protein Z; Short=PSII-Z sp|Q1KXW2.1|PSBZ_HELAN RecName: Full=Photosystem II reaction center protein Z; Short=PSII-Z gb|AAT98506.1| LhbA protein (chloroplast) [Panax ginseng] gb|ABD47143.1| photosystem II protein Z (chloroplast) [Helianthus annuus] dbj|BAK54117.1| LhbA protein (chloroplast) [Panax ginseng] gb|AHB14454.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB14539.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB14624.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB14709.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB14794.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB14879.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB14964.1| photosystem II reaction center Z protein (plastid) [Helianthus divaricatus] gb|AHB15049.1| photosystem II reaction center Z protein (plastid) [Helianthus divaricatus] gb|AHB15134.1| photosystem II reaction center Z protein (plastid) [Helianthus divaricatus] gb|AHB15219.1| photosystem II reaction center Z protein (plastid) [Helianthus divaricatus] gb|AHB15304.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB15389.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB15474.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB15559.1| photosystem II reaction center Z protein (plastid) [Helianthus hirsutus] gb|AHB15644.1| photosystem II reaction center Z protein (plastid) [Helianthus hirsutus] gb|AHB15729.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB15814.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB15899.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB15984.1| photosystem II reaction center Z protein (plastid) [Helianthus divaricatus] gb|AHB16069.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB16154.1| photosystem II reaction center Z protein (plastid) [Helianthus giganteus] gb|AHB16239.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB16324.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB16409.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB16494.1| photosystem II reaction center Z protein (plastid) [Helianthus grosseserratus] gb|AHB16579.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB16664.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB16749.1| photosystem II reaction center Z protein (plastid) [Helianthus decapetalus] gb|AHB16834.1| photosystem II reaction center Z protein (plastid) [Helianthus hirsutus] gb|AHB16919.1| photosystem II reaction center Z protein (plastid) [Helianthus hirsutus] gb|AHB17004.1| photosystem II reaction center Z protein (plastid) [Helianthus strumosus] gb|AHB17089.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB17174.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB17259.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AHB17344.1| photosystem II reaction center Z protein (plastid) [Helianthus maximiliani] gb|AHB17429.1| photosystem II reaction center Z protein (plastid) [Helianthus maximiliani] gb|AHB17514.1| photosystem II reaction center Z protein (plastid) [Helianthus maximiliani] gb|AHB17599.1| photosystem II reaction center Z protein (plastid) [Helianthus maximiliani] gb|AJE73983.1| photosystem II reaction center Z (plastid) [Helenium flexuosum] gb|AJE74287.1| photosystem II reaction center Z (plastid) [Helianthus petiolaris] gb|AJE74439.1| photosystem II reaction center Z (plastid) [Helianthus mollis] gb|AJE75199.1| photosystem II reaction center Z (plastid) [Senecio integerrimus] gb|AKZ23368.1| photosystem II reaction center Z protein (plastid) [Helianthus pauciflorus subsp. subrhomboideus] gb|AKZ23369.1| photosystem II reaction center Z protein (plastid) [Helianthus tuberosus] gb|AMQ33934.1| PsbZ (chloroplast) [Helianthus petiolaris subsp. fallax] gb|AMX21468.1| LhbA (chloroplast) [Helianthus praecox] gb|AMX22341.1| LhbA (chloroplast) [Helianthus petiolaris] gb|ANA91205.1| PsbZ (chloroplast) [Helianthus debilis] gb|ANB78991.1| photosystem II protein Z (chloroplast) [Helianthus annuus subsp. texanus] gb|ANF03662.1| LhbA (chloroplast) [Helianthus argophyllus] gb|ANF03899.1| LhbA (plastid) [Helianthus annuus] gb|OTF84263.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTF84536.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTF84555.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTF84568.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTF84752.1| putative photosystem II PsbZ, reaction centre (plastid) [Helianthus annuus] gb|OTG07117.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG09977.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG17278.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG21159.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG27375.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG34072.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|OTG34350.1| putative photosystem II PsbZ, reaction centre [Helianthus annuus] gb|ATU07243.1| PsbZ (plastid) [Monotropastrum sciaphilum] gb|AVN90068.1| LhbA (chloroplast) [Helianthus tuberosus] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009420891.1| photosystem II protein Z (chloroplast) [Caryopteris mongholica] gb|ASQ40476.1| photosystem II protein Z (chloroplast) [Caryopteris mongholica] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009382958.1| photosystem II protein Z (chloroplast) [Albizia odoratissima] gb|APA32809.1| photosystem II protein Z (chloroplast) [Albizia odoratissima] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009366252.1| photosystem II protein Z (plastid) [Aloysia citrodora] gb|ARJ61911.1| photosystem II protein Z (plastid) [Aloysia citrodora] gb|ASV64035.1| PsbZ (chloroplast) [Lantana depressa] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >emb|CUQ99985.1| psbZ (chloroplast) [Acacia acanthoclada subsp. glaucescens] emb|CUR00074.1| psbZ (chloroplast) [Acacia acuaria] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009242764.1| PsbZ (chloroplast) [Stachys byzantina] gb|AMQ33825.1| PsbZ (chloroplast) [Stachys byzantina] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >gb|AMQ33297.1| PsbZ (chloroplast) [Stenogyne sessilis] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009232741.1| PsbZ (chloroplast) [Angelica acutiloba] gb|AMA97836.1| PsbZ (chloroplast) [Angelica acutiloba] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 IL+IGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILVIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009121170.1| PsbZ (chloroplast) [Panax notoginseng] gb|AIA24324.1| PsbZ (chloroplast) [Panax notoginseng] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIG+PVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGLPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009242060.1| PsbZ (chloroplast) [Stenogyne haliakalae] ref|YP_009242148.1| PsbZ (chloroplast) [Stenogyne bifida] ref|YP_009242236.1| PsbZ (chloroplast) [Haplostachys haplostachya] ref|YP_009242324.1| PsbZ (chloroplast) [Phyllostegia velutina] ref|YP_009242412.1| PsbZ (chloroplast) [Stenogyne kanehoana] ref|YP_009242500.1| PsbZ (chloroplast) [Stachys chamissonis] ref|YP_009242588.1| PsbZ (chloroplast) [Stachys coccinea] ref|YP_009242676.1| PsbZ (chloroplast) [Stachys sylvatica] ref|YP_009460772.1| photosystem II protein Z (plastid) [Galeopsis tetrahit] gb|ADZ96281.1| PsbZ (chloroplast) [Medusantha martiusii] gb|AHH30438.1| photosystem II protein Z (chloroplast) [Neobartsia inaequalis] gb|AMQ32857.1| PsbZ (chloroplast) [Stenogyne haliakalae] gb|AMQ32945.1| PsbZ (chloroplast) [Phyllostegia waimeae] gb|AMQ33033.1| PsbZ (chloroplast) [Stenogyne bifida] gb|AMQ33121.1| PsbZ (chloroplast) [Haplostachys haplostachya] gb|AMQ33209.1| PsbZ (chloroplast) [Phyllostegia velutina] gb|AMQ33385.1| PsbZ (chloroplast) [Stenogyne kanehoana] gb|AMQ33561.1| PsbZ (chloroplast) [Stachys chamissonis] gb|AMQ33649.1| PsbZ (chloroplast) [Stachys coccinea] gb|AMQ33737.1| PsbZ (chloroplast) [Stachys sylvatica] gb|AUT82113.1| photosystem II protein Z (plastid) [Galeopsis tetrahit] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_009115412.1| photosystem II reaction center protein Z (chloroplast) [Acacia ligulata] ref|YP_009193071.1| photosystem II protein Z (chloroplast) [Inga leiocalycina] ref|YP_009193163.1| photosystem II protein Z (chloroplast) [Leucaena trichandra] ref|YP_009240791.1| photosystem II protein Z (chloroplast) [Diplopanax stachyanthus] ref|YP_009253560.1| PsbZ (chloroplast) [Senna tora] ref|YP_009309070.1| photosystem II protein Z (chloroplast) [Primula veris] ref|YP_009379610.1| PsbZ (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379436.1| PsbZ (chloroplast) [Hydrangea serrata] ref|YP_009379522.1| PsbZ (chloroplast) [Hydrangea petiolaris] ref|YP_009383402.1| photosystem II protein Z (chloroplast) [Samanea saman] ref|YP_009382784.1| photosystem II protein Z (chloroplast) [Acacia dealbata] ref|YP_009382875.1| photosystem II protein Z (chloroplast) [Adenanthera microsperma] ref|YP_009383142.1| photosystem II protein Z (chloroplast) [Parkia javanica] ref|YP_009383225.1| photosystem II protein Z (chloroplast) [Piptadenia communis] ref|YP_009383308.1| photosystem II protein Z (chloroplast) [Pithecellobium flexicaule] ref|YP_009402352.1| photosystem II protein Z (chloroplast) [Dichrostachys cinerea] ref|YP_009402435.1| photosystem II protein Z (chloroplast) [Faidherbia albida] ref|YP_009402525.1| photosystem II protein Z (chloroplast) [Pararchidendron pruinosum] ref|YP_009416940.1| photosystem II protein Z (chloroplast) [Hydrangea luteovenosa] ref|YP_009453973.1| photosystem II protein Z (chloroplast) [Vachellia flava] ref|YP_009454055.1| photosystem II protein Z (chloroplast) [Vachellia seyal] ref|YP_009454137.1| photosystem II protein Z (chloroplast) [Senegalia laeta] gb|ABY52010.1| photosystem II protein Z (chloroplast) [Astragalus douglasii] gb|ABY52032.1| photosystem II protein Z (chloroplast) [Astragalus vagus] gb|ABY52033.1| photosystem II protein Z (chloroplast) [Astragalus pehuenches] gb|ABY52036.1| photosystem II protein Z (chloroplast) [Astragalus curvicaulis] gb|ABY52038.1| photosystem II protein Z (chloroplast) [Astragalus uniflorus] gb|ABY52040.1| photosystem II protein Z (chloroplast) [Astragalus johnstonii] gb|ABY52041.1| photosystem II protein Z (chloroplast) [Astragalus cruckshanksii] gb|AHY32806.1| PsbZ (chloroplast) [Libidibia coriaria] gb|AHY32890.1| PsbZ (chloroplast) [Ceratonia siliqua] gb|AHY32973.1| PsbZ (chloroplast) [Haematoxylum brasiletto] gb|AHY33304.1| PsbZ (chloroplast) [Prosopis glandulosa] emb|CED95158.1| PsbZ; photosystem II reaction center protein Z (chloroplast) [Acacia ligulata] gb|AJE72072.1| photosystem II reaction center Z protein (plastid) [Chamaecrista fasciculata] gb|AJE72782.1| photosystem II reaction center Z protein (plastid) [Astragalus crassicarpus] gb|AJE72995.1| photosystem II reaction center Z protein (plastid) [Desmanthus illinoensis] gb|AJO25270.1| photosystem II protein Z (chloroplast) [Diplopanax stachyanthus] gb|ALF03749.1| PsbZ (chloroplast) [Senna tora] gb|ALQ11458.1| photosystem II protein Z (chloroplast) [Inga leiocalycina] gb|ALQ11551.1| photosystem II protein Z (chloroplast) [Leucaena trichandra] gb|AMC31964.1| photosystem II reaction center Z protein; YCF9 (chloroplast) [Chamaecrista fasciculata] gb|AMC31984.1| photosystem II reaction center Z protein; YCF9 (chloroplast) [Senna marilandica] gb|KYP36763.1| Photosystem II reaction center protein Z [Cajanus cajan] gb|ANN38929.1| PsbZ (chloroplast) [Hydrangea serrata f. fertilis] gb|ANY60404.1| photosystem II protein Z (chloroplast) [Mezoneuron cucullatum] emb|CUR00163.1| psbZ (chloroplast) [Acacia acuminata] emb|CUR00254.1| psbZ (chloroplast) [Acacia acuminata] emb|CUR00345.1| psbZ (chloroplast) [Acacia ampliata] emb|CUR00436.1| psbZ (chloroplast) [Acacia andrewsii] emb|CUR00527.1| psbZ (chloroplast) [Acacia anthochaera] emb|CUR00616.1| psbZ (chloroplast) [Acacia anthochaera] emb|CUR00705.1| psbZ (chloroplast) [Acacia ashbyae] emb|CUR00794.1| psbZ (chloroplast) [Acacia assimilis subsp. assimilis] emb|CUR00885.1| psbZ (chloroplast) [Acacia assimilis subsp. assimilis] emb|CUR00977.1| psbZ (chloroplast) [Acacia aulacophylla] emb|CUR01159.1| psbZ (chloroplast) [Acacia burkittii] emb|CUR01250.1| psbZ (chloroplast) [Acacia burkittii] emb|CUR01341.1| psbZ (chloroplast) [Acacia cerastes] emb|CUR01432.1| psbZ (chloroplast) [Acacia colletioides] emb|CUR01524.1| psbZ (chloroplast) [Acacia coolgardiensis] emb|CUR01615.1| psbZ (chloroplast) [Acacia cyclops] emb|CUR01706.1| psbZ (chloroplast) [Acacia daphnifolia] emb|CUR01797.1| psbZ (chloroplast) [Acacia diallaga] emb|CUR01889.1| psbZ (chloroplast) [Acacia duriuscula] emb|CUR01980.1| psbZ (chloroplast) [Acacia effusifolia] emb|CUR02071.1| psbZ (chloroplast) [Acacia effusifolia] emb|CUR02163.1| psbZ (chloroplast) [Acacia eremaea] emb|CUR02258.1| psbZ (chloroplast) [Acacia erinacea] emb|CUR02349.1| psbZ (chloroplast) [Acacia erinacea] emb|CUR02616.1| psbZ (chloroplast) [Acacia formidabilis] emb|CUR02707.1| psbZ (chloroplast) [Acacia fragilis] emb|CUR02798.1| psbZ (chloroplast) [Acacia gibbosa] emb|CUR02890.1| psbZ (chloroplast) [Acacia hemiteles] emb|CUR02981.1| psbZ (chloroplast) [Acacia hemiteles] emb|CUR03070.1| psbZ (chloroplast) [Acacia heteroclita subsp. heteroclita] emb|CUR03161.1| psbZ (chloroplast) [Acacia inceana subsp. conformis] emb|CUR03251.1| psbZ (chloroplast) [Acacia inceana subsp. conformis] emb|CUR03341.1| psbZ (chloroplast) [Acacia jennerae] emb|CUR03432.1| psbZ (chloroplast) [Acacia jibberdingensis] emb|CUR03523.1| psbZ (chloroplast) [Acacia jibberdingensis] emb|CUR03615.1| psbZ (chloroplast) [Acacia karina] emb|CUR03706.1| psbZ (chloroplast) [Acacia karina] emb|CUR03797.1| psbZ (chloroplast) [Acacia kochii] emb|CUR03888.1| psbZ (chloroplast) [Acacia lasiocalyx] emb|CUR03979.1| psbZ (chloroplast) [Acacia lasiocalyx] emb|CUR04070.1| psbZ (chloroplast) [Acacia lineolata subsp. lineolata] emb|CUR04161.1| psbZ (chloroplast) [Acacia longiphyllodinea] emb|CUR04252.1| psbZ (chloroplast) [Acacia longiphyllodinea] emb|CUR04343.1| psbZ (chloroplast) [Acacia longispinea] emb|CUR04433.1| psbZ (chloroplast) [Acacia longispinea] emb|CUR04523.1| psbZ (chloroplast) [Acacia merrallii] emb|CUR04614.1| psbZ (chloroplast) [Acacia merrallii] emb|CUR04705.1| psbZ (chloroplast) [Acacia murrayana] emb|CUR04796.1| psbZ (chloroplast) [Acacia murrayana] emb|CUR04887.1| psbZ (chloroplast) [Acacia neurophylla subsp. erugata] emb|CUR04978.1| psbZ (chloroplast) [Acacia neurophylla subsp. erugata] emb|CUR05069.1| psbZ (chloroplast) [Acacia obtecta] emb|CUR05161.1| psbZ (chloroplast) [Acacia oldfieldii] emb|CUR05252.1| psbZ (chloroplast) [Acacia oldfieldii] emb|CUR05343.1| psbZ (chloroplast) [Acacia prainii] emb|CUR05434.1| psbZ, partial (chloroplast) [Acacia puncticulata] emb|CUR05525.1| psbZ (chloroplast) [Acacia ramulosa var. ramulosa] emb|CUR05616.1| psbZ (chloroplast) [Acacia resinimarginea] emb|CUR05707.1| psbZ (chloroplast) [Acacia resinimarginea] emb|CUR05798.1| psbZ (chloroplast) [Acacia resinimarginea] emb|CUR05889.1| psbZ (chloroplast) [Acacia resinosa] emb|CUR05980.1| psbZ (chloroplast) [Acacia resinosa] emb|CUR06071.1| psbZ (chloroplast) [Acacia restiacea] emb|CUR06161.1| psbZ (chloroplast) [Acacia restiacea] emb|CUR06251.1| psbZ (chloroplast) [Acacia rostellifera] emb|CUR06342.1| psbZ (chloroplast) [Acacia rostellifera] emb|CUR06433.1| psbZ (chloroplast) [Acacia scalena] emb|CUR06615.1| psbZ (chloroplast) [Acacia scleroclada] emb|CUR06705.1| psbZ (chloroplast) [Acacia sclerosperma subsp. sclerosperma] emb|CUR06795.1| psbZ (chloroplast) [Acacia sclerosperma subsp. sclerosperma] emb|CUR06886.1| psbZ (chloroplast) [Acacia sibina] emb|CUR06978.1| psbZ (chloroplast) [Acacia stanleyi] emb|CUR07069.1| psbZ (chloroplast) [Acacia stereophylla var. stereophylla] emb|CUR07160.1| psbZ (chloroplast) [Acacia sulcaticaulis] emb|CUR07251.1| psbZ (chloroplast) [Acacia tetragonophylla] emb|CUR07342.1| psbZ (chloroplast) [Acacia tetragonophylla] emb|CUR07433.1| psbZ (chloroplast) [Acacia tetragonophylla] emb|CUR07524.1| psbZ (chloroplast) [Acacia tetragonophylla] emb|CUR07615.1| psbZ (chloroplast) [Acacia tysonii] emb|CUR07706.1| psbZ (chloroplast) [Acacia umbraculiformis] emb|CUR07797.1| psbZ (chloroplast) [Acacia uncinella] emb|CUR07888.1| psbZ (chloroplast) [Acacia websteri] emb|CUR07979.1| psbZ (chloroplast) [Acacia woodmaniorum] emb|CUR08068.1| psbZ (chloroplast) [Acacia xanthina] emb|CUR08157.1| psbZ (chloroplast) [Acacia xanthina] emb|CUR08248.1| psbZ (chloroplast) [Acacia yorkrakinensis subsp. acrita] emb|CUR08339.1| psbZ (chloroplast) [Acacia yorkrakinensis subsp. acrita] emb|CUR08430.1| psbZ (chloroplast) [Pararchidendron pruinosum] emb|CUR08510.1| psbZ (chloroplast) [Paraserianthes lophantha subsp. lophantha] gb|AOS86864.1| photosystem II protein Z (chloroplast) [Primula veris] gb|APA32635.1| photosystem II protein Z (chloroplast) [Acacia dealbata] gb|APA32726.1| photosystem II protein Z (chloroplast) [Adenanthera microsperma] gb|APA32993.1| photosystem II protein Z (chloroplast) [Dichrostachys cinerea] gb|APA33076.1| photosystem II protein Z (chloroplast) [Faidherbia albida] gb|APA33166.1| photosystem II protein Z (chloroplast) [Pararchidendron pruinosum] gb|APA33258.1| photosystem II protein Z (chloroplast) [Parkia javanica] gb|APA33341.1| photosystem II protein Z (chloroplast) [Piptadenia communis] gb|APA33424.1| photosystem II protein Z (chloroplast) [Pithecellobium flexicaule] gb|APA33518.1| photosystem II protein Z (chloroplast) [Samanea saman] gb|ARQ81411.1| PsbZ (chloroplast) [Hydrangea serrata] gb|ARQ81497.1| PsbZ (chloroplast) [Hydrangea serrata] gb|ARQ81583.1| PsbZ (chloroplast) [Hydrangea serrata] gb|ARQ81669.1| PsbZ (chloroplast) [Hydrangea serrata] gb|ARQ81755.1| PsbZ (chloroplast) [Hydrangea petiolaris] gb|ARQ81843.1| PsbZ (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81931.1| PsbZ (chloroplast) [Hydrangea serrata] gb|AST10055.1| photosystem II protein Z (chloroplast) [Hydrangea luteovenosa] gb|ATO88789.1| photosystem II protein Z (chloroplast) [Vachellia flava] gb|ATO88871.1| photosystem II protein Z (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88953.1| photosystem II protein Z (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89117.1| photosystem II protein Z (chloroplast) [Vachellia seyal] gb|ATO89153.1| photosystem II protein Z (chloroplast) [Faidherbia albida] gb|ATO89235.1| photosystem II protein Z (chloroplast) [Senegalia laeta] gb|ATO89035.1| photosystem II protein Z (chloroplast) [Vachellia tortilis subsp. raddiana] gb|AUF33251.1| PsbZ (chloroplast) [Diplopanax stachyanthus] gb|AUF33336.1| PsbZ (chloroplast) [Hydrangea aspera] gb|AUF33421.1| PsbZ (chloroplast) [Deutzia crassifolia] gb|AUF33506.1| PsbZ (chloroplast) [Hydrangea heteromalla] gb|AUF33761.1| PsbZ (chloroplast) [Fouquieria diguetii] gb|AUF34101.1| PsbZ (chloroplast) [Mastixia caudatilimba] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >gb|ABY52000.1| photosystem II protein Z (chloroplast) [Astragalus tetrapterus] gb|ABY52002.1| photosystem II protein Z (chloroplast) [Astragalus preussii] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62 >ref|YP_001381733.1| photosystem II protein Z (chloroplast) [Medicago truncatula] ref|YP_009141605.1| PsbZ (chloroplast) [Medicago hybrida] ref|YP_009141680.1| PsbZ (chloroplast) [Medicago papillosa] ref|YP_009327953.1| photosystem II protein Z (chloroplast) [Medicago falcata] ref|XP_003628393.1| photosystem II reaction center protein Z [Medicago truncatula] gb|AET02869.1| photosystem II reaction center protein Z [Medicago truncatula] gb|AFR59980.1| photosystem II protein Z (plastid) [Medicago truncatula] gb|AFR60056.1| photosystem II protein Z (plastid) [Medicago truncatula] gb|AFR60132.1| photosystem II protein Z (plastid) [Medicago truncatula] gb|AGV52610.1| photosystem II protein Z (chloroplast) [Medicago truncatula f. tricycla] gb|AIL56130.1| PsbZ (chloroplast) [Medicago hybrida] gb|AIL56205.1| PsbZ (chloroplast) [Medicago papillosa] gb|AJE71646.1| photosystem II reaction center Z protein (plastid) [Melilotus officinalis] gb|AJE71717.1| photosystem II reaction center Z protein (plastid) [Melilotus albus] gb|AJE72570.1| photosystem II reaction center Z protein (plastid) [Medicago lupulina] gb|AMC31975.1| photosystem II reaction center Z protein; YCF9 (chloroplast) [Medicago sativa] gb|ANS57900.1| photosystem II protein Z (chloroplast) [Medicago sativa] gb|AOG66208.1| photosystem II protein Z (chloroplast) [Medicago sativa] gb|APC60497.1| photosystem II protein Z (chloroplast) [Medicago falcata] Length = 62 Score = 90.5 bits (223), Expect = 2e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 ILLIGVPVVFASPDGWSSNKNVLFSGTSLWIGLVFLVGILNSLIS 137 ILLIGVPVVFASPDGWSSNKNV+FSGTSLWIGLVFLVGILNSLIS Sbjct: 18 ILLIGVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS 62