BLASTX nr result
ID: Acanthopanax21_contig00000657
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax21_contig00000657
(451 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|ABE08896.1| conserved hypothetical protein [Escherichia coli ... 273 3e-92
gb|AAN82207.1|AE016766_295 Protein ygiW precursor [Escherichia c... 270 5e-91
gb|OSL46782.1| protein YgiW [Escherichia coli H605] 264 2e-88
ref|WP_000712658.1| MULTISPECIES: TIGR00156 family protein [Prot... 259 3e-87
ref|WP_096988190.1| TIGR00156 family protein [Escherichia coli] 259 4e-87
ref|WP_089583795.1| TIGR00156 family protein [Escherichia coli] 259 4e-87
ref|WP_069903762.1| TIGR00156 family protein [Escherichia coli] ... 259 4e-87
ref|WP_021577970.1| TIGR00156 family protein [Escherichia coli] ... 259 4e-87
ref|WP_001330010.1| TIGR00156 family protein [Escherichia coli] ... 259 4e-87
ref|WP_104725572.1| TIGR00156 family protein [Escherichia coli] ... 259 5e-87
ref|WP_052920118.1| TIGR00156 family protein [Escherichia coli] ... 259 5e-87
ref|WP_097755184.1| TIGR00156 family protein [Escherichia coli] 258 7e-87
ref|WP_097336758.1| TIGR00156 family protein [Escherichia coli] 258 7e-87
ref|WP_096969485.1| TIGR00156 family protein [Escherichia coli] 258 7e-87
ref|WP_096853128.1| TIGR00156 family protein [Escherichia coli] 258 7e-87
ref|WP_039060162.1| TIGR00156 family protein [Escherichia coli] ... 258 7e-87
ref|WP_073461824.1| TIGR00156 family protein [Escherichia coli] ... 258 7e-87
ref|WP_057698165.1| TIGR00156 family protein [Escherichia coli] ... 258 7e-87
ref|WP_024224930.1| TIGR00156 family protein [Escherichia coli] ... 258 7e-87
ref|WP_047645898.1| TIGR00156 family protein [Escherichia coli] 258 7e-87
>gb|ABE08896.1| conserved hypothetical protein [Escherichia coli UTI89]
gb|EGJ05857.1| TIGR00156 family protein [Escherichia coli D9]
gb|AHA67119.1| Protein ygiW precursor [Shigella dysenteriae 1617]
gb|ESU79895.1| Protein ygiW precursor [Shigella dysenteriae WRSd3]
gb|ESU84311.1| Protein ygiW precursor [Shigella dysenteriae WRSd5]
gb|ETE12110.1| hypothetical protein V413_03595 [Escherichia coli LAU-EC8]
gb|ETE17245.1| hypothetical protein V415_22645 [Escherichia coli LAU-EC10]
gb|ETE25678.1| hypothetical protein V412_24120 [Escherichia coli LAU-EC7]
gb|ETE38801.1| hypothetical protein V414_03600 [Escherichia coli LAU-EC9]
emb|CDN83765.1| hypothetical protein EC958_3420 [Escherichia coli O25b:H4-ST131]
gb|AKK34640.1| hypothetical protein APECO18_11265 [Escherichia coli APEC O18]
gb|AKK40520.1| hypothetical protein APECO2_18410 [Escherichia coli APEC O2-211]
gb|ANK03481.1| ygiW [Escherichia coli O25b:H4]
Length = 149
Score = 273 bits (697), Expect = 3e-92
Identities = 136/136 (100%), Positives = 136/136 (100%)
Frame = +3
Query: 3 TLKGVINMKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAK 182
TLKGVINMKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAK
Sbjct: 13 TLKGVINMKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAK 72
Query: 183 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 362
SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK
Sbjct: 73 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 132
Query: 363 DWNSVEIDVKQIRKVN 410
DWNSVEIDVKQIRKVN
Sbjct: 133 DWNSVEIDVKQIRKVN 148
>gb|AAN82207.1|AE016766_295 Protein ygiW precursor [Escherichia coli CFT073]
gb|AER85991.1| hypothetical protein i02_3455 [Escherichia coli str. 'clone D i2']
gb|AER90910.1| hypothetical protein i14_3455 [Escherichia coli str. 'clone D i14']
gb|ETE13616.1| hypothetical protein V411_18465 [Escherichia coli LAU-EC6]
Length = 149
Score = 270 bits (689), Expect = 5e-91
Identities = 134/136 (98%), Positives = 134/136 (98%)
Frame = +3
Query: 3 TLKGVINMKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAK 182
TLKGVINMKKFAAVIAVMALCS PVMAAEQGGFSGPS TQSQAGGFQGPNGSVTTVESAK
Sbjct: 13 TLKGVINMKKFAAVIAVMALCSTPVMAAEQGGFSGPSTTQSQAGGFQGPNGSVTTVESAK 72
Query: 183 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 362
SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK
Sbjct: 73 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 132
Query: 363 DWNSVEIDVKQIRKVN 410
DWNSVEIDVKQIRKVN
Sbjct: 133 DWNSVEIDVKQIRKVN 148
>gb|OSL46782.1| protein YgiW [Escherichia coli H605]
Length = 163
Score = 264 bits (674), Expect = 2e-88
Identities = 131/136 (96%), Positives = 132/136 (97%)
Frame = +3
Query: 3 TLKGVINMKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAK 182
TLKGV NMKK AAVIAVMALCSAPVMAAEQGGFSGPSATQSQ GGFQGPNGSVT VE+AK
Sbjct: 27 TLKGVTNMKKLAAVIAVMALCSAPVMAAEQGGFSGPSATQSQTGGFQGPNGSVTNVENAK 86
Query: 183 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 362
SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK
Sbjct: 87 SLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDK 146
Query: 363 DWNSVEIDVKQIRKVN 410
DWNSVEIDVKQIRKVN
Sbjct: 147 DWNSVEIDVKQIRKVN 162
>ref|WP_000712658.1| MULTISPECIES: TIGR00156 family protein [Proteobacteria]
ref|NP_311933.1| hypothetical protein ECs3906 [Escherichia coli O157:H7 str. Sakai]
ref|NP_417496.1| hydrogen peroxide and cadmium resistance periplasmic protein;
stress-induced OB-fold protein [Escherichia coli str.
K-12 substr. MG1655]
ref|YP_404715.1| hypothetical protein SDY_3215 [Shigella dysenteriae Sd197]
ref|YP_002409425.1| hypothetical protein ECIAI39_3519 [Escherichia coli IAI39]
ref|YP_002414170.1| hypothetical protein ECUMN_3509 [Escherichia coli UMN026]
ref|YP_006121347.1| hypothetical protein NRG857_15015 [Escherichia coli O83:H1 str. NRG
857C]
ref|YP_006777495.1| hypothetical protein O3K_03825 [Escherichia coli O104:H4 str.
2011C-3493]
sp|P0ADU6.1|YGIW_ECO57 RecName: Full=Protein YgiW; Flags: Precursor
sp|P0ADU5.1|YGIW_ECOLI RecName: Full=Protein YgiW; Flags: Precursor
gb|AAG58158.1|AE005532_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
gb|AAA69192.1| ORF_f130 [Escherichia coli str. K-12 substr. MG1655]
gb|AAC76060.1| hydrogen peroxide and cadmium resistance periplasmic protein;
stress-induced OB-fold protein [Escherichia coli str.
K-12 substr. MG1655]
dbj|BAB37329.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
gb|AAZ89747.1| conserved hypothetical protein [Shigella sonnei Ss046]
gb|ABB63224.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
gb|ABB67401.1| conserved hypothetical protein [Shigella boydii Sb227]
dbj|BAE77080.1| conserved hypothetical protein [Escherichia coli str. K-12 substr.
W3110]
gb|ABG71094.1| protein YgiW precursor [Escherichia coli 536]
gb|ABF05133.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
gb|ABJ02529.1| conserved hypothetical protein [Escherichia coli APEC O1]
gb|ABV07435.1| conserved hypothetical protein TIGR00156 [Escherichia coli HS]
gb|ABV19269.1| conserved hypothetical protein TIGR00156 [Escherichia coli O139:H28
str. E24377A]
gb|ACA76349.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
gb|ACB04109.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
gb|ACD08279.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
gb|EDU34643.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4196]
gb|EDU56081.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4113]
gb|EDU65483.1| conserved hypothetical protein TIGR00156 [Escherichia coli 53638]
gb|EDU69566.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4076]
gb|EDU76968.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4401]
gb|EDU82295.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4486]
gb|EDU87637.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4501]
gb|EDU92523.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC869]
gb|EDU98185.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC508]
gb|EDV62135.1| conserved hypothetical protein [Escherichia coli B7A]
gb|EDV66802.1| conserved hypothetical protein [Escherichia coli F11]
gb|EDV84742.1| conserved hypothetical protein [Escherichia coli E22]
gb|EDV89801.1| conserved hypothetical protein [Escherichia coli E110019]
gb|EDX32041.1| conserved hypothetical protein [Escherichia coli B171]
gb|EDX36070.1| conserved hypothetical protein [Shigella dysenteriae 1012]
gb|EDX40384.1| conserved hypothetical protein [Escherichia coli 101-1]
gb|EDZ76418.1| conserved hypothetical protein TIGR00156 [Escherichia coli O157:H7
str. EC4206]
gb|EDZ82516.1| conserved hypothetical protein TIGR00156 [Escherichia coli O157:H7
str. EC4045]
gb|EDZ89489.1| conserved hypothetical protein TIGR00156 [Escherichia coli O157:H7
str. EC4042]
gb|ACI36714.1| conserved hypothetical protein TIGR00156 [Escherichia coli O157:H7
str. EC4115]
gb|ACI78101.1| hypothetical protein ECs3906 [Escherichia coli]
gb|ACI78102.1| hypothetical protein ECs3906 [Escherichia coli]
gb|ACI78103.1| hypothetical protein ECs3906 [Escherichia coli]
gb|ACI78104.1| hypothetical protein ECs3906 [Escherichia coli]
gb|ACI78105.1| hypothetical protein ECs3906 [Escherichia coli]
dbj|BAG78829.1| conserved hypothetical protein [Escherichia coli SE11]
gb|EEC28009.1| conserved hypothetical protein TIGR00156 [Escherichia coli O157:H7
str. TW14588]
emb|CAU99556.1| conserved hypothetical protein [Escherichia coli 55989]
emb|CAQ99986.1| conserved hypothetical protein [Escherichia coli IAI1]
emb|CAR04640.1| conserved hypothetical protein [Escherichia coli S88]
emb|CAR19635.1| conserved hypothetical protein [Escherichia coli IAI39]
emb|CAR09830.2| conserved hypothetical protein [Escherichia coli ED1a]
emb|CAR14665.1| conserved hypothetical protein [Escherichia coli UMN026]
emb|CAP77490.1| Protein ygiW [Escherichia coli LF82]
gb|ACR62376.1| conserved protein [Escherichia coli BW2952]
emb|CAQ33363.1| stress-induced protein [Escherichia coli BL21(DE3)]
gb|ACT27784.1| conserved hypothetical protein [Escherichia coli
'BL21-Gold(DE3)pLysS AG']
gb|ACT40545.1| hypothetical protein ECB_02896 [Escherichia coli B str. REL606]
gb|ACT44700.1| hydrogen peroxide and cadmium resistance periplasmic protein;
stress-induced OB-fold protein [Escherichia coli
BL21(DE3)]
gb|ACT73737.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
dbj|BAI27308.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
dbj|BAI37629.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
gb|ACX38362.1| conserved hypothetical protein [Escherichia coli DH1]
dbj|BAI56398.1| conserved hypothetical protein [Escherichia coli SE15]
emb|CBG36138.1| possible exported protein [Escherichia coli 042]
gb|ADD58236.1| Protein ygiW [Escherichia coli O55:H7 str. CB9615]
gb|EFE61885.1| hypothetical protein ECCG_02397 [Escherichia coli B088]
gb|EFE99677.1| ygiW [Escherichia coli FVEC1412]
gb|EFF04803.1| hypothetical protein ECDG_03220 [Escherichia coli B185]
gb|EFF11660.1| hypothetical protein ECEG_02407 [Escherichia coli B354]
gb|ADE90180.1| conserved hypothetical protein TIGR00156 [Escherichia coli IHE3034]
gb|EFI19035.1| ygiW [Escherichia coli FVEC1302]
gb|EFI90178.1| TIGR00156 family protein [Escherichia coli MS 196-1]
gb|EFJ59618.1| TIGR00156 family protein [Escherichia coli MS 200-1]
gb|EFJ64701.1| TIGR00156 family protein [Escherichia coli MS 175-1]
gb|EFJ71046.1| TIGR00156 family protein [Escherichia coli MS 198-1]
gb|EFJ83793.1| TIGR00156 family protein [Escherichia coli MS 69-1]
gb|EFJ85854.1| TIGR00156 family protein [Escherichia coli MS 84-1]
gb|EFJ99148.1| TIGR00156 family protein [Escherichia coli MS 115-1]
gb|EFK03360.1| TIGR00156 family protein [Escherichia coli MS 182-1]
gb|EFK13558.1| TIGR00156 family protein [Escherichia coli MS 116-1]
gb|EFK23826.1| TIGR00156 family protein [Escherichia coli MS 187-1]
gb|EFK46815.1| TIGR00156 family protein [Escherichia coli MS 119-7]
gb|EFK49635.1| TIGR00156 family protein [Escherichia coli MS 107-1]
gb|EFK70686.1| TIGR00156 family protein [Escherichia coli MS 124-1]
gb|EFK75359.1| TIGR00156 family protein [Escherichia coli MS 78-1]
gb|EFK92797.1| TIGR00156 family protein [Escherichia coli MS 146-1]
gb|EFM50656.1| Protein ygiW [Escherichia coli NC101]
gb|EFN39738.1| conserved hypothetical protein [Escherichia coli W]
gb|ADN69675.1| Protein ygiW [Escherichia coli UM146]
gb|EFO59807.1| TIGR00156 family protein [Escherichia coli MS 145-7]
gb|EFP71926.1| conserved hypothetical protein [Shigella dysenteriae 1617]
emb|CBJ02795.1| possible exported protein [Escherichia coli ETEC H10407]
gb|EFP99870.1| conserved hypothetical protein [Escherichia coli 1827-70]
gb|ADR28413.1| hypothetical protein NRG857_15015 [Escherichia coli O83:H1 str. NRG
857C]
gb|ADT76662.1| conserved hypothetical protein [Escherichia coli W]
dbj|BAJ44776.1| YgiW [Escherichia coli DH1]
gb|EFU36893.1| TIGR00156 family protein [Escherichia coli MS 85-1]
gb|EFU48212.1| TIGR00156 family protein [Escherichia coli MS 110-3]
gb|EFU56995.1| TIGR00156 family protein [Escherichia coli MS 16-3]
gb|EFU97902.1| conserved hypothetical protein [Escherichia coli 3431]
gb|EFW55870.1| Protein ygiW precursor [Shigella boydii ATCC 9905]
gb|EFW59006.1| Protein ygiW precursor [Shigella flexneri CDC 796-83]
gb|EFW64034.1| Protein ygiW precursor [Escherichia coli O157:H7 str. EC1212]
gb|EFW69805.1| Protein ygiW precursor [Escherichia coli WV_060327]
gb|EFW76511.1| Protein ygiW precursor [Escherichia coli EC4100B]
gb|EFX09670.1| Protein ygiW [Escherichia coli O157:H7 str. G5101]
gb|EFX14404.1| Protein ygiW [Escherichia coli O157:H- str. 493-89]
gb|EFX19164.1| Protein ygiW [Escherichia coli O157:H- str. H 2687]
gb|EFX24309.1| Protein ygiW [Escherichia coli O55:H7 str. 3256-97]
gb|EFX29182.1| Protein ygiW [Escherichia coli O55:H7 str. USDA 5905]
gb|EFX33902.1| Protein ygiW [Escherichia coli O157:H7 str. LSU-61]
gb|EFZ40919.1| hypothetical protein ECEPECA14_3521 [Escherichia coli EPECa14]
gb|EFZ48908.1| hypothetical protein ECE128010_0671 [Escherichia coli E128010]
gb|EFZ59364.1| hypothetical protein ECLT68_2053 [Escherichia coli LT-68]
gb|EFZ64304.1| hypothetical protein ECOK1180_2460 [Escherichia coli OK1180]
gb|EFZ69005.1| hypothetical protein ECOK1357_3388 [Escherichia coli OK1357]
gb|EFZ73827.1| hypothetical protein ECRN5871_2961 [Escherichia coli RN587/1]
gb|ADX49347.1| protein of unknown function DUF388, OB-fold protein [Escherichia
coli KO11FL]
gb|EGB32269.1| bacterial OB protein [Escherichia coli E1520]
gb|EGB38056.1| hypothetical protein ERDG_01652 [Escherichia coli E482]
gb|EGB42754.1| bacterial OB protein [Escherichia coli H120]
gb|EGB47326.1| hypothetical protein ERKG_02094 [Escherichia coli H252]
gb|EGB53537.1| hypothetical protein ERLG_01149 [Escherichia coli H263]
gb|EGB56547.1| hypothetical protein ERGG_02577 [Escherichia coli H489]
gb|EGB61987.1| hypothetical protein ERJG_02143 [Escherichia coli M863]
gb|EGB67075.1| hypothetical protein ERHG_02154 [Escherichia coli TA007]
gb|EGB73983.1| hypothetical protein ERFG_00244 [Escherichia coli TW10509]
gb|EGB74590.1| TIGR00156 family protein [Escherichia coli MS 57-2]
gb|EGB81198.1| TIGR00156 family protein [Escherichia coli MS 60-1]
gb|EGB87353.1| TIGR00156 family protein [Escherichia coli MS 117-3]
gb|EGC13515.1| hypothetical protein ERBG_00420 [Escherichia coli E1167]
gb|EGD61562.1| Protein ygiW precursor [Escherichia coli O157:H7 str. 1125]
gb|EGD71017.1| Protein ygiW precursor [Escherichia coli O157:H7 str. 1044]
gb|EGE63495.1| hypothetical protein ECSTEC7V_3661 [Escherichia coli STEC_7v]
gb|EGH37598.1| protein ygiW precursor [Escherichia coli AA86]
gb|EGI09419.1| protein YgiW [Escherichia coli H736]
gb|EGI14706.1| protein YgiW [Escherichia coli M605]
gb|EGI20088.1| protein YgiW [Escherichia coli M718]
gb|EGI25919.1| protein YgiW [Escherichia coli TA206]
gb|EGI30546.1| protein YgiW [Escherichia coli TA143]
gb|EGI34785.1| protein YgiW [Escherichia coli TA271]
gb|EGI44482.1| protein YgiW [Escherichia coli H591]
gb|EGI49486.1| protein YgiW [Escherichia coli H299]
gb|EGI91821.1| hypothetical protein SB521682_3615 [Shigella boydii 5216-82]
gb|EGI92400.1| hypothetical protein SD15574_3553 [Shigella dysenteriae 155-74]
gb|EGI97053.1| hypothetical protein SB359474_3347 [Shigella boydii 3594-74]
gb|AEE58314.1| conserved hypothetical protein [Escherichia coli UMNK88]
gb|AEJ58411.1| hypothetical protein UMNF18_3913 [Escherichia coli UMNF18]
gb|EGR61684.1| Protein ygiW [Escherichia coli O104:H4 str. 01-09591]
gb|EGR73085.1| Protein ygiW [Escherichia coli O104:H4 str. LB226692]
gb|EGT68739.1| ygiW [Escherichia coli O104:H4 str. C227-11]
gb|EGU26079.1| Protein ygiW [Escherichia coli XH140A]
gb|EGU98368.1| protein YgiW [Escherichia coli MS 79-10]
gb|EGV46407.1| Protein ygiW [Escherichia coli XH001]
gb|EGW65471.1| hypothetical protein ECSTECC16502_3787 [Escherichia coli
STEC_C165-02]
gb|EGW66971.1| hypothetical protein EC253486_4042 [Escherichia coli 2534-86]
gb|EGW68531.1| hypothetical protein ECSTECB2F1_3325 [Escherichia coli STEC_B2F1]
gb|EGW80615.1| hypothetical protein ECSTEC94C_3643 [Escherichia coli STEC_94C]
gb|EGW83279.1| hypothetical protein EC30301_3570 [Escherichia coli 3030-1]
gb|EGW88358.1| hypothetical protein ECSTECDG1313_4108 [Escherichia coli
STEC_DG131-3]
gb|EGW92641.1| hypothetical protein ECSTECEH250_3709 [Escherichia coli STEC_EH250]
gb|EGX02860.1| hypothetical protein ECSTECMHI813_3428 [Escherichia coli
STEC_MHI813]
gb|EGX07028.1| hypothetical protein ECSTECH18_3838 [Escherichia coli STEC_H.1.8]
gb|EGX15658.1| hypothetical protein ECSTECS1191_4047 [Escherichia coli STEC_S1191]
gb|EGX22420.1| hypothetical protein ECTX1999_3582 [Escherichia coli TX1999]
gb|AEQ14276.1| conserved protein [Escherichia coli O7:K1 str. CE10]
gb|EHF20836.1| protein ygiW [Escherichia coli O104:H4 str. C236-11]
gb|EHF24139.1| protein ygiW [Escherichia coli O104:H4 str. C227-11]
gb|EHF26422.1| protein ygiW [Escherichia coli O104:H4 str. 04-8351]
gb|EHF32845.1| protein ygiW [Escherichia coli O104:H4 str. 09-7901]
gb|EHF38738.1| protein ygiW [Escherichia coli O104:H4 str. 11-3677]
gb|EHF47892.1| protein ygiW [Escherichia coli O104:H4 str. 11-4404]
gb|EHF51561.1| protein ygiW [Escherichia coli O104:H4 str. 11-4522]
gb|EHF56130.1| protein ygiW [Escherichia coli O104:H4 str. 11-4623]
gb|EHF67368.1| protein ygiW [Escherichia coli O104:H4 str. 11-4632 C1]
gb|EHF69774.1| protein ygiW [Escherichia coli O104:H4 str. 11-4632 C2]
gb|EHF73164.1| protein ygiW [Escherichia coli O104:H4 str. 11-4632 C3]
gb|EHF75503.1| protein ygiW [Escherichia coli O104:H4 str. 11-4632 C4]
gb|EHF82545.1| protein ygiW [Escherichia coli O104:H4 str. 11-4632 C5]
gb|EHF99388.1| hypothetical protein i01_04292 [Escherichia coli cloneA_i1]
dbj|BAL39683.1| conserved protein [Escherichia coli str. K-12 substr. MDS42]
gb|EHN83462.1| protein ygiW [Escherichia coli H494]
gb|EHN89438.1| protein ygiW [Escherichia coli TA124]
gb|EHN94157.1| ygiW [Escherichia coli H397]
gb|EHN95078.1| ygiW [Escherichia coli E101]
gb|EHN95196.1| ygiW [Escherichia coli B093]
gb|EHP65986.1| protein ygiW [Escherichia coli 4_1_47FAA]
gb|AEZ42131.1| hypothetical protein ECO55CA74_17850 [Escherichia coli O55:H7 str.
RM12579]
gb|EHU55657.1| hypothetical protein ECDEC3A_3934 [Escherichia coli DEC3A]
gb|EHU67749.1| hypothetical protein ECDEC3C_4388 [Escherichia coli DEC3C]
gb|EHU71867.1| hypothetical protein ECDEC3D_4096 [Escherichia coli DEC3D]
gb|EHU73711.1| hypothetical protein ECDEC3E_4334 [Escherichia coli DEC3E]
gb|EHU83492.1| hypothetical protein ECDEC3F_4242 [Escherichia coli DEC3F]
gb|EHU89172.1| hypothetical protein ECDEC4A_3887 [Escherichia coli DEC4A]
gb|EHU92501.1| hypothetical protein ECDEC4B_4041 [Escherichia coli DEC4B]
gb|EHV03576.1| hypothetical protein ECDEC4D_3881 [Escherichia coli DEC4D]
gb|EHV04912.1| hypothetical protein ECDEC4C_3965 [Escherichia coli DEC4C]
gb|EHV09460.1| hypothetical protein ECDEC4E_3975 [Escherichia coli DEC4E]
gb|EHV19282.1| hypothetical protein ECDEC4F_3898 [Escherichia coli DEC4F]
gb|EHV21892.1| hypothetical protein ECDEC5A_3762 [Escherichia coli DEC5A]
gb|EHV26695.1| hypothetical protein ECDEC5B_4116 [Escherichia coli DEC5B]
gb|EHV34951.1| hypothetical protein ECDEC5C_3786 [Escherichia coli DEC5C]
gb|EHV36655.1| hypothetical protein ECDEC5D_3906 [Escherichia coli DEC5D]
gb|EHV45958.1| protein ygiW [Escherichia coli DEC5E]
gb|EHV53611.1| hypothetical protein ECDEC6B_4079 [Escherichia coli DEC6B]
gb|EHV54777.1| protein ygiW [Escherichia coli DEC6A]
gb|EHV57573.1| protein ygiW [Escherichia coli DEC6C]
gb|EHV68694.1| protein ygiW [Escherichia coli DEC6D]
gb|EHV71776.1| hypothetical protein ECDEC6E_3635 [Escherichia coli DEC6E]
gb|EHV76552.1| protein ygiW [Escherichia coli DEC7A]
gb|EHV85212.1| hypothetical protein ECDEC7C_3565 [Escherichia coli DEC7C]
gb|EHV88418.1| hypothetical protein ECDEC7D_3784 [Escherichia coli DEC7D]
gb|EHV93536.1| hypothetical protein ECDEC7B_3305 [Escherichia coli DEC7B]
gb|EHV99089.1| protein ygiW [Escherichia coli DEC7E]
gb|EHW07099.1| protein ygiW [Escherichia coli DEC8A]
gb|EHW07821.1| hypothetical protein ECDEC8B_4154 [Escherichia coli DEC8B]
gb|EHW12985.1| hypothetical protein ECDEC8C_4692 [Escherichia coli DEC8C]
gb|EHW22126.1| hypothetical protein ECDEC8D_4122 [Escherichia coli DEC8D]
gb|EHW25523.1| hypothetical protein ECDEC8E_3976 [Escherichia coli DEC8E]
gb|EHW33009.1| hypothetical protein ECDEC9A_4014 [Escherichia coli DEC9A]
gb|EHW37385.1| hypothetical protein ECDEC9B_3601 [Escherichia coli DEC9B]
gb|EHW43603.1| hypothetical protein ECDEC9C_3799 [Escherichia coli DEC9C]
gb|EHW49900.1| hypothetical protein ECDEC9D_3651 [Escherichia coli DEC9D]
gb|EHW54207.1| hypothetical protein ECDEC9E_4156 [Escherichia coli DEC9E]
gb|EHW60242.1| hypothetical protein ECDEC10A_4143 [Escherichia coli DEC10A]
gb|EHW65509.1| hypothetical protein ECDEC10B_4516 [Escherichia coli DEC10B]
gb|EHW71012.1| hypothetical protein ECDEC10C_4569 [Escherichia coli DEC10C]
gb|EHW75651.1| hypothetical protein ECDEC10D_4144 [Escherichia coli DEC10D]
gb|EHW87033.1| hypothetical protein ECDEC10E_3628 [Escherichia coli DEC10E]
gb|EHW88861.1| hypothetical protein ECDEC11A_3563 [Escherichia coli DEC11A]
gb|EHW90278.1| hypothetical protein ECDEC10F_4583 [Escherichia coli DEC10F]
gb|EHX00867.1| hypothetical protein ECDEC11B_3503 [Escherichia coli DEC11B]
gb|EHX07335.1| protein ygiW [Escherichia coli DEC11D]
gb|EHX09770.1| protein ygiW [Escherichia coli DEC11C]
gb|EHX17117.1| protein ygiW [Escherichia coli DEC11E]
gb|EHX23727.1| hypothetical protein ECDEC12B_4215 [Escherichia coli DEC12B]
gb|EHX27987.1| protein ygiW [Escherichia coli DEC12A]
gb|EHX28319.1| protein ygiW [Escherichia coli DEC12C]
gb|EHX40962.1| hypothetical protein ECDEC12D_3916 [Escherichia coli DEC12D]
gb|EHX45347.1| hypothetical protein ECDEC13A_3346 [Escherichia coli DEC13A]
gb|EHX45765.1| hypothetical protein ECDEC12E_3681 [Escherichia coli DEC12E]
gb|EHX58088.1| hypothetical protein ECDEC13C_3708 [Escherichia coli DEC13C]
gb|EHX61624.1| hypothetical protein ECDEC13D_3486 [Escherichia coli DEC13D]
gb|EHX74597.1| protein ygiW [Escherichia coli DEC14A]
gb|EHX77273.1| hypothetical protein ECDEC14B_3683 [Escherichia coli DEC14B]
gb|EHX86174.1| hypothetical protein ECDEC14C_3588 [Escherichia coli DEC14C]
gb|EHX89661.1| hypothetical protein ECDEC14D_3535 [Escherichia coli DEC14D]
gb|EHX96192.1| hypothetical protein ECDEC15A_3792 [Escherichia coli DEC15A]
gb|EHY01175.1| hypothetical protein ECDEC15B_3594 [Escherichia coli DEC15B]
gb|EHY13154.1| hypothetical protein ECDEC15D_3449 [Escherichia coli DEC15D]
gb|EHY17866.1| hypothetical protein ECDEC15E_3783 [Escherichia coli DEC15E]
gb|EIA35614.1| hypothetical protein OQA_15051 [Escherichia coli SCI-07]
gb|AFG41955.1| Protein ygiW [Escherichia coli P12b]
gb|AFH16498.1| Protein ygiW [Escherichia coli KO11FL]
gb|AFH12865.1| Protein ygiW [Escherichia coli W]
gb|EID63377.1| hypothetical protein SF5M90T_2996 [Shigella flexneri 5a str. M90T]
gb|EID67949.1| Protein ygiW [Escherichia coli W26]
gb|EIF17065.1| hypothetical protein UWO_16278 [Escherichia coli O32:H37 str. P4]
gb|EIF85528.1| protein ygiW [Escherichia coli M919]
gb|EIG47015.1| protein ygiW [Escherichia coli H730]
gb|EIG47356.1| protein ygiW [Escherichia coli B799]
gb|EIG81131.1| TIGR00156 family protein [Escherichia coli 1.2741]
gb|EIH04630.1| TIGR00156 family protein [Escherichia coli 5.0588]
gb|EIH10957.1| TIGR00156 family protein [Escherichia coli 97.0259]
gb|EIH24867.1| TIGR00156 family protein [Escherichia coli 1.2264]
gb|EIH32018.1| TIGR00156 family protein [Escherichia coli 96.0497]
gb|EIH45315.1| TIGR00156 family protein [Escherichia coli 99.0741]
gb|EIH57090.1| TIGR00156 family protein [Escherichia coli 3.2608]
gb|EIH64846.1| TIGR00156 family protein [Escherichia coli 93.0624]
gb|EIH76181.1| TIGR00156 family protein [Escherichia coli 4.0522]
gb|EIH89838.1| TIGR00156 family protein [Escherichia coli JB1-95]
gb|EIH99870.1| TIGR00156 family protein [Escherichia coli 96.154]
gb|EII11832.1| TIGR00156 family protein [Escherichia coli 5.0959]
gb|EII20907.1| TIGR00156 family protein [Escherichia coli 9.0111]
gb|EII36967.1| TIGR00156 family protein [Escherichia coli 4.0967]
gb|EII48533.1| TIGR00156 family protein [Escherichia coli 2.3916]
gb|EII56708.1| TIGR00156 family protein [Escherichia coli 3.3884]
gb|EII67579.1| TIGR00156 family protein [Escherichia coli 2.4168]
gb|EII74180.1| TIGR00156 family protein [Escherichia coli 3.2303]
gb|EII87325.1| TIGR00156 family protein [Escherichia coli 3003]
gb|EIJ03597.1| TIGR00156 family protein [Escherichia coli B41]
gb|EIJ15280.1| TIGR00156 family protein [Escherichia coli 900105 (10e)]
gb|AFJ30705.1| hypothetical protein CDCO157_3649 [Escherichia coli Xuzhou21]
gb|EIL04865.1| hypothetical protein ECO9450_04602 [Escherichia coli O103:H2 str.
CVM9450]
gb|EIL06613.1| hypothetical protein ECO9340_07556 [Escherichia coli O103:H25 str.
CVM9340]
gb|EIL13089.1| hypothetical protein ECO9534_26508 [Escherichia coli O111:H11 str.
CVM9534]
gb|EIL15504.1| hypothetical protein ECO9570_04548 [Escherichia coli O111:H8 str.
CVM9570]
gb|EIL15728.1| hypothetical protein ECO9545_13741 [Escherichia coli O111:H11 str.
CVM9545]
gb|EIL31685.1| hypothetical protein ECO9574_08116 [Escherichia coli O111:H8 str.
CVM9574]
gb|EIL37586.1| hypothetical protein ECO9942_25797 [Escherichia coli O26:H11 str.
CVM9942]
gb|EIL38047.1| hypothetical protein ECO10026_02010 [Escherichia coli O26:H11 str.
CVM10026]
gb|EIL48477.1| Protein ygiW [Escherichia coli KD2]
gb|EIL51149.1| Protein ygiW [Escherichia coli KD1]
gb|EIL52444.1| Protein ygiW [Escherichia coli 541-15]
gb|EIL66221.1| Protein ygiW [Escherichia coli 576-1]
gb|EIL67654.1| Protein ygiW [Escherichia coli 75]
gb|EIL68050.1| Protein ygiW [Escherichia coli 541-1]
gb|EIL73741.1| Protein ygiW [Escherichia coli HM605]
gb|EIL81492.1| Protein ygiW [Escherichia coli CUMT8]
gb|EIN18735.1| protein ygiW [Escherichia coli FRIK1996]
gb|EIN20367.1| protein ygiW [Escherichia coli FDA517]
gb|EIN20734.1| protein ygiW [Escherichia coli FDA505]
gb|EIN36522.1| protein ygiW [Escherichia coli 93-001]
gb|EIN36657.1| protein ygiW [Escherichia coli FRIK1985]
gb|EIN39441.1| protein ygiW [Escherichia coli FRIK1990]
gb|EIN51672.1| protein ygiW [Escherichia coli PA3]
gb|EIN54940.1| protein ygiW [Escherichia coli PA5]
gb|EIN58267.1| protein ygiW [Escherichia coli PA9]
gb|EIN68942.1| protein ygiW [Escherichia coli PA10]
gb|EIN73075.1| protein ygiW [Escherichia coli PA14]
gb|EIN73511.1| protein ygiW [Escherichia coli PA15]
gb|EIN85803.1| protein ygiW [Escherichia coli PA22]
gb|EIN92546.1| protein ygiW [Escherichia coli PA25]
gb|EIN94714.1| protein ygiW [Escherichia coli PA24]
gb|EIN98207.1| protein ygiW [Escherichia coli PA28]
gb|EIO10495.1| protein ygiW [Escherichia coli PA31]
gb|EIO11303.1| protein ygiW [Escherichia coli PA32]
gb|EIO26165.1| protein ygiW [Escherichia coli PA40]
gb|EIO33812.1| protein ygiW [Escherichia coli PA39]
gb|EIO34435.1| protein ygiW [Escherichia coli PA41]
gb|EIO36137.1| protein ygiW [Escherichia coli PA42]
gb|EIO47883.1| protein ygiW [Escherichia coli TW06591]
gb|EIO55082.1| protein ygiW [Escherichia coli TW07945]
gb|EIO56349.1| protein ygiW [Escherichia coli TW10246]
gb|EIO61884.1| protein ygiW [Escherichia coli TW11039]
gb|EIO70110.1| protein ygiW [Escherichia coli TW09098]
gb|EIO72547.1| protein ygiW [Escherichia coli TW09109]
gb|EIO81253.1| protein ygiW [Escherichia coli TW10119]
gb|EIO90137.1| protein ygiW [Escherichia coli EC4203]
gb|EIO92471.1| protein ygiW [Escherichia coli TW09195]
gb|EIO94693.1| protein ygiW [Escherichia coli EC4196]
gb|EIP07467.1| protein ygiW [Escherichia coli O157:H7 str. TW14313]
gb|EIP08150.1| protein ygiW [Escherichia coli TW14301]
gb|EIP12572.1| protein ygiW [Escherichia coli EC4421]
gb|EIP21828.1| protein ygiW [Escherichia coli EC4422]
gb|EIP26153.1| protein ygiW [Escherichia coli EC4013]
gb|EIP30343.1| protein ygiW [Escherichia coli EC4402]
gb|EIP37723.1| protein ygiW [Escherichia coli EC4439]
gb|EIP42867.1| protein ygiW [Escherichia coli EC4436]
gb|EIP51444.1| protein ygiW [Escherichia coli EC4437]
gb|EIP53575.1| protein ygiW [Escherichia coli EC4448]
gb|EIP57923.1| protein ygiW [Escherichia coli EC1738]
gb|EIP66269.1| protein ygiW [Escherichia coli EC1734]
gb|EIQ05648.1| protein ygiW [Shigella flexneri 2850-71]
gb|EIQ08291.1| protein ygiW [Shigella flexneri CCH060]
gb|EIQ18631.1| protein ygiW [Shigella flexneri K-315]
gb|EIQ26177.1| protein ygiW [Shigella boydii 965-58]
gb|EIQ34354.1| protein ygiW [Shigella boydii 4444-74]
gb|EIQ38183.1| protein ygiW [Shigella sonnei 3226-85]
gb|EIQ61377.1| protein ygiW [Escherichia coli EPECa12]
gb|EJE58979.1| hypothetical protein ECO9602_20352 [Escherichia coli O111:H8 str.
CVM9602]
gb|EJE68432.1| hypothetical protein ECO10224_09689 [Escherichia coli O26:H11 str.
CVM10224]
gb|EJE75301.1| hypothetical protein ECO9634_02514 [Escherichia coli O111:H8 str.
CVM9634]
gb|EJE75719.1| hypothetical protein ECO9553_04678 [Escherichia coli O111:H11 str.
CVM9553]
gb|EJE81849.1| hypothetical protein ECO10021_22347 [Escherichia coli O26:H11 str.
CVM10021]
gb|EJE88788.1| hypothetical protein ECO9455_26122 [Escherichia coli O111:H11 str.
CVM9455]
gb|EJE98382.1| hypothetical protein ECO9952_21887 [Escherichia coli O26:H11 str.
CVM9952]
gb|EJF04893.1| hypothetical protein ECO10030_27790 [Escherichia coli O26:H11 str.
CVM10030]
gb|EJK94610.1| hypothetical protein ECSTECO31_3338 [Escherichia coli STEC_O31]
gb|EJL13231.1| BOF family protein [Shigella sonnei str. Moseley]
gb|EEH71838.2| protein ygiW [Escherichia sp. 1_1_43]
gb|EJZ63658.1| hypothetical protein SF148580_3590 [Shigella flexneri 1485-80]
gb|AFS55491.1| hypothetical protein O3M_03860 [Escherichia coli O104:H4 str.
2009EL-2050]
gb|AFS72694.1| hypothetical protein O3K_03825 [Escherichia coli O104:H4 str.
2011C-3493]
gb|AFS88079.1| hypothetical protein O3O_21820 [Escherichia coli O104:H4 str.
2009EL-2071]
gb|EKG97449.1| protein ygiW [Escherichia coli PA7]
gb|EKG99639.1| protein ygiW [Escherichia coli FRIK920]
gb|EKH11943.1| protein ygiW [Escherichia coli FDA506]
gb|EKH39268.1| protein ygiW [Escherichia coli NE1487]
gb|EKH45398.1| protein ygiW [Escherichia coli NE037]
gb|EKH56455.1| protein ygiW [Escherichia coli PA4]
gb|EKH65797.1| protein ygiW [Escherichia coli PA23]
gb|EKH68309.1| protein ygiW [Escherichia coli PA49]
gb|EKH74169.1| protein ygiW [Escherichia coli PA45]
gb|EKH81875.1| protein ygiW [Escherichia coli TT12B]
gb|EKH86486.1| protein ygiW [Escherichia coli MA6]
gb|EKH90298.1| protein ygiW [Escherichia coli 5905]
gb|EKH98756.1| protein ygiW [Escherichia coli CB7326]
gb|EKI05175.1| protein ygiW [Escherichia coli EC96038]
gb|EKI08227.1| protein ygiW [Escherichia coli 5412]
gb|EKI24617.1| protein ygiW [Escherichia coli ARS4.2123]
gb|EKI25426.1| protein ygiW [Escherichia coli TW00353]
gb|EKI39734.1| protein ygiW [Escherichia coli PA38]
gb|EKI49044.1| protein ygiW [Escherichia coli EC1735]
gb|EKI50306.1| protein ygiW [Escherichia coli N1]
gb|EKI59571.1| protein ygiW [Escherichia coli EC1736]
gb|EKI67186.1| protein ygiW [Escherichia coli EC1846]
gb|EKI75302.1| protein ygiW [Escherichia coli EC1847]
gb|EKI78786.1| protein ygiW [Escherichia coli EC1848]
gb|EKI84823.1| protein ygiW [Escherichia coli EC1849]
gb|EKI92833.1| protein ygiW [Escherichia coli EC1850]
gb|EKI95509.1| protein ygiW [Escherichia coli EC1856]
gb|EKJ03008.1| protein ygiW [Escherichia coli EC1862]
gb|EKJ08564.1| protein ygiW [Escherichia coli EC1864]
gb|EKJ13265.1| protein ygiW [Escherichia coli EC1865]
gb|EKJ23097.1| protein ygiW [Escherichia coli EC1868]
gb|EKJ23574.1| protein ygiW [Escherichia coli EC1866]
gb|EKJ33333.1| protein ygiW [Escherichia coli EC1869]
gb|EKJ38692.1| protein ygiW [Escherichia coli EC1870]
gb|EKJ41046.1| protein ygiW [Escherichia coli NE098]
gb|EKJ50023.1| protein ygiW [Escherichia coli FRIK523]
gb|EKJ58945.1| protein ygiW [Escherichia coli 0.1304]
gb|EKJ83871.1| Protein ygiW [Escherichia coli AD30]
gb|EKK25041.1| protein ygiW [Escherichia coli 5.2239]
gb|EKK25114.1| protein ygiW [Escherichia coli 3.4870]
gb|EKK26233.1| protein ygiW [Escherichia coli 6.0172]
gb|EKK42174.1| protein ygiW [Escherichia coli 8.0566]
gb|EKK42365.1| protein ygiW [Escherichia coli 8.0586]
gb|EKK52796.1| protein ygiW [Escherichia coli 10.0833]
gb|EKK55511.1| protein ygiW [Escherichia coli 8.2524]
gb|EKK64304.1| protein ygiW [Escherichia coli 10.0869]
gb|EKK73863.1| protein ygiW [Escherichia coli 8.0416]
gb|EKK83956.1| protein ygiW [Escherichia coli 10.0821]
emb|CCK48323.1| hypothetical protein BN16_36451 [Escherichia coli chi7122]
emb|CCJ45637.1| hypothetical protein BN17_29521 [Escherichia coli]
gb|EKU01091.1| hypothetical protein CFSAN001632_07041 [Escherichia coli O111:H8
str. CFSAN001632]
gb|EKU02730.1| hypothetical protein CFSAN001630_13937 [Escherichia coli O111:H11
str. CFSAN001630]
gb|EKU05301.1| hypothetical protein CFSAN001629_00887 [Escherichia coli O26:H11
str. CFSAN001629]
gb|EKV73031.1| protein ygiW [Escherichia coli 88.1042]
gb|EKV74280.1| protein ygiW [Escherichia coli 89.0511]
gb|EKV88000.1| protein ygiW [Escherichia coli 90.0091]
gb|EKV91423.1| protein ygiW [Escherichia coli 90.2281]
gb|EKV94515.1| protein ygiW [Escherichia coli 90.0039]
gb|EKW07320.1| protein ygiW [Escherichia coli 93.0056]
gb|EKW07644.1| protein ygiW [Escherichia coli 93.0055]
gb|EKW11468.1| protein ygiW [Escherichia coli 94.0618]
gb|EKW24765.1| protein ygiW [Escherichia coli 95.0183]
gb|EKW25579.1| protein ygiW [Escherichia coli 95.0943]
gb|EKW28084.1| protein ygiW [Escherichia coli 95.1288]
gb|EKW39584.1| protein ygiW [Escherichia coli 96.0428]
gb|EKW42102.1| protein ygiW [Escherichia coli 96.0427]
gb|EKW46058.1| protein ygiW [Escherichia coli 96.0939]
gb|EKW53694.1| protein ygiW [Escherichia coli 96.0932]
gb|EKW60372.1| protein ygiW [Escherichia coli 96.0107]
gb|EKW62030.1| protein ygiW [Escherichia coli 97.0003]
gb|EKW72496.1| protein ygiW [Escherichia coli 97.1742]
gb|EKW75424.1| protein ygiW [Escherichia coli 97.0007]
gb|EKW79528.1| protein ygiW [Escherichia coli 99.0672]
gb|EKW87735.1| protein ygiW [Escherichia coli 99.0678]
gb|EKW89276.1| protein ygiW [Escherichia coli 99.0713]
gb|EKY36778.1| protein ygiW [Escherichia coli 96.0109]
gb|EKY38239.1| protein ygiW [Escherichia coli 97.0010]
gb|EKY83216.1| protein ygiW [Escherichia coli O104:H4 str. 11-02092]
gb|EKY93964.1| protein ygiW [Escherichia coli O104:H4 str. 11-02030]
gb|EKY95464.1| protein ygiW [Escherichia coli O104:H4 str. 11-02033-1]
gb|EKZ09132.1| protein ygiW [Escherichia coli O104:H4 str. 11-02093]
gb|EKZ11063.1| protein ygiW [Escherichia coli O104:H4 str. 11-02281]
gb|EKZ14720.1| protein ygiW [Escherichia coli O104:H4 str. 11-02318]
gb|EKZ24811.1| protein ygiW [Escherichia coli O104:H4 str. 11-02913]
gb|EKZ28176.1| protein ygiW [Escherichia coli O104:H4 str. 11-03439]
gb|EKZ28565.1| protein ygiW [Escherichia coli O104:H4 str. 11-03943]
gb|EKZ38943.1| protein ygiW [Escherichia coli O104:H4 str. 11-04080]
gb|EKZ40470.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-9990]
gb|EKZ44150.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-9450]
gb|EKZ51638.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-4984]
gb|EKZ55133.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-4986]
gb|EKZ61438.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-4987]
gb|EKZ66456.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-4988]
gb|EKZ70412.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-5603]
gb|EKZ72880.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-6006]
gb|EKZ77424.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-5604]
gb|EKZ81696.1| protein ygiW [Escherichia coli O104:H4 str. Ec12-0465]
gb|EKZ91377.1| protein ygiW [Escherichia coli O104:H4 str. Ec12-0466]
gb|EKZ95056.1| protein ygiW [Escherichia coli O104:H4 str. Ec11-9941]
gb|ELB97502.1| protein ygiW [Escherichia coli KTE2]
gb|ELB98080.1| protein ygiW [Escherichia coli KTE4]
gb|ELC07016.1| protein ygiW [Escherichia coli KTE5]
gb|ELC14347.1| protein ygiW [Escherichia coli KTE10]
gb|ELC18883.1| protein ygiW [Escherichia coli KTE12]
gb|ELC25969.1| protein ygiW [Escherichia coli KTE16]
gb|ELC27426.1| protein ygiW [Escherichia coli KTE15]
gb|ELC34708.1| protein ygiW [Escherichia coli KTE25]
gb|ELC36382.1| protein ygiW [Escherichia coli KTE21]
gb|ELC44535.1| protein ygiW [Escherichia coli KTE26]
gb|ELC48659.1| protein ygiW [Escherichia coli KTE28]
gb|ELC58084.1| protein ygiW [Escherichia coli KTE44]
gb|ELC62882.1| protein ygiW [Escherichia coli KTE178]
gb|ELC71983.1| protein ygiW [Escherichia coli KTE181]
gb|ELC79114.1| protein ygiW [Escherichia coli KTE188]
gb|ELC82168.1| protein ygiW [Escherichia coli KTE189]
gb|ELC88619.1| protein ygiW [Escherichia coli KTE191]
gb|ELC95367.1| protein ygiW [Escherichia coli KTE193]
gb|ELD02882.1| protein ygiW [Escherichia coli KTE204]
gb|ELD08223.1| protein ygiW [Escherichia coli KTE205]
gb|ELD12442.1| protein ygiW [Escherichia coli KTE206]
gb|ELD18109.1| protein ygiW [Escherichia coli KTE208]
gb|ELD20075.1| protein ygiW [Escherichia coli KTE210]
gb|ELD28192.1| protein ygiW [Escherichia coli KTE212]
gb|ELD32293.1| protein ygiW [Escherichia coli KTE213]
gb|ELD39579.1| protein ygiW [Escherichia coli KTE216]
gb|ELD49919.1| protein ygiW [Escherichia coli KTE224]
gb|ELD58450.1| protein ygiW [Escherichia coli KTE228]
gb|ELD58976.1| protein ygiW [Escherichia coli KTE230]
gb|ELD68104.1| protein ygiW [Escherichia coli KTE234]
gb|ELD70929.1| protein ygiW [Escherichia coli KTE233]
gb|ELD76306.1| protein ygiW [Escherichia coli KTE235]
gb|ELD79868.1| protein ygiW [Escherichia coli KTE236]
gb|ELD84929.1| protein ygiW [Escherichia coli KTE237]
gb|ELD88762.1| protein ygiW [Escherichia coli KTE47]
gb|ELD94836.1| protein ygiW [Escherichia coli KTE49]
gb|ELD96991.1| protein ygiW [Escherichia coli KTE51]
gb|ELE10150.1| protein ygiW [Escherichia coli KTE55]
gb|ELE17094.1| protein ygiW [Escherichia coli KTE56]
gb|ELE21794.1| protein ygiW [Escherichia coli KTE58]
gb|ELE24933.1| protein ygiW [Escherichia coli KTE57]
gb|ELE31331.1| protein ygiW [Escherichia coli KTE62]
gb|ELE40004.1| protein ygiW [Escherichia coli KTE66]
gb|ELE48645.1| protein ygiW [Escherichia coli KTE72]
gb|ELE52986.1| protein ygiW [Escherichia coli KTE75]
gb|ELE58081.1| protein ygiW [Escherichia coli KTE76]
gb|ELE62427.1| protein ygiW [Escherichia coli KTE77]
gb|ELE68296.1| protein ygiW [Escherichia coli KTE80]
gb|ELE69871.1| protein ygiW [Escherichia coli KTE81]
gb|ELE78961.1| protein ygiW [Escherichia coli KTE86]
gb|ELE79251.1| protein ygiW [Escherichia coli KTE83]
gb|ELE88168.1| protein ygiW [Escherichia coli KTE93]
gb|ELE97139.1| protein ygiW [Escherichia coli KTE111]
gb|ELE97757.1| protein ygiW [Escherichia coli KTE116]
gb|ELF07087.1| protein ygiW [Escherichia coli KTE119]
gb|ELF10215.1| protein ygiW [Escherichia coli KTE142]
gb|ELF15725.1| protein ygiW [Escherichia coli KTE143]
gb|ELF18158.1| protein ygiW [Escherichia coli KTE156]
gb|ELF27652.1| protein ygiW [Escherichia coli KTE162]
gb|ELF32124.1| protein ygiW [Escherichia coli KTE161]
gb|ELF35479.1| protein ygiW [Escherichia coli KTE169]
gb|ELF35994.1| protein ygiW [Escherichia coli KTE171]
gb|ELF47208.1| protein ygiW [Escherichia coli KTE8]
gb|ELF48884.1| protein ygiW [Escherichia coli KTE6]
gb|ELF53079.1| protein ygiW [Escherichia coli KTE9]
gb|ELF55421.1| protein ygiW [Escherichia coli KTE17]
gb|ELF62797.1| protein ygiW [Escherichia coli KTE18]
gb|ELF63799.1| protein ygiW [Escherichia coli KTE45]
gb|ELF71487.1| protein ygiW [Escherichia coli KTE42]
gb|ELF72827.1| protein ygiW [Escherichia coli KTE23]
gb|ELF80851.1| protein ygiW [Escherichia coli KTE43]
gb|ELF84860.1| protein ygiW [Escherichia coli KTE29]
gb|ELF89795.1| protein ygiW [Escherichia coli KTE22]
gb|ELF94498.1| protein ygiW [Escherichia coli KTE46]
gb|ELF96729.1| protein ygiW [Escherichia coli KTE48]
gb|ELG04090.1| protein ygiW [Escherichia coli KTE54]
gb|ELG10147.1| protein ygiW [Escherichia coli KTE50]
gb|ELG12678.1| protein ygiW [Escherichia coli KTE59]
gb|ELG23169.1| protein ygiW [Escherichia coli KTE65]
gb|ELG25409.1| protein ygiW [Escherichia coli KTE78]
gb|ELG34196.1| protein ygiW [Escherichia coli KTE84]
gb|ELG36735.1| protein ygiW [Escherichia coli KTE79]
gb|ELG40486.1| protein ygiW [Escherichia coli KTE91]
gb|ELG48386.1| protein ygiW [Escherichia coli KTE115]
gb|ELG52763.1| protein ygiW [Escherichia coli KTE118]
gb|ELG63446.1| protein ygiW [Escherichia coli KTE123]
gb|ELG67645.1| protein ygiW [Escherichia coli KTE135]
gb|ELG68159.1| protein ygiW [Escherichia coli KTE136]
gb|ELG71295.1| protein ygiW [Escherichia coli KTE140]
gb|ELG82012.1| protein ygiW [Escherichia coli KTE144]
gb|ELG92634.1| protein ygiW [Escherichia coli KTE147]
gb|ELG97348.1| protein ygiW [Escherichia coli KTE158]
gb|ELH01312.1| protein ygiW [Escherichia coli KTE154]
gb|ELH06133.1| protein ygiW [Escherichia coli KTE192]
gb|ELH11056.1| protein ygiW [Escherichia coli KTE194]
gb|ELH13306.1| protein ygiW [Escherichia coli KTE165]
gb|ELH18210.1| protein ygiW [Escherichia coli KTE190]
gb|ELH18585.1| protein ygiW [Escherichia coli KTE173]
gb|ELH23078.1| protein ygiW [Escherichia coli KTE175]
gb|ELH31707.1| protein ygiW [Escherichia coli KTE184]
gb|ELH36085.1| protein ygiW [Escherichia coli KTE196]
gb|ELH41594.1| protein ygiW [Escherichia coli KTE183]
gb|ELH45838.1| protein ygiW [Escherichia coli KTE197]
gb|ELH48733.1| protein ygiW [Escherichia coli KTE203]
gb|ELH51951.1| protein ygiW [Escherichia coli KTE202]
gb|ELH59467.1| protein ygiW [Escherichia coli KTE207]
gb|ELH69352.1| protein ygiW [Escherichia coli KTE211]
gb|ELH72005.1| protein ygiW [Escherichia coli KTE217]
gb|ELH75722.1| protein ygiW [Escherichia coli KTE215]
gb|ELH89394.1| protein ygiW [Escherichia coli KTE227]
gb|ELH99501.1| protein ygiW [Escherichia coli KTE229]
gb|ELI05010.1| protein ygiW [Escherichia coli KTE104]
gb|ELI05211.1| protein ygiW [Escherichia coli KTE105]
gb|ELI09234.1| protein ygiW [Escherichia coli KTE106]
gb|ELI17071.1| protein ygiW [Escherichia coli KTE109]
gb|ELI22483.1| protein ygiW [Escherichia coli KTE112]
gb|ELI23912.1| protein ygiW [Escherichia coli KTE113]
gb|ELI28202.1| protein ygiW [Escherichia coli KTE117]
gb|ELI36097.1| protein ygiW [Escherichia coli KTE120]
gb|ELI40535.1| protein ygiW [Escherichia coli KTE122]
gb|ELI51764.1| protein ygiW [Escherichia coli KTE125]
gb|ELI52970.1| protein ygiW [Escherichia coli KTE128]
gb|ELI56650.1| protein ygiW [Escherichia coli KTE129]
gb|ELI64694.1| protein ygiW [Escherichia coli KTE131]
gb|ELI69148.1| protein ygiW [Escherichia coli KTE133]
gb|ELI78039.1| protein ygiW [Escherichia coli KTE138]
gb|ELI82621.1| protein ygiW [Escherichia coli KTE139]
gb|ELI86428.1| protein ygiW [Escherichia coli KTE145]
gb|ELI93476.1| protein ygiW [Escherichia coli KTE148]
gb|ELI94689.1| protein ygiW [Escherichia coli KTE150]
gb|ELJ08129.1| protein ygiW [Escherichia coli KTE157]
gb|ELJ11980.1| protein ygiW [Escherichia coli KTE163]
gb|ELJ21940.1| protein ygiW [Escherichia coli KTE166]
gb|ELJ26347.1| protein ygiW [Escherichia coli KTE168]
gb|ELJ37943.1| protein ygiW [Escherichia coli KTE176]
gb|ELJ41077.1| protein ygiW [Escherichia coli KTE177]
gb|ELJ50392.1| protein ygiW [Escherichia coli KTE179]
gb|ELJ51843.1| protein ygiW [Escherichia coli KTE180]
gb|ELJ55690.1| protein ygiW [Escherichia coli KTE232]
gb|ELJ63954.1| protein ygiW [Escherichia coli KTE82]
gb|ELJ68039.1| protein ygiW [Escherichia coli KTE85]
gb|ELJ68386.1| protein ygiW [Escherichia coli KTE88]
gb|ELJ77990.1| protein ygiW [Escherichia coli KTE90]
gb|ELJ82258.1| protein ygiW [Escherichia coli KTE95]
gb|ELJ83034.1| protein ygiW [Escherichia coli KTE94]
gb|ELJ96408.1| protein ygiW [Escherichia coli KTE99]
gb|ELL40534.1| hypothetical protein B185_017463 [Escherichia coli J96]
emb|CCP99428.1| Protein ygiW precursor [Escherichia coli O10:K5(L):H4 str. ATCC
23506]
emb|CCQ00802.1| Protein ygiW precursor [Escherichia coli O5:K4(L):H4 str. ATCC
23502]
gb|AGC88497.1| hypothetical protein APECO78_18900 [Escherichia coli APEC O78]
gb|ELV16565.1| protein ygiW [Escherichia coli 99.0814]
gb|ELV17931.1| protein ygiW [Escherichia coli 09BKT078844]
gb|ELV25274.1| protein ygiW [Escherichia coli 99.0815]
gb|ELV33662.1| protein ygiW [Escherichia coli 99.0839]
gb|ELV33905.1| protein ygiW [Escherichia coli 99.0816]
gb|ELV38553.1| protein ygiW [Escherichia coli 99.0848]
gb|ELV47464.1| protein ygiW [Escherichia coli 99.1753]
gb|ELV50876.1| protein ygiW [Escherichia coli 99.1775]
gb|ELV53911.1| protein ygiW [Escherichia coli 99.1793]
gb|ELV66780.1| protein ygiW [Escherichia coli PA11]
gb|ELV67969.1| protein ygiW [Escherichia coli 99.1805]
gb|ELV79627.1| protein ygiW [Escherichia coli PA13]
gb|ELV80130.1| protein ygiW [Escherichia coli PA19]
gb|ELV88269.1| protein ygiW [Escherichia coli PA2]
gb|ELV95283.1| protein ygiW [Escherichia coli PA47]
gb|ELV96409.1| protein ygiW [Escherichia coli PA48]
gb|ELW09934.1| protein ygiW [Escherichia coli 7.1982]
gb|ELW12931.1| protein ygiW [Escherichia coli 99.1781]
gb|ELW16667.1| protein ygiW [Escherichia coli 99.1762]
gb|ELW25725.1| protein ygiW [Escherichia coli PA35]
gb|ELW30797.1| protein ygiW [Escherichia coli 3.4880]
gb|ELW33951.1| protein ygiW [Escherichia coli 95.0083]
gb|ELW40488.1| protein ygiW [Escherichia coli 99.0670]
gb|EMD05471.1| hypothetical protein C202_14889 [Escherichia coli O08]
gb|EMD06696.1| hypothetical protein C201_14183 [Escherichia coli S17]
gb|EMD08293.1| hypothetical protein A364_15773 [Escherichia coli SEPT362]
gb|EMR93273.1| hypothetical protein C4893_29410 [Escherichia coli ONT:H33 str.
C48/93]
gb|EMR97855.1| hypothetical protein E9211_34250 [Escherichia coli O104:H4 str.
E92/11]
gb|EMS00100.1| hypothetical protein E11210_34130 [Escherichia coli O104:H4 str.
E112/10]
gb|EMS06410.1| hypothetical protein C4390_29900 [Escherichia coli O127:H27 str.
C43/90]
gb|EMU59579.1| protein ygiW [Escherichia coli MP021552.11]
gb|EMU59782.1| protein ygiW [Escherichia coli MP021552.7]
gb|EMU68420.1| protein ygiW [Escherichia coli MP021552.12]
gb|EMU74910.1| protein ygiW [Escherichia coli MP021017.9]
gb|EMU79326.1| protein ygiW [Escherichia coli MP021017.5]
gb|EMU90390.1| protein ygiW [Escherichia coli MP021017.4]
gb|EMU91758.1| protein ygiW [Escherichia coli MP021017.3]
gb|EMU94371.1| protein ygiW [Escherichia coli MP021017.2]
gb|EMV04700.1| protein ygiW [Escherichia coli MP021017.10]
gb|EMV08617.1| protein ygiW [Escherichia coli MP021017.11]
gb|EMV17138.1| protein ygiW [Escherichia coli MP021017.12]
gb|EMV18052.1| protein ygiW [Escherichia coli C-34666]
gb|EMV19747.1| protein ygiW [Escherichia coli BCE034_MS-14]
gb|EMV30889.1| protein ygiW [Escherichia coli BCE002_MS12]
gb|EMV38353.1| protein ygiW [Escherichia coli BCE019_MS-13]
gb|EMV54018.1| protein ygiW [Escherichia coli 2872000]
gb|EMV83329.1| protein ygiW [Escherichia coli 2861200]
gb|EMV87555.1| protein ygiW [Escherichia coli 2865200]
gb|EMV90860.1| protein ygiW [Escherichia coli 2860050]
gb|EMW17216.1| protein ygiW [Escherichia coli 2845650]
gb|EMW20718.1| protein ygiW [Escherichia coli 2848050]
gb|EMW33381.1| protein ygiW [Escherichia coli 2785200]
gb|EMW40394.1| protein ygiW [Escherichia coli 2788150]
gb|EMW47611.1| protein ygiW [Escherichia coli 2780750]
gb|EMW48650.1| protein ygiW [Escherichia coli 2770900]
gb|EMW54727.1| protein ygiW [Escherichia coli 2762100]
gb|EMW66333.1| protein ygiW [Escherichia coli 2749250]
gb|EMW72219.1| protein ygiW [Escherichia coli 2747800]
gb|EMW75365.1| protein ygiW [Escherichia coli 2731150]
gb|EMW77913.1| protein ygiW [Escherichia coli 180600]
gb|EMW93901.1| protein ygiW [Escherichia coli ThroopD]
gb|EMW94892.1| protein ygiW [Escherichia coli 174750]
gb|EMW98302.1| protein ygiW [Escherichia coli P0304777.1]
gb|EMX08281.1| protein ygiW [Escherichia coli P0302308.1]
gb|EMX14422.1| protein ygiW [Escherichia coli P0302293.2]
gb|EMX18748.1| protein ygiW [Escherichia coli P0301867.1]
gb|EMX22927.1| protein ygiW [Escherichia coli MP021566.1]
gb|EMX29582.1| protein ygiW [Escherichia coli MP021561.2]
gb|EMX36803.1| protein ygiW [Escherichia coli MP021552.8]
gb|EMX37270.1| protein ygiW [Escherichia coli MP021017.1]
gb|EMX46968.1| protein ygiW [Escherichia coli MP020980.2]
gb|EMX52929.1| protein ygiW [Escherichia coli MP020940.1]
gb|EMX61986.1| protein ygiW [Escherichia coli Jurua 18/11]
gb|EMX67414.1| protein ygiW [Escherichia coli Envira 10/1]
gb|EMX67882.1| protein ygiW [Escherichia coli Envira 8/11]
gb|EMX74868.1| protein ygiW [Escherichia coli 2726800]
gb|EMX83335.1| protein ygiW [Escherichia coli 2719100]
gb|EMX87472.1| protein ygiW [Escherichia coli BCE001_MS16]
gb|EMX91033.1| protein ygiW [Escherichia coli 2720900]
gb|EMZ43574.1| protein ygiW [Escherichia coli SWW33]
gb|EMZ61790.1| protein ygiW [Escherichia coli 174900]
gb|EMZ76531.1| protein ygiW [Escherichia coli 199900.1]
gb|EMZ77933.1| protein ygiW [Escherichia coli 2722950]
gb|EMZ81983.1| protein ygiW [Escherichia coli p0305293.1]
gb|EMZ91445.1| protein ygiW [Escherichia coli P0305260.1]
gb|EMZ96054.1| protein ygiW [Escherichia coli P0304816.1]
gb|ENA03062.1| protein ygiW [Escherichia coli P0299438.2]
gb|ENA04756.1| protein ygiW [Escherichia coli P0299917.1]
gb|ENA14252.1| protein ygiW [Escherichia coli BCE008_MS-13]
gb|ENA19403.1| protein ygiW [Escherichia coli 201600.1]
gb|ENA28841.1| protein ygiW [Escherichia coli BCE007_MS-11]
gb|ENA37948.1| protein ygiW [Escherichia coli P0301867.4]
gb|ENA43294.1| protein ygiW [Escherichia coli P0301867.2]
gb|ENA49973.1| protein ygiW [Escherichia coli 2729250]
gb|ENA50498.1| protein ygiW [Escherichia coli 2726950]
gb|ENA59563.1| protein ygiW [Escherichia coli 178900]
gb|ENA76260.1| protein ygiW [Escherichia coli 2730450]
gb|ENA77554.1| protein ygiW [Escherichia coli 2741950]
gb|ENA90825.1| protein ygiW [Escherichia coli 2860650]
gb|ENA92980.1| protein ygiW [Escherichia coli 2864350]
gb|ENB05307.1| protein ygiW [Escherichia coli 2866350]
gb|ENB12796.1| protein ygiW [Escherichia coli BCE008_MS-01]
gb|ENB20096.1| protein ygiW [Escherichia coli BCE011_MS-01]
gb|ENB26160.1| protein ygiW [Escherichia coli BCE030_MS-09]
gb|ENB32083.1| protein ygiW [Escherichia coli BCE032_MS-12]
gb|ENB34700.1| protein ygiW [Escherichia coli MP021561.3]
gb|ENB86686.1| protein ygiW [Escherichia coli P0299438.10]
gb|ENB93280.1| protein ygiW [Escherichia coli P0299438.11]
gb|ENB96884.1| protein ygiW [Escherichia coli P0299438.3]
gb|ENC02456.1| protein ygiW [Escherichia coli P0299438.4]
gb|ENC08588.1| protein ygiW [Escherichia coli P0299438.5]
gb|ENC13505.1| protein ygiW [Escherichia coli P0299438.6]
gb|ENC14482.1| protein ygiW [Escherichia coli P0299438.7]
gb|ENC22971.1| protein ygiW [Escherichia coli P0299438.8]
gb|ENC30314.1| protein ygiW [Escherichia coli P0299438.9]
gb|ENC30522.1| protein ygiW [Escherichia coli P02997067.6]
gb|ENC45128.1| protein ygiW [Escherichia coli P0299917.2]
gb|ENC52295.1| protein ygiW [Escherichia coli P0299917.3]
gb|ENC53750.1| protein ygiW [Escherichia coli P0299917.4]
gb|ENC59120.1| protein ygiW [Escherichia coli P0299917.5]
gb|ENC68910.1| protein ygiW [Escherichia coli P0299917.6]
gb|ENC69040.1| protein ygiW [Escherichia coli P0299917.8]
gb|ENC81585.1| protein ygiW [Escherichia coli P0299917.9]
gb|ENC89478.1| protein ygiW [Escherichia coli P0301867.11]
gb|ENC92680.1| protein ygiW [Escherichia coli P0301867.8]
gb|ENC97081.1| protein ygiW [Escherichia coli P0302308.10]
gb|END00647.1| protein ygiW [Escherichia coli P0302308.11]
gb|END08909.1| protein ygiW [Escherichia coli P0302308.3]
gb|END12097.1| protein ygiW [Escherichia coli P0302308.2]
gb|END20709.1| protein ygiW [Escherichia coli P0302308.5]
gb|END23525.1| protein ygiW [Escherichia coli P0302308.4]
gb|END31165.1| protein ygiW [Escherichia coli 179100]
gb|END38415.1| protein ygiW [Escherichia coli p0305293.13]
gb|END39005.1| protein ygiW [Escherichia coli 2854350]
gb|END51304.1| protein ygiW [Escherichia coli MP020980.1]
gb|END66111.1| protein ygiW [Escherichia coli P0299483.1]
gb|END77520.1| protein ygiW [Escherichia coli P0299483.2]
gb|END80706.1| protein ygiW [Escherichia coli P0299483.3]
gb|END88857.1| protein ygiW [Escherichia coli P0301867.13]
gb|END90299.1| protein ygiW [Escherichia coli P0301904.3]
gb|END96376.1| protein ygiW [Escherichia coli P0302293.7]
gb|ENE06094.1| protein ygiW [Escherichia coli P0305260.2]
gb|ENE07682.1| protein ygiW [Escherichia coli p0305293.14]
gb|ENE19189.1| protein ygiW [Escherichia coli P0302293.10]
gb|ENE20931.1| protein ygiW [Escherichia coli P0302293.3]
gb|ENE28284.1| protein ygiW [Escherichia coli P0302293.4]
gb|ENE34711.1| protein ygiW [Escherichia coli P0302293.6]
gb|ENE43962.1| protein ygiW [Escherichia coli P0304777.10]
gb|ENE49624.1| protein ygiW [Escherichia coli P0302293.9]
gb|ENE55211.1| protein ygiW [Escherichia coli P0304777.11]
gb|ENE61978.1| protein ygiW [Escherichia coli P0304777.12]
gb|ENE63541.1| protein ygiW [Escherichia coli P0304777.13]
gb|ENE69354.1| protein ygiW [Escherichia coli P0304777.14]
gb|ENE75254.1| protein ygiW [Escherichia coli P0304777.15]
gb|ENE79375.1| protein ygiW [Escherichia coli P0304777.2]
gb|ENE85285.1| protein ygiW [Escherichia coli P0304777.3]
gb|ENE92190.1| protein ygiW [Escherichia coli P0304777.4]
gb|ENE98904.1| protein ygiW [Escherichia coli P0304777.7]
gb|ENF07238.1| protein ygiW [Escherichia coli P0304777.8]
gb|ENF10541.1| protein ygiW [Escherichia coli P0304777.9]
gb|ENF17872.1| protein ygiW [Escherichia coli P0304816.11]
gb|ENF22285.1| protein ygiW [Escherichia coli P0304816.10]
gb|ENF29252.1| protein ygiW [Escherichia coli P0304816.12]
gb|ENF32607.1| protein ygiW [Escherichia coli P0304816.14]
gb|ENF38490.1| protein ygiW [Escherichia coli P0304816.13]
gb|ENF45117.1| protein ygiW [Escherichia coli P0304816.15]
gb|ENF48743.1| protein ygiW [Escherichia coli P0304816.2]
gb|ENF49656.1| protein ygiW [Escherichia coli P0304816.6]
gb|ENF60720.1| protein ygiW [Escherichia coli P0304816.7]
gb|ENF66591.1| protein ygiW [Escherichia coli P0304816.8]
gb|ENF69501.1| protein ygiW [Escherichia coli P0304816.9]
gb|ENF74110.1| protein ygiW [Escherichia coli P0305260.10]
gb|ENF81650.1| protein ygiW [Escherichia coli P0305260.11]
gb|ENF84005.1| protein ygiW [Escherichia coli P0305260.12]
gb|ENF95724.1| protein ygiW [Escherichia coli P0305260.15]
gb|ENG01277.1| protein ygiW [Escherichia coli P0305260.3]
gb|ENG10685.1| protein ygiW [Escherichia coli P0305260.5]
gb|ENG14971.1| protein ygiW [Escherichia coli P0305260.6]
gb|ENG15376.1| protein ygiW [Escherichia coli P0305260.7]
gb|ENG24514.1| protein ygiW [Escherichia coli P0305260.8]
gb|ENG28412.1| protein ygiW [Escherichia coli p0305293.10]
gb|ENG32531.1| protein ygiW [Escherichia coli P0305260.9]
gb|ENG39785.1| protein ygiW [Escherichia coli p0305293.11]
gb|ENG40796.1| protein ygiW [Escherichia coli p0305293.12]
gb|ENG49690.1| protein ygiW [Escherichia coli p0305293.15]
gb|ENG53377.1| protein ygiW [Escherichia coli p0305293.2]
gb|ENG59446.1| protein ygiW [Escherichia coli p0305293.3]
gb|ENG62858.1| protein ygiW [Escherichia coli p0305293.4]
gb|ENG69346.1| protein ygiW [Escherichia coli p0305293.8]
gb|ENG76045.1| protein ygiW [Escherichia coli p0305293.9]
gb|ENG81440.1| protein ygiW [Escherichia coli 178200]
gb|ENG89808.1| protein ygiW [Escherichia coli 178850]
gb|ENG94929.1| protein ygiW [Escherichia coli P0301867.3]
gb|ENH00294.1| protein ygiW [Escherichia coli P0301867.5]
gb|ENH07205.1| protein ygiW [Escherichia coli P0301867.7]
gb|ENH14180.1| protein ygiW [Escherichia coli P0302308.13]
gb|ENH16011.1| protein ygiW [Escherichia coli P0302308.12]
gb|ENH17983.1| protein ygiW [Escherichia coli P0302308.14]
gb|ENH30464.1| protein ygiW [Escherichia coli P0304816.3]
gb|ENH30884.1| protein ygiW [Escherichia coli P0304816.4]
gb|ENH43870.1| protein ygiW [Escherichia coli p0305293.5]
gb|ENH50049.1| protein ygiW [Escherichia coli p0305293.7]
gb|ENH55303.1| protein ygiW [Escherichia coli p0305293.6]
gb|ENO10861.1| hypothetical protein T22_004491 [Escherichia coli O157:H43 str.
T22]
gb|EOU29683.1| protein ygiW [Escherichia coli KTE7]
gb|EOU30771.1| protein ygiW [Escherichia coli KTE13]
gb|EOU31100.1| protein ygiW [Escherichia coli KTE3]
gb|EOU44061.1| protein ygiW [Escherichia coli KTE35]
gb|EOU49167.1| protein ygiW [Escherichia coli KTE231]
gb|EOU57403.1| protein ygiW [Escherichia coli KTE14]
gb|EOU61369.1| protein ygiW [Escherichia coli KTE19]
gb|EOU64028.1| protein ygiW [Escherichia coli KTE20]
gb|EOU69727.1| protein ygiW [Escherichia coli KTE24]
gb|EOU74523.1| protein ygiW [Escherichia coli KTE27]
gb|EOU89063.1| protein ygiW [Escherichia coli KTE37]
gb|EOU89602.1| protein ygiW [Escherichia coli KTE34]
gb|EOV03163.1| protein ygiW [Escherichia coli KTE38]
gb|EOV04750.1| protein ygiW [Escherichia coli KTE195]
gb|EOV10194.1| protein ygiW [Escherichia coli KTE40]
gb|EOV16448.1| protein ygiW [Escherichia coli KTE198]
gb|EOV17309.1| protein ygiW [Escherichia coli KTE200]
gb|EOV24194.1| protein ygiW [Escherichia coli KTE199]
gb|EOV32897.1| protein ygiW [Escherichia coli KTE219]
gb|EOV34876.1| protein ygiW [Escherichia coli KTE221]
gb|EOV42705.1| protein ygiW [Escherichia coli KTE222]
gb|EOV48380.1| protein ygiW [Escherichia coli KTE61]
gb|EOV55486.1| protein ygiW [Escherichia coli KTE64]
gb|EOV58068.1| protein ygiW [Escherichia coli KTE68]
gb|EOV62624.1| protein ygiW [Escherichia coli KTE69]
gb|EOV70681.1| protein ygiW [Escherichia coli KTE70]
gb|EOV76027.1| protein ygiW [Escherichia coli KTE73]
gb|EOV87162.1| protein ygiW [Escherichia coli KTE74]
gb|EOV87377.1| protein ygiW [Escherichia coli KTE89]
gb|EOW01164.1| protein ygiW [Escherichia coli KTE98]
gb|EOW02391.1| protein ygiW [Escherichia coli KTE102]
gb|EOW03794.1| protein ygiW [Escherichia coli KTE100]
gb|EOW11338.1| protein ygiW [Escherichia coli KTE103]
gb|EOW28732.1| protein ygiW [Escherichia coli KTE121]
gb|EOW29697.1| protein ygiW [Escherichia coli KTE108]
gb|EOW32423.1| protein ygiW [Escherichia coli KTE127]
gb|EOW40343.1| protein ygiW [Escherichia coli KTE126]
gb|EOW42741.1| protein ygiW [Escherichia coli KTE130]
gb|EOW45089.1| protein ygiW [Escherichia coli KTE132]
gb|EOW57247.1| protein ygiW [Escherichia coli KTE134]
gb|EOW58123.1| protein ygiW [Escherichia coli KTE155]
gb|EOW65506.1| protein ygiW [Escherichia coli KTE170]
gb|EOW73484.1| protein ygiW [Escherichia sp. KTE172]
gb|EOW89197.1| protein ygiW [Escherichia coli KTE1]
gb|EOW93916.1| protein ygiW [Escherichia coli KTE41]
gb|EOW94067.1| protein ygiW [Escherichia coli KTE182]
gb|EOX03113.1| protein ygiW [Escherichia coli KTE225]
gb|EOX09527.1| protein ygiW [Escherichia coli KTE240]
gb|EOX21318.1| protein ygiW [Escherichia coli KTE185]
gb|EOX28241.1| protein ygiW [Escherichia coli KTE186]
gb|EPH50471.1| Protein ygiW precursor [Escherichia coli E2265]
emb|CDC81549.1| putative uncharacterized protein ygiW [Escherichia coli CAG:4]
gb|EQN03177.1| protein ygiW [Escherichia coli HVH 3 (4-7276001)]
gb|EQN12657.1| protein ygiW [Escherichia coli HVH 1 (4-6876161)]
gb|EQN15261.1| protein ygiW [Escherichia coli HVH 4 (4-7276109)]
gb|EQN16664.1| protein ygiW [Escherichia coli HVH 5 (4-7148410)]
gb|EQN24150.1| protein ygiW [Escherichia coli HVH 6 (3-8296502)]
gb|EQN30242.1| protein ygiW [Escherichia coli HVH 9 (4-6942539)]
gb|EQN44180.1| protein ygiW [Escherichia coli HVH 10 (4-6832164)]
gb|EQN51922.1| protein ygiW [Escherichia coli HVH 17 (4-7473087)]
gb|EQN63054.1| protein ygiW [Escherichia coli HVH 18 (4-8589585)]
gb|EQN67238.1| protein ygiW [Escherichia coli HVH 19 (4-7154984)]
gb|EQN73339.1| protein ygiW [Escherichia coli HVH 21 (4-4517873)]
gb|EQN78018.1| protein ygiW [Escherichia coli HVH 22 (4-2258986)]
gb|EQN83476.1| protein ygiW [Escherichia coli HVH 24 (4-5985145)]
gb|EQN90650.1| protein ygiW [Escherichia coli HVH 26 (4-5703913)]
gb|EQN91187.1| protein ygiW [Escherichia coli HVH 25 (4-5851939)]
gb|EQO04077.1| protein ygiW [Escherichia coli HVH 29 (4-3418073)]
gb|EQO06626.1| protein ygiW [Escherichia coli HVH 28 (4-0907367)]
gb|EQO14407.1| protein ygiW [Escherichia coli HVH 30 (4-2661829)]
gb|EQO20691.1| protein ygiW [Escherichia coli HVH 32 (4-3773988)]
gb|EQO27446.1| protein ygiW [Escherichia coli HVH 33 (4-2174936)]
gb|EQO30215.1| protein ygiW [Escherichia coli HVH 35 (4-2962667)]
gb|EQO40794.1| protein ygiW [Escherichia coli HVH 39 (4-2679949)]
gb|EQO45227.1| protein ygiW [Escherichia coli HVH 38 (4-2774682)]
gb|EQO58586.1| protein ygiW [Escherichia coli HVH 41 (4-2677849)]
gb|EQO59065.1| protein ygiW [Escherichia coli HVH 42 (4-2100061)]
gb|EQO69132.1| protein ygiW [Escherichia coli HVH 44 (4-2298570)]
gb|EQO69643.1| protein ygiW [Escherichia coli HVH 43 (4-2173468)]
gb|EQO75200.1| protein ygiW [Escherichia coli HVH 45 (4-3129918)]
gb|EQO82812.1| protein ygiW [Escherichia coli HVH 48 (4-2658593)]
gb|EQO84072.1| protein ygiW [Escherichia coli HVH 46 (4-2758776)]
gb|EQO96417.1| protein ygiW [Escherichia coli HVH 55 (4-2646161)]
gb|EQP03065.1| protein ygiW [Escherichia coli HVH 53 (4-0631051)]
gb|EQP05602.1| protein ygiW [Escherichia coli HVH 56 (4-2153033)]
gb|EQP15795.1| protein ygiW [Escherichia coli HVH 59 (4-1119338)]
gb|EQP22464.1| protein ygiW [Escherichia coli HVH 63 (4-2542528)]
gb|EQP32434.1| protein ygiW [Escherichia coli HVH 65 (4-2262045)]
gb|EQP33317.1| protein ygiW [Escherichia coli HVH 69 (4-2837072)]
gb|EQP45799.1| protein ygiW [Escherichia coli HVH 70 (4-2963531)]
gb|EQP48428.1| protein ygiW [Escherichia coli HVH 73 (4-2393174)]
gb|EQP59727.1| protein ygiW [Escherichia coli HVH 76 (4-2538717)]
gb|EQP66386.1| protein ygiW [Escherichia coli HVH 78 (4-2735946)]
gb|EQP69403.1| protein ygiW [Escherichia coli HVH 79 (4-2512823)]
gb|EQP84898.1| protein ygiW [Escherichia coli HVH 80 (4-2428830)]
gb|EQP87289.1| protein ygiW [Escherichia coli HVH 84 (4-1021478)]
gb|EQP88925.1| protein ygiW [Escherichia coli HVH 85 (4-0792144)]
gb|EQP90393.1| protein ygiW [Escherichia coli HVH 82 (4-2209276)]
gb|EQQ00206.1| protein ygiW [Escherichia coli HVH 88 (4-5854636)]
gb|EQQ01979.1| protein ygiW [Escherichia coli HVH 87 (4-5977630)]
gb|EQQ12525.1| protein ygiW [Escherichia coli HVH 90 (4-3191362)]
gb|EQQ18989.1| protein ygiW [Escherichia coli HVH 91 (4-4638751)]
gb|EQQ38167.1| protein ygiW [Escherichia coli HVH 102 (4-6906788)]
gb|EQQ39960.1| protein ygiW [Escherichia coli HVH 100 (4-2850729)]
gb|EQQ47643.1| protein ygiW [Escherichia coli HVH 104 (4-6977960)]
gb|EQQ56080.1| protein ygiW [Escherichia coli HVH 106 (4-6881831)]
gb|EQQ64284.1| protein ygiW [Escherichia coli HVH 110 (4-6978754)]
gb|EQQ68714.1| protein ygiW [Escherichia coli HVH 107 (4-5860571)]
gb|EQQ85290.1| protein ygiW [Escherichia coli HVH 112 (4-5987253)]
gb|EQQ85646.1| protein ygiW [Escherichia coli HVH 113 (4-7535473)]
gb|EQQ96569.1| protein ygiW [Escherichia coli HVH 115 (4-4465989)]
gb|EQR00529.1| protein ygiW [Escherichia coli HVH 115 (4-4465997)]
gb|EQR16116.1| protein ygiW [Escherichia coli HVH 118 (4-7345399)]
gb|EQR17940.1| protein ygiW [Escherichia coli HVH 119 (4-6879578)]
gb|EQR31577.1| protein ygiW [Escherichia coli HVH 122 (4-6851606)]
gb|EQR35721.1| protein ygiW [Escherichia coli HVH 121 (4-6877826)]
gb|EQR40715.1| protein ygiW [Escherichia coli HVH 125 (4-2634716)]
gb|EQR45950.1| protein ygiW [Escherichia coli HVH 126 (4-6034225)]
gb|EQR51839.1| protein ygiW [Escherichia coli HVH 127 (4-7303629)]
gb|EQR57150.1| protein ygiW [Escherichia coli HVH 128 (4-7030436)]
gb|EQR59781.1| protein ygiW [Escherichia coli HVH 130 (4-7036876)]
gb|EQR79396.1| protein ygiW [Escherichia coli HVH 135 (4-4449320)]
gb|EQR81017.1| protein ygiW [Escherichia coli HVH 134 (4-6073441)]
gb|EQR82792.1| protein ygiW [Escherichia coli HVH 133 (4-4466519)]
gb|EQR86637.1| protein ygiW [Escherichia coli HVH 137 (4-2124971)]
gb|EQR91976.1| protein ygiW [Escherichia coli HVH 138 (4-6066704)]
gb|EQR94528.1| protein ygiW [Escherichia coli HVH 139 (4-3192644)]
gb|EQR98947.1| protein ygiW [Escherichia coli HVH 140 (4-5894387)]
gb|EQS03248.1| protein ygiW [Escherichia coli HVH 141 (4-5995973)]
gb|EQS10726.1| protein ygiW [Escherichia coli HVH 143 (4-5674999)]
gb|EQS27928.1| protein ygiW [Escherichia coli HVH 145 (4-5672112)]
gb|EQS31471.1| protein ygiW [Escherichia coli HVH 147 (4-5893887)]
gb|EQS32388.1| protein ygiW [Escherichia coli HVH 146 (4-3189767)]
gb|EQS45572.1| protein ygiW [Escherichia coli HVH 151 (4-5755573)]
gb|EQS47282.1| protein ygiW [Escherichia coli HVH 153 (3-9344314)]
gb|EQS53254.1| protein ygiW [Escherichia coli HVH 150 (4-3258106)]
gb|EQS60050.1| protein ygiW [Escherichia coli HVH 158 (4-3224287)]
gb|EQS63814.1| protein ygiW [Escherichia coli HVH 154 (4-5636698)]
gb|EQS78304.1| protein ygiW [Escherichia coli HVH 162 (4-5627982)]
gb|EQS80668.1| protein ygiW [Escherichia coli HVH 163 (4-4697553)]
gb|EQS85481.1| protein ygiW [Escherichia coli HVH 167 (4-6073565)]
gb|EQS92383.1| protein ygiW [Escherichia coli HVH 164 (4-5953081)]
gb|EQT02051.1| protein ygiW [Escherichia coli HVH 170 (4-3026949)]
gb|EQT10610.1| protein ygiW [Escherichia coli HVH 173 (3-9175482)]
gb|EQT19550.1| protein ygiW [Escherichia coli HVH 176 (4-3428664)]
gb|EQT21264.1| protein ygiW [Escherichia coli HVH 175 (4-3405184)]
gb|EQT25935.1| protein ygiW [Escherichia coli HVH 180 (4-3051617)]
gb|EQT33677.1| protein ygiW [Escherichia coli HVH 183 (4-3205932)]
gb|EQT36791.1| protein ygiW [Escherichia coli HVH 182 (4-0985554)]
gb|EQT42783.1| protein ygiW [Escherichia coli HVH 184 (4-3343286)]
gb|EQT47459.1| protein ygiW [Escherichia coli HVH 185 (4-2876639)]
gb|EQT53641.1| protein ygiW [Escherichia coli HVH 186 (4-3405044)]
gb|EQT59101.1| protein ygiW [Escherichia coli HVH 188 (4-2356988)]
gb|EQT67112.1| protein ygiW [Escherichia coli HVH 187 (4-4471660)]
gb|EQT70668.1| protein ygiW [Escherichia coli HVH 190 (4-3255514)]
gb|EQT72608.1| protein ygiW [Escherichia coli HVH 189 (4-3220125)]
gb|EQT75232.1| protein ygiW [Escherichia coli HVH 191 (3-9341900)]
gb|EQT81668.1| protein ygiW [Escherichia coli HVH 192 (4-3054470)]
gb|EQT87865.1| protein ygiW [Escherichia coli HVH 193 (4-3331423)]
gb|EQT92182.1| protein ygiW [Escherichia coli HVH 195 (3-7155360)]
gb|EQT99744.1| protein ygiW [Escherichia coli HVH 196 (4-4530470)]
gb|EQU02440.1| protein ygiW [Escherichia coli HVH 194 (4-2356805)]
gb|EQU08560.1| protein ygiW [Escherichia coli HVH 198 (4-3206106)]
gb|EQU09924.1| protein ygiW [Escherichia coli HVH 199 (4-5670322)]
gb|EQU10927.1| protein ygiW [Escherichia coli HVH 197 (4-4466217)]
gb|EQU20914.1| protein ygiW [Escherichia coli HVH 201 (4-4459431)]
gb|EQU21440.1| protein ygiW [Escherichia coli HVH 200 (4-4449924)]
gb|EQU32138.1| protein ygiW [Escherichia coli HVH 202 (4-3163997)]
gb|EQU32517.1| protein ygiW [Escherichia coli HVH 203 (4-3126218)]
gb|EQU44886.1| protein ygiW [Escherichia coli HVH 205 (4-3094677)]
gb|EQU48057.1| protein ygiW [Escherichia coli HVH 206 (4-3128229)]
gb|EQU59824.1| protein ygiW [Escherichia coli HVH 208 (4-3112292)]
gb|EQU68351.1| protein ygiW [Escherichia coli HVH 211 (4-3041891)]
gb|EQU72998.1| protein ygiW [Escherichia coli HVH 209 (4-3062651)]
gb|EQU76998.1| protein ygiW [Escherichia coli HVH 213 (4-3042928)]
gb|EQU85040.1| protein ygiW [Escherichia coli HVH 215 (4-3008371)]
gb|EQU91043.1| protein ygiW [Escherichia coli HVH 217 (4-1022806)]
gb|EQV05919.1| protein ygiW [Escherichia coli HVH 221 (4-3136817)]
gb|EQV12098.1| protein ygiW [Escherichia coli HVH 222 (4-2977443)]
gb|EQV19464.1| protein ygiW [Escherichia coli HVH 223 (4-2976528)]
gb|EQV25004.1| protein ygiW [Escherichia coli HVH 225 (4-1273116)]
gb|EQV30878.1| protein ygiW [Escherichia coli KOEGE 30 (63a)]
gb|EQV43805.1| protein ygiW [Escherichia coli KOEGE 32 (66a)]
gb|EQV44635.1| protein ygiW [Escherichia coli KOEGE 33 (68a)]
gb|EQV51918.1| protein ygiW [Escherichia coli KOEGE 40 (102a)]
gb|EQV63660.1| protein ygiW [Escherichia coli KOEGE 56 (169a)]
gb|EQV66568.1| protein ygiW [Escherichia coli KOEGE 58 (171a)]
gb|EQV77070.1| protein ygiW [Escherichia coli KOEGE 68 (182a)]
gb|EQV80181.1| protein ygiW [Escherichia coli KOEGE 62 (175a)]
gb|EQV81877.1| protein ygiW [Escherichia coli KOEGE 70 (185a)]
gb|EQV97320.1| protein ygiW [Escherichia coli KOEGE 77 (202a)]
gb|EQV97652.1| protein ygiW [Escherichia coli KOEGE 73 (195a)]
gb|EQW08218.1| protein ygiW [Escherichia coli KOEGE 118 (317a)]
gb|EQW10598.1| protein ygiW [Escherichia coli KOEGE 131 (358a)]
gb|EQW16901.1| protein ygiW [Escherichia coli UMEA 3022-1]
gb|EQW29662.1| protein ygiW [Escherichia coli UMEA 3033-1]
gb|EQW30197.1| protein ygiW [Escherichia coli UMEA 3041-1]
gb|EQW30494.1| protein ygiW [Escherichia coli UMEA 3052-1]
gb|EQW39163.1| protein ygiW [Escherichia coli UMEA 3053-1]
gb|EQW41356.1| protein ygiW [Escherichia coli UMEA 3065-1]
gb|EQW53154.1| protein ygiW [Escherichia coli UMEA 3097-1]
gb|EQW58812.1| protein ygiW [Escherichia coli UMEA 3088-1]
gb|EQW64459.1| protein ygiW [Escherichia coli UMEA 3108-1]
gb|EQW64843.1| protein ygiW [Escherichia coli UMEA 3113-1]
gb|EQW79411.1| protein ygiW [Escherichia coli UMEA 3117-1]
gb|EQW82197.1| protein ygiW [Escherichia coli UMEA 3122-1]
gb|EQW84957.1| protein ygiW [Escherichia coli UMEA 3124-1]
gb|EQW90315.1| protein ygiW [Escherichia coli UMEA 3139-1]
gb|EQW99762.1| protein ygiW [Escherichia coli UMEA 3152-1]
gb|EQX05056.1| protein ygiW [Escherichia coli UMEA 3155-1]
gb|EQX06826.1| protein ygiW [Escherichia coli UMEA 3140-1]
gb|EQX16751.1| protein ygiW [Escherichia coli UMEA 3161-1]
gb|EQX17936.1| protein ygiW [Escherichia coli UMEA 3160-1]
gb|EQX25945.1| protein ygiW [Escherichia coli UMEA 3162-1]
gb|EQX30372.1| protein ygiW [Escherichia coli UMEA 3163-1]
gb|EQX49616.1| protein ygiW [Escherichia coli UMEA 3174-1]
gb|EQX54090.1| protein ygiW [Escherichia coli UMEA 3176-1]
gb|EQX65829.1| protein ygiW [Escherichia coli UMEA 3190-1]
gb|EQX67019.1| protein ygiW [Escherichia coli UMEA 3180-1]
gb|EQX74102.1| protein ygiW [Escherichia coli UMEA 3193-1]
gb|EQX85343.1| protein ygiW [Escherichia coli UMEA 3200-1]
gb|EQX98118.1| protein ygiW [Escherichia coli UMEA 3203-1]
gb|EQX98668.1| protein ygiW [Escherichia coli UMEA 3206-1]
gb|EQY04345.1| protein ygiW [Escherichia coli UMEA 3201-1]
gb|EQY12780.1| protein ygiW [Escherichia coli UMEA 3215-1]
gb|EQY15887.1| protein ygiW [Escherichia coli UMEA 3212-1]
gb|EQY26303.1| protein ygiW [Escherichia coli UMEA 3217-1]
gb|EQY37960.1| protein ygiW [Escherichia coli UMEA 3221-1]
gb|EQY41333.1| protein ygiW [Escherichia coli UMEA 3230-1]
gb|EQY57428.1| protein ygiW [Escherichia coli UMEA 3240-1]
gb|EQY81207.1| protein ygiW [Escherichia coli UMEA 3304-1]
gb|EQY86183.1| protein ygiW [Escherichia coli UMEA 3314-1]
gb|EQY89109.1| protein ygiW [Escherichia coli UMEA 3317-1]
gb|EQY96486.1| protein ygiW [Escherichia coli UMEA 3329-1]
gb|EQY99330.1| protein ygiW [Escherichia coli UMEA 3318-1]
gb|EQZ09170.1| protein ygiW [Escherichia coli UMEA 3341-1]
gb|EQZ11832.1| protein ygiW [Escherichia coli UMEA 3355-1]
gb|EQZ15684.1| protein ygiW [Escherichia coli UMEA 3391-1]
gb|EQZ31804.1| protein ygiW [Escherichia coli UMEA 3585-1]
gb|EQZ33888.1| protein ygiW [Escherichia coli UMEA 3592-1]
gb|EQZ36511.1| protein ygiW [Escherichia coli UMEA 3617-1]
gb|EQZ37481.1| protein ygiW [Escherichia coli UMEA 3609-1]
gb|EQZ49260.1| protein ygiW [Escherichia coli UMEA 3632-1]
gb|EQZ51563.1| protein ygiW [Escherichia coli UMEA 3656-1]
gb|EQZ54698.1| protein ygiW [Escherichia coli UMEA 3662-1]
gb|EQZ62969.1| protein ygiW [Escherichia coli UMEA 3682-1]
gb|EQZ64558.1| protein ygiW [Escherichia coli UMEA 3671-1]
gb|EQZ76349.1| protein ygiW [Escherichia coli UMEA 3702-1]
gb|EQZ89265.1| protein ygiW [Escherichia coli UMEA 3703-1]
gb|ERA03779.1| protein ygiW [Escherichia coli UMEA 3805-1]
gb|ERA16203.1| protein ygiW [Escherichia coli UMEA 3889-1]
gb|ERA17514.1| protein ygiW [Escherichia coli UMEA 3834-1]
gb|ERA19444.1| protein ygiW [Escherichia coli UMEA 3893-1]
gb|ERA27266.1| protein ygiW [Escherichia coli UMEA 3955-1]
gb|ERA44940.1| protein ygiW [Escherichia coli UMEA 3899-1]
gb|ERA47521.1| protein ygiW [Escherichia coli UMEA 4076-1]
gb|ERA56602.1| hypothetical protein L668_16515 [Escherichia coli 95NR1]
gb|ERA67472.1| protein ygiW [Escherichia coli HVH 155 (4-4509048)]
gb|ERA88056.1| protein ygiW [Escherichia coli HVH 210 (4-3042480)]
gb|ERA98895.1| protein ygiW [Escherichia coli KOEGE 3 (4a)]
gb|ERB02598.1| protein ygiW [Escherichia coli KOEGE 7 (16a)]
gb|ERB03171.1| protein ygiW [Escherichia coli KOEGE 10 (25a)]
gb|ERB12875.1| protein ygiW [Escherichia coli UMEA 3144-1]
gb|ERB18090.1| protein ygiW [Escherichia coli UMEA 3151-1]
gb|ERB21608.1| protein ygiW [Escherichia coli UMEA 3150-1]
gb|ERB25347.1| protein ygiW [Escherichia coli UMEA 3271-1]
gb|ERB31704.1| protein ygiW [Escherichia coli UMEA 3298-1]
gb|ERB33101.1| protein ygiW [Escherichia coli UMEA 3292-1]
gb|ERB70744.1| protein ygiW [Escherichia coli B102]
gb|ERB71205.1| protein ygiW [Escherichia coli B107]
gb|ERB81894.1| protein ygiW [Escherichia coli B26-1]
gb|ERB88709.1| protein ygiW [Escherichia coli B26-2]
gb|ERB95649.1| protein ygiW [Escherichia coli B28-1]
gb|ERB95933.1| protein ygiW [Escherichia coli B28-2]
gb|ERC03882.1| protein ygiW [Escherichia coli B29-1]
gb|ERC11905.1| protein ygiW [Escherichia coli B29-2]
gb|ERC15503.1| protein ygiW [Escherichia coli B36-1]
gb|ERC19011.1| protein ygiW [Escherichia coli B36-2]
gb|ERC27755.1| protein ygiW [Escherichia coli B7-1]
gb|ERC32735.1| protein ygiW [Escherichia coli B7-2]
gb|ERC37473.1| protein ygiW [Escherichia coli B93]
gb|ERC43044.1| protein ygiW [Escherichia coli B94]
gb|ERC49638.1| protein ygiW [Escherichia coli B95]
gb|ERC55551.1| protein ygiW [Escherichia coli TW07509]
gb|ERC57961.1| protein ygiW [Escherichia coli 08BKT055439]
gb|ERC63889.1| protein ygiW [Escherichia coli Bd5610_99]
gb|ERC68107.1| protein ygiW [Escherichia coli T1840_97]
gb|ERC76733.1| protein ygiW [Escherichia coli T234_00]
gb|ERC80576.1| protein ygiW [Escherichia coli 14A]
gb|ERC83353.1| protein ygiW [Escherichia coli T924_01]
gb|ERC93245.1| protein ygiW [Escherichia coli 2886-75]
gb|ERC96353.1| protein ygiW [Escherichia coli B104]
gb|ERC96850.1| protein ygiW [Escherichia coli B103]
gb|ERD08142.1| protein ygiW [Escherichia coli B105]
gb|ERD12060.1| protein ygiW [Escherichia coli B108]
gb|ERD12550.1| protein ygiW [Escherichia coli B106]
gb|ERD24939.1| protein ygiW [Escherichia coli B109]
gb|ERD26464.1| protein ygiW [Escherichia coli B112]
gb|ERD30732.1| protein ygiW [Escherichia coli B113]
gb|ERD39163.1| protein ygiW [Escherichia coli B114]
gb|ERD43137.1| protein ygiW [Escherichia coli B15]
gb|ERD48072.1| protein ygiW [Escherichia coli B17]
gb|ERD57311.1| protein ygiW [Escherichia coli B40-2]
gb|ERD59274.1| protein ygiW [Escherichia coli B40-1]
gb|ERD61700.1| protein ygiW [Escherichia coli B49-2]
gb|ERD70438.1| protein ygiW [Escherichia coli B5-2]
gb|ERD75318.1| protein ygiW [Escherichia coli B83]
gb|ERD78749.1| protein ygiW [Escherichia coli B84]
gb|ERD86218.1| protein ygiW [Escherichia coli B85]
gb|ERD90633.1| protein ygiW [Escherichia coli B86]
gb|ERE02140.1| protein ygiW [Escherichia coli 08BKT77219]
gb|ERE09527.1| hypothetical protein L667_00540 [Escherichia coli 95JB1]
gb|ERE12824.1| protein ygiW [Escherichia coli 09BKT024447]
gb|ERE16566.1| protein ygiW [Escherichia coli T1282_01]
gb|ERE25671.1| protein ygiW [Escherichia coli B89]
gb|ERE27475.1| protein ygiW [Escherichia coli B90]
gb|ERE31978.1| protein ygiW [Escherichia coli Tx1686]
gb|ERE39450.1| protein ygiW [Escherichia coli Tx3800]
gb|ERF91510.1| hypothetical protein CFSAN002237_16870 [Escherichia coli O104:H21
str. CFSAN002237]
gb|AGW10137.1| hypothetical protein LY180_15625 [Escherichia coli LY180]
emb|CDH66689.1| hypothetical protein ECOPMV1_03330 [Escherichia coli PMV-1]
gb|AGX35007.1| ygiW [synthetic Escherichia coli C321.deltaA]
gb|ERO92159.1| protein ygiW [Escherichia coli BWH 24]
gb|ERO98010.1| protein ygiW [Escherichia coli BIDMC 19C]
gb|ESA25385.1| Protein ygiW precursor [Escherichia coli SCD1]
gb|ESA29972.1| Protein ygiW precursor [Escherichia coli SCD2]
gb|ESA64765.1| TIGR00156 family protein [Escherichia coli 110957]
gb|ESA65968.1| TIGR00156 family protein [Escherichia coli 113303]
gb|ESA70036.1| TIGR00156 family protein [Escherichia coli 113290]
gb|ESA75079.1| TIGR00156 family protein [Escherichia coli 907357]
gb|ESA86265.1| TIGR00156 family protein [Escherichia coli 907713]
gb|ESA94470.1| TIGR00156 family protein [Escherichia coli 907779]
gb|ESA95076.1| TIGR00156 family protein [Escherichia coli 909945-2]
gb|ESC94639.1| TIGR00156 family protein [Escherichia coli 113302]
gb|ESC98985.1| TIGR00156 family protein [Escherichia coli 907446]
gb|ESD12758.1| TIGR00156 family protein [Escherichia coli 907700]
gb|ESD14849.1| TIGR00156 family protein [Escherichia coli 907701]
gb|ESD19360.1| TIGR00156 family protein [Escherichia coli 907710]
gb|ESD20773.1| TIGR00156 family protein [Escherichia coli 907715]
gb|ESD41171.1| TIGR00156 family protein [Escherichia coli 907889]
gb|ESD41252.1| TIGR00156 family protein [Escherichia coli 908519]
gb|ESD49301.1| TIGR00156 family protein [Escherichia coli 908521]
gb|ESD50562.1| TIGR00156 family protein [Escherichia coli 908524]
gb|ESD61602.1| TIGR00156 family protein [Escherichia coli 908522]
gb|ESD68816.1| TIGR00156 family protein [Escherichia coli 908541]
gb|ESD69762.1| TIGR00156 family protein [Escherichia coli 908555]
gb|ESD77690.1| TIGR00156 family protein [Escherichia coli 908573]
gb|ESD86742.1| TIGR00156 family protein [Escherichia coli 908616]
gb|ESD91630.1| TIGR00156 family protein [Escherichia coli 908585]
gb|ESD97503.1| TIGR00156 family protein [Escherichia coli 908624]
gb|ESE05501.1| TIGR00156 family protein [Escherichia coli 908632]
gb|ESE12677.1| TIGR00156 family protein [Escherichia coli 908658]
gb|ESE17834.1| TIGR00156 family protein [Escherichia coli 908675]
gb|ESE18893.1| TIGR00156 family protein [Escherichia coli 910096-2]
gb|ESE21580.1| TIGR00156 family protein [Escherichia coli 908691]
gb|ESE33351.1| TIGR00156 family protein [Escherichia coli A35218R]
gb|AGY85748.1| hypothetical protein P423_17070 [Escherichia coli JJ1886]
gb|ESK01222.1| protein ygiW [Escherichia coli HVH 98 (4-5799287)]
gb|ESK04531.1| protein ygiW [Escherichia coli UMEA 3336-1]
gb|ESK13321.1| protein ygiW [Escherichia coli UMEA 3426-1]
gb|ESK15230.1| protein ygiW [Escherichia coli UMEA 3290-1]
gb|ESK15955.1| protein ygiW [Escherichia coli HVH 50 (4-2593475)]
gb|ESK25566.1| protein ygiW [Escherichia coli UMEA 3693-1]
gb|ESK33411.1| protein ygiW [Escherichia coli UMEA 3323-1]
gb|ESL33932.1| protein ygiW [Escherichia coli BIDMC 37]
gb|ESL34640.1| protein ygiW [Escherichia coli BIDMC 38]
gb|ESM34204.1| protein ygiW [Escherichia coli BWH 32]
gb|ESP07372.1| protein ygiW [Escherichia coli HVH 36 (4-5675286)]
gb|ESP14250.1| protein ygiW [Escherichia coli HVH 136 (4-5970458)]
gb|ESP16092.1| protein ygiW [Escherichia coli HVH 12 (4-7653042)]
gb|ESP30083.1| protein ygiW [Escherichia coli HVH 178 (4-3189163)]
gb|ESP35083.1| protein ygiW [Escherichia coli HVH 152 (4-3447545)]
gb|ESP37848.1| protein ygiW [Escherichia coli HVH 148 (4-3192490)]
gb|ESP42519.1| protein ygiW [Escherichia coli HVH 108 (4-6924867)]
emb|CDJ73828.1| hypothetical protein BN896_2737 [Escherichia coli str. K-12 substr.
MC4100]
gb|ESS90225.1| Protein ygiW precursor [Escherichia coli CE516]
gb|ESS93655.1| Protein ygiW precursor [Escherichia coli CE549]
gb|ESS97974.1| Protein ygiW precursor [Escherichia coli CE418]
gb|EST63078.1| Protein ygiW [Escherichia coli ECC-Z]
gb|EST68245.1| hypothetical protein M13_12675 [Escherichia coli P4-96]
gb|EST69171.1| hypothetical protein MOI_14319 [Escherichia coli P4-NR]
gb|EST81380.1| Protein ygiW [Escherichia coli ECA-727]
gb|EST86163.1| Protein ygiW [Escherichia coli ECC-1470]
gb|EST87550.1| Protein ygiW [Escherichia coli ECA-0157]
gb|ESV02672.1| Protein ygiW precursor [Escherichia coli E1777]
gb|ETD44637.1| hypothetical protein Q459_23735 [Escherichia coli ATCC BAA-2215]
gb|ETD63543.1| hypothetical protein Q458_12355 [Escherichia coli ATCC BAA-2209]
gb|ETF16325.1| protein ygiW [Escherichia coli HVH 177 (4-2876612)]
gb|ETF31994.1| protein ygiW [Escherichia coli HVH 214 (4-3062198)]
gb|ETF34892.1| protein ygiW [Escherichia coli UMEA 3489-1]
gb|ETI76149.1| hypothetical protein Q457_13495 [Escherichia coli ATCC BAA-2196]
gb|ETI78083.1| hypothetical protein Q460_09725 [Escherichia coli ATCC BAA-2219]
gb|ETJ57307.1| hypothetical protein Q456_0218100 [Escherichia coli ATCC BAA-2193]
gb|ETJ69441.1| hypothetical protein O199_0209540 [Escherichia coli ATCC 35150]
gb|ETJ76964.1| hypothetical protein Q455_0224190 [Escherichia coli ATCC BAA-2192]
emb|CDK46905.1| Protein ygiW precursor [Escherichia coli IS1]
emb|CDK54352.1| Protein ygiW precursor [Escherichia coli IS5]
emb|CDK81290.1| Protein ygiW precursor [Escherichia coli IS25]
emb|CDK69587.1| Protein ygiW precursor [Klebsiella pneumoniae IS22]
emb|CDK59057.1| Protein ygiW precursor [Escherichia coli IS9]
emb|CDL03363.1| Protein ygiW precursor [Escherichia coli IS35]
emb|CDK90020.1| Protein ygiW precursor [Escherichia coli IS29]
gb|ETS27774.1| hypothetical protein N444_07345 [Escherichia coli O6:H16:CFA/II
str. B2C]
gb|AHG16422.1| Protein ygiW precursor [Escherichia coli O145:H28 str. RM13516]
gb|AHG10580.1| Protein ygiW precursor [Escherichia coli O145:H28 str. RM13514]
gb|ETX79777.1| protein ygiW [Escherichia coli BIDMC 43b]
gb|ETX84194.1| protein ygiW [Escherichia coli BIDMC 43a]
gb|ETX88839.1| protein ygiW [Escherichia coli BIDMC 20B]
gb|ETX93310.1| protein ygiW [Escherichia coli BIDMC 20A]
gb|ETX98951.1| protein ygiW [Escherichia coli BIDMC 19B]
gb|ETY07077.1| protein ygiW [Escherichia coli BIDMC 19A]
gb|ETY11669.1| protein ygiW [Escherichia coli BIDMC 17B]
gb|ETY17159.1| protein ygiW [Escherichia coli BIDMC 17A]
gb|ETY24305.1| protein ygiW [Escherichia coli BIDMC 15]
gb|ETY30618.1| protein ygiW [Escherichia coli BIDMC 9]
gb|ETY32003.1| protein ygiW [Escherichia coli BIDMC 3]
gb|ETY37857.1| protein ygiW [Escherichia coli BIDMC 2B]
gb|ETY41893.1| protein ygiW [Escherichia coli BWH 40]
gb|ETY46519.1| protein ygiW [Escherichia coli BWH 34]
gb|ETY55212.1| protein ygiW [Escherichia coli BIDMC 49b]
gb|ETY58352.1| protein ygiW [Escherichia coli BIDMC 49a]
gb|ETY62326.1| protein ygiW [Escherichia coli BIDMC 6]
emb|CDL48861.1| Protein ygiW precursor [Escherichia coli ISC41]
gb|EWC56608.1| hypothetical protein G654_06385 [Escherichia coli EC096/10]
gb|EWY54407.1| hypothetical protein K427_06300 [Escherichia coli MP1]
gb|AHM29886.1| hypothetical protein BU34_13460 [Escherichia coli]
gb|AHM33139.1| hypothetical protein CF57_04675 [Escherichia coli]
gb|AHM37742.1| hypothetical protein CF61_05450 [Escherichia coli]
gb|AHM45267.1| hypothetical protein CF58_25115 [Escherichia coli]
gb|AHM49868.1| hypothetical protein CF59_25100 [Escherichia coli]
gb|AHM54310.1| hypothetical protein CF60_24650 [Escherichia coli]
gb|EYB41800.1| hypothetical protein BU70_14365 [Escherichia coli]
gb|EYB43281.1| hypothetical protein BU69_20090 [Escherichia coli]
gb|EYB48494.1| hypothetical protein BU68_22595 [Escherichia coli]
gb|EYB50518.1| hypothetical protein BU65_16755 [Escherichia coli]
gb|EYD82687.1| protein ygiW [Escherichia coli 1-176-05_S3_C1]
gb|EYD95693.1| protein ygiW [Escherichia coli 1-110-08_S4_C3]
gb|EYD97165.1| protein ygiW [Escherichia coli 1-110-08_S4_C2]
gb|EYE00438.1| protein ygiW [Escherichia coli 1-110-08_S4_C1]
gb|EYE11037.1| protein ygiW [Escherichia coli 1-110-08_S3_C3]
gb|EYE18617.1| protein ygiW [Escherichia coli 1-110-08_S3_C2]
gb|EYE20719.1| protein ygiW [Escherichia coli 1-110-08_S1_C3]
gb|EYE21295.1| protein ygiW [Escherichia coli 1-110-08_S3_C1]
gb|EYE33772.1| protein ygiW [Escherichia coli 1-110-08_S1_C1]
gb|EYE34715.1| protein ygiW [Escherichia coli 1-110-08_S1_C2]
gb|EYT08820.1| protein ygiW [Escherichia coli K02]
gb|EYU73652.1| hypothetical protein BX62_20175 [Escherichia coli O121:H19 str.
2010C-4254]
gb|EYU82734.1| hypothetical protein BX60_07740 [Escherichia coli O111:NM str.
2010C-4221]
gb|EYU84709.1| hypothetical protein BX63_13215 [Escherichia coli O26:NM str.
2010C-4347]
gb|EYU86877.1| hypothetical protein BX56_25145 [Escherichia coli O45:H2 str.
2010C-3876]
gb|EYU95350.1| hypothetical protein BX58_10585 [Escherichia coli O111:NM str.
2010C-3977]
gb|EYU97719.1| hypothetical protein BX59_23620 [Escherichia coli O111:NM str.
2010C-4086]
gb|EYV00512.1| hypothetical protein BX54_11330 [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV05261.1| hypothetical protein BX54_20060 [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV13931.1| hypothetical protein BX52_08725 [Escherichia coli O121:H19 str.
2010C-3609]
gb|EYV18870.1| hypothetical protein BX51_24990 [Escherichia coli O145:NM str.
2010C-3526]
gb|EYV21691.1| hypothetical protein BX50_01185 [Escherichia coli O145:NM str.
2010C-3521]
gb|EYV27544.1| hypothetical protein BX48_22375 [Escherichia coli O145:NM str.
2010C-3517]
gb|EYV29326.1| hypothetical protein BX49_25510 [Escherichia coli O145:NM str.
2010C-3518]
gb|EYV33271.1| hypothetical protein BX47_03115 [Escherichia coli O145:NM str.
2010C-3516]
gb|EYV41567.1| hypothetical protein BX45_11740 [Escherichia coli O145:NM str.
2010C-3510]
gb|EYV44378.1| hypothetical protein BX46_12845 [Escherichia coli O145:NM str.
2010C-3511]
gb|EYV51077.1| hypothetical protein BX44_20310 [Escherichia coli O145:NM str.
2010C-3509]
gb|EYV54546.1| hypothetical protein BX36_26140 [Escherichia coli O157:H7 str.
2009EL2109]
gb|EYV57280.1| hypothetical protein BX42_06175 [Escherichia coli O145:NM str.
2010C-3507]
gb|EYV64015.1| hypothetical protein BX40_19920 [Escherichia coli O103:H11 str.
2010C-3214]
gb|EYV69058.1| hypothetical protein BX34_08055 [Escherichia coli O157:H7 str.
2009EL1705]
gb|EYV72876.1| hypothetical protein BX32_20865 [Escherichia coli O121:H19 str.
2009EL1412]
gb|EYV74174.1| hypothetical protein BY91_21340 [Escherichia coli O157:H7 str.
K5806]
gb|EYV80914.1| hypothetical protein BX25_09065 [Escherichia coli O121:H19 str.
2009C-4659]
gb|EYV86247.1| hypothetical protein BY41_01510 [Escherichia coli O86:H34 str.
99-3124]
gb|EYV92289.1| hypothetical protein BY51_03995 [Escherichia coli O157:H7 str.
F7350]
gb|EYV98431.1| hypothetical protein BY42_06360 [Escherichia coli O6:H16 str.
99-3165]
gb|EYW01469.1| hypothetical protein BY37_16170 [Escherichia coli O157:H7 str.
2011EL-2312]
gb|EYW07048.1| hypothetical protein BY34_05945 [Escherichia coli O157:H7 str.
2011EL-2288]
gb|EYW10008.1| hypothetical protein BY35_13025 [Escherichia coli O157:H7 str.
2011EL-2289]
gb|EYW17762.1| hypothetical protein BY33_12885 [Escherichia coli O157:H7 str.
2011EL-2287]
gb|EYW19822.1| hypothetical protein BY32_21675 [Escherichia coli O157:H7 str.
2011EL-2286]
gb|EYW21660.1| hypothetical protein BY31_05145 [Escherichia coli O157:H7 str.
2011EL-2114]
gb|EYW32292.1| hypothetical protein BY30_13310 [Escherichia coli O157:H7 str.
2011EL-2113]
gb|EYW33036.1| hypothetical protein BY29_12255 [Escherichia coli O157:H7 str.
2011EL-2112]
gb|EYW40467.1| hypothetical protein BY28_09695 [Escherichia coli O157:H7 str.
2011EL-2111]
gb|EYW43955.1| hypothetical protein BY27_22825 [Escherichia coli O157:H7 str.
2011EL-2109]
gb|EYW54304.1| hypothetical protein BY25_14440 [Escherichia coli O157:H7 str.
2011EL-2107]
gb|EYW54456.1| hypothetical protein BY26_05595 [Escherichia coli O157:H7 str.
2011EL-2108]
gb|EYW65545.1| hypothetical protein BY24_06615 [Escherichia coli O157:H7 str.
2011EL-2106]
gb|EYW66274.1| hypothetical protein BY23_08415 [Escherichia coli O157:H7 str.
2011EL-2105]
gb|EYW68439.1| hypothetical protein BY22_18515 [Escherichia coli O157:H7 str.
2011EL-2104]
gb|EYW72985.1| hypothetical protein BY21_22755 [Escherichia coli O157:H7 str.
2011EL-2103]
gb|EYW74980.1| hypothetical protein BY20_21635 [Escherichia coli O157:H7 str.
2011EL-2101]
gb|EYW84263.1| hypothetical protein BY19_11495 [Escherichia coli O157:H7 str.
2011EL-2099]
gb|EYW90374.1| hypothetical protein BX03_12475 [Escherichia coli O111:NM str.
08-4487]
gb|EYW92511.1| hypothetical protein BX01_21460 [Escherichia coli O157:H7 str.
08-4169]
gb|EYW92949.1| hypothetical protein BX02_23620 [Escherichia coli O145:NM str.
08-4270]
gb|EYW98163.1| hypothetical protein BX00_22300 [Escherichia coli O118:H16 str.
08-3651]
gb|EYX11129.1| hypothetical protein BW99_14365 [Escherichia coli O157:H7 str.
08-3527]
gb|EYX13400.1| hypothetical protein BW98_03225 [Escherichia coli O157:H7 str.
08-3037]
gb|EYX19817.1| hypothetical protein BW97_09090 [Escherichia coli O69:H11 str.
07-4281]
gb|EYX23346.1| hypothetical protein BY18_14755 [Escherichia coli O157:H7 str.
2011EL-2098]
gb|EYX23597.1| hypothetical protein BY17_18235 [Escherichia coli O157:H7 str.
2011EL-2097]
gb|EYX35114.1| hypothetical protein BY16_05550 [Escherichia coli O157:H7 str.
2011EL-2096]
gb|EYX41497.1| hypothetical protein BY14_11860 [Escherichia coli O157:H7 str.
2011EL-2093]
gb|EYX43796.1| hypothetical protein BY15_07925 [Escherichia coli O157:H7 str.
2011EL-2094]
gb|EYX46878.1| hypothetical protein BY13_19325 [Escherichia coli O157:H7 str.
2011EL-2092]
gb|EYX57921.1| hypothetical protein BY12_20840 [Escherichia coli O157:H7 str.
2011EL-2091]
gb|EYX60479.1| hypothetical protein BY11_00630 [Escherichia coli O157:H7 str.
2011EL-2090]
gb|EYX63382.1| hypothetical protein BY10_15575 [Escherichia coli O104:H4 str.
2011EL-1675A]
gb|EYX67335.1| hypothetical protein BY09_14570 [Escherichia coli O157:H7 str.
2011EL-1107]
gb|EYX74838.1| hypothetical protein BY05_17310 [Escherichia coli O111:NM str.
2011C-3632]
gb|EYX77452.1| hypothetical protein BY07_14920 [Escherichia coli O111:NM str.
2011C-3679]
gb|EYX83332.1| hypothetical protein BY04_08310 [Escherichia coli O156:H25 str.
2011C-3602]
gb|EYX86087.1| hypothetical protein BY08_13715 [Escherichia coli O103:H2 str.
2011C-3750]
gb|EYX94187.1| hypothetical protein BY03_06565 [Escherichia coli O111:NM str.
2011C-3573]
gb|EYX97024.1| hypothetical protein BY02_13935 [Escherichia coli O121:H19 str.
2011C-3537]
gb|EYY02210.1| hypothetical protein BY00_11180 [Escherichia coli O121:H19 str.
2011C-3500]
gb|EYY08512.1| hypothetical protein BX97_05960 [Escherichia coli O111:NM str.
2011C-3362]
gb|EYY13113.1| hypothetical protein BX94_11110 [Escherichia coli O121:H19 str.
2011C-3216]
gb|EYY18145.1| hypothetical protein BX93_13085 [Escherichia coli O111:NM str.
2011C-3170]
gb|EYY22978.1| hypothetical protein BX92_06740 [Escherichia coli O121:H19 str.
2011C-3108]
gb|EYY23525.1| hypothetical protein BX91_17800 [Escherichia coli O121:H19 str.
2011C-3072]
gb|EYY26994.1| hypothetical protein BX87_20750 [Escherichia coli O121:H19 str.
2010EL1058]
gb|EYY35266.1| hypothetical protein BX84_07960 [Escherichia coli O121:H19 str.
2010C-4989]
gb|EYY43520.1| hypothetical protein BX86_20650 [Escherichia coli O153:H2 str.
2010C-5034]
gb|EYY47166.1| hypothetical protein BX83_04120 [Escherichia coli O157:H7 str.
2010C-4979C1]
gb|EYY52693.1| hypothetical protein BX82_09200 [Escherichia coli O121:H19 str.
2010C-4966]
gb|EYY56805.1| hypothetical protein BX81_13840 [Escherichia coli O165:H25 str.
2010C-4874]
gb|EYY62966.1| hypothetical protein BX79_09220 [Escherichia coli O121:H19 str.
2010C-4824]
gb|EYY66328.1| hypothetical protein BX77_10370 [Escherichia coli O111:NM str.
2010C-4818]
gb|EYY66543.1| hypothetical protein BX76_16755 [Escherichia coli O111:NM str.
2010C-4799]
gb|EYY76894.1| hypothetical protein BX75_21640 [Escherichia coli O26:NM str.
2010C-4788]
gb|EYY77836.1| hypothetical protein BX74_04955 [Escherichia coli O111:NM str.
2010C-4746]
gb|EYY83413.1| hypothetical protein BX73_16425 [Escherichia coli O111:NM str.
2010C-4735]
gb|EYY88577.1| hypothetical protein BX72_16920 [Escherichia coli O121:H19 str.
2010C-4732]
gb|EYY97167.1| hypothetical protein BX71_24425 [Escherichia coli O111:NM str.
2010C-4715]
gb|EYY98869.1| hypothetical protein BX70_11025 [Escherichia coli O111:NM str.
2010C-4622]
gb|EYZ06342.1| hypothetical protein BX69_11115 [Escherichia coli O111:NM str.
2010C-4592]
gb|EYZ13741.1| hypothetical protein BX66_19070 [Escherichia coli O103:H25 str.
2010C-4529]
gb|EYZ18923.1| hypothetical protein BX67_07975 [Escherichia coli O145:NM str.
2010C-4557C2]
gb|EYZ24567.1| hypothetical protein BX65_11070 [Escherichia coli O103:H2 str.
2010C-4433]
gb|EYZ31393.1| hypothetical protein BW94_15485 [Escherichia coli O157:H7 str.
06-4039]
gb|EYZ34113.1| hypothetical protein BW96_24225 [Escherichia coli O157:H7 str.
07-3391]
gb|EYZ36961.1| hypothetical protein BW95_26060 [Escherichia coli O157:H7 str.
07-3091]
gb|EYZ44285.1| hypothetical protein BW91_04030 [Escherichia coli O91:H14 str.
06-3691]
gb|EYZ44369.1| hypothetical protein BW93_18980 [Escherichia coli O121:H19 str.
06-3822]
gb|EYZ53389.1| hypothetical protein BW92_24160 [Escherichia coli O157:H7 str.
06-3745]
gb|EYZ61386.1| hypothetical protein BW88_00150 [Escherichia coli O79:H7 str.
06-3501]
gb|EYZ62333.1| hypothetical protein BW89_08605 [Escherichia coli O55:H7 str.
06-3555]
gb|EYZ63507.1| hypothetical protein BW90_22420 [Escherichia coli O118:H16 str.
06-3612]
gb|EYZ67846.1| hypothetical protein BW85_03065 [Escherichia coli O69:H11 str.
06-3325]
gb|EYZ73235.1| hypothetical protein BW87_08165 [Escherichia coli O145:NM str.
06-3484]
gb|EYZ79722.1| hypothetical protein BW83_23060 [Escherichia coli O121:H19 str.
06-3003]
gb|EYZ88445.1| hypothetical protein BW82_02580 [Escherichia coli O111:NM str.
04-3211]
gb|EYZ90900.1| hypothetical protein BW84_14610 [Escherichia coli O118:H16 str.
06-3256]
gb|EYZ94004.1| hypothetical protein BW79_14975 [Escherichia coli O119:H4 str.
03-3458]
gb|EZA01975.1| hypothetical protein BW78_23110 [Escherichia coli O174:H21 str.
03-3269]
gb|EZA03746.1| hypothetical protein BW80_14935 [Escherichia coli O111:NM str.
03-3484]
gb|EZA07817.1| hypothetical protein BW77_20960 [Escherichia coli O121:H19 str.
03-3227]
gb|EZA12478.1| hypothetical protein BW76_08495 [Escherichia coli O28ac:NM str.
02-3404]
gb|EZA16499.1| hypothetical protein BW75_01285 [Escherichia coli O81:NM str.
02-3012]
gb|EZA22951.1| hypothetical protein BW74_24405 [Escherichia coli O45:H2 str.
01-3147]
gb|EZA25444.1| hypothetical protein BW71_01535 [Escherichia coli O113:H21 str.
07-4224]
gb|EZA39193.1| hypothetical protein BW70_07485 [Escherichia coli O174:H8 str.
04-3038]
gb|EZA39321.1| hypothetical protein BW69_09285 [Escherichia coli O103:H11 str.
04-3023]
gb|EZA42449.1| hypothetical protein BW68_14775 [Escherichia coli O26:H11 str.
05-3646]
gb|EZA65251.1| hypothetical protein BY39_22530 [Escherichia coli O104:H21 str.
94-3025]
gb|EZA71751.1| hypothetical protein BY40_05470 [Escherichia coli O157:H16 str.
98-3133]
gb|EZA77639.1| hypothetical protein BY43_09120 [Escherichia coli O25:NM str.
E2539C1]
gb|EZA78203.1| hypothetical protein BY44_10760 [Escherichia coli O6:H16 str.
F5656C1]
gb|EZA82425.1| hypothetical protein BY46_20305 [Escherichia coli O111:H8 str.
F6627]
gb|EZA90253.1| hypothetical protein BY45_24090 [Escherichia coli O157:H7 str.
F6142]
gb|EZA92057.1| hypothetical protein BY47_18165 [Escherichia coli O121:H19 str.
F6714]
gb|EZB02474.1| hypothetical protein BY49_06390 [Escherichia coli O157:H7 str.
F6750]
gb|EZB03040.1| hypothetical protein BY48_06335 [Escherichia coli O157:H7 str.
F6749]
gb|EZB07383.1| hypothetical protein BY50_20500 [Escherichia coli O157:H7 str.
F6751]
gb|EZB13789.1| hypothetical protein BY53_15555 [Escherichia coli O157:H7 str.
F7384]
gb|EZB15288.1| hypothetical protein BY52_17785 [Escherichia coli O157:H7 str.
F7377]
gb|EZB28942.1| hypothetical protein BY55_15705 [Escherichia coli O169:H41 str.
F9792]
gb|EZB30387.1| hypothetical protein BY54_09000 [Escherichia coli O157:H7 str.
F7410]
gb|EZB31003.1| hypothetical protein BY56_18420 [Escherichia coli O157:H7 str.
G5303]
gb|EZB41932.1| hypothetical protein BY58_09455 [Escherichia coli O157:H7 str.
H2498]
gb|EZB44485.1| hypothetical protein BY57_25635 [Escherichia coli O157:H7 str.
H2495]
gb|EZB47516.1| hypothetical protein BY59_04890 [Escherichia coli O157:H7 str.
K1420]
gb|EZB57753.1| hypothetical protein BY62_25120 [Escherichia coli O157:H7 str.
K1793]
gb|EZB60137.1| hypothetical protein BY61_01335 [Escherichia coli O157:H7 str.
K1792]
gb|EZB62325.1| hypothetical protein BY60_21440 [Escherichia coli O15:H18 str.
K1516]
gb|EZB65115.1| hypothetical protein BY64_24710 [Escherichia coli O157:H7 str.
K1796]
gb|EZB72929.1| hypothetical protein BY63_01580 [Escherichia coli O157:H7 str.
K1795]
gb|EZB78497.1| hypothetical protein BY65_06220 [Escherichia coli O157:H7 str.
K1845]
gb|EZB90331.1| hypothetical protein BY67_19260 [Escherichia coli O157:H7 str.
K1927]
gb|EZB90905.1| hypothetical protein BY66_15405 [Escherichia coli O157:H7 str.
K1921]
gb|EZB92874.1| hypothetical protein BY70_08905 [Escherichia coli O157:H7 str.
K2192]
gb|EZB93104.1| hypothetical protein BY68_21095 [Escherichia coli O157:H7 str.
K2188]
gb|EZC00953.1| hypothetical protein BY69_01565 [Escherichia coli O157:H7 str.
K2191]
gb|EZC07027.1| hypothetical protein BY71_12830 [Escherichia coli O157:H7 str.
K2324]
gb|EZC07177.1| hypothetical protein BY72_22205 [Escherichia coli O157:H7 str.
K2581]
gb|EZC12182.1| hypothetical protein BY74_07650 [Escherichia coli O157:H7 str.
K2845]
gb|EZC17407.1| hypothetical protein BY73_07870 [Escherichia coli O157:H7 str.
K2622]
gb|EZC19438.1| hypothetical protein BY75_20865 [Escherichia coli O157:H7 str.
K2854]
gb|EZC26103.1| hypothetical protein BY76_23905 [Escherichia coli O157:H7 str.
K4396]
gb|EZC27764.1| hypothetical protein BY77_02355 [Escherichia coli O157:H7 str.
K4405]
gb|EZC42153.1| hypothetical protein BY79_22200 [Escherichia coli O157:H7 str.
K4527]
gb|EZC42471.1| hypothetical protein BY78_23600 [Escherichia coli O157:H7 str.
K4406]
gb|EZC47183.1| hypothetical protein BY80_24730 [Escherichia coli O121:H19 str.
K5198]
gb|EZC55494.1| hypothetical protein BY81_13065 [Escherichia coli O121:H19 str.
K5269]
gb|EZC61006.1| hypothetical protein BY82_20750 [Escherichia coli O157:H7 str.
K5418]
gb|EZC68384.1| hypothetical protein BY85_12985 [Escherichia coli O157:H7 str.
K5453]
gb|EZC69993.1| hypothetical protein BY84_13705 [Escherichia coli O157:H7 str.
K5449]
gb|EZC71536.1| hypothetical protein BY83_13620 [Escherichia coli O157:H7 str.
K5448]
gb|EZC78672.1| hypothetical protein BY87_24305 [Escherichia coli O157:H7 str.
K5467]
gb|EZC78742.1| hypothetical protein BY86_12505 [Escherichia coli O157:H7 str.
K5460]
gb|EZC84688.1| hypothetical protein BY88_24285 [Escherichia coli O157:H7 str.
K5602]
gb|EZC91629.1| hypothetical protein BY89_13225 [Escherichia coli O157:H7 str.
K5607]
gb|EZC99967.1| hypothetical protein BY90_07545 [Escherichia coli O157:H7 str.
K5609]
gb|EZD06852.1| hypothetical protein BY92_20205 [Escherichia coli O157:H7 str.
K5852]
gb|EZD14021.1| hypothetical protein BY94_04630 [Escherichia coli O157:H7 str.
K6676]
gb|EZD14990.1| hypothetical protein BY93_12100 [Escherichia coli O157:H7 str.
K6590]
gb|EZD26404.1| hypothetical protein BY95_24750 [Escherichia coli O157:H7 str.
K6687]
gb|EZD28607.1| hypothetical protein BY97_11025 [Escherichia coli O111:NM str.
K6723]
gb|EZD30930.1| hypothetical protein BY96_08325 [Escherichia coli O111:NM str.
K6722]
gb|EZD35308.1| hypothetical protein BY99_08340 [Escherichia coli O111:NM str.
K6890]
gb|EZD40084.1| hypothetical protein BY98_12415 [Escherichia coli O111:NM str.
K6728]
gb|EZD46735.1| hypothetical protein BZ00_25210 [Escherichia coli O111:NM str.
K6895]
gb|EZD53852.1| hypothetical protein BZ01_04135 [Escherichia coli O111:NM str.
K6897]
gb|EZD59185.1| hypothetical protein BZ02_08610 [Escherichia coli O111:NM str.
K6898]
gb|EZD60714.1| hypothetical protein BZ04_06990 [Escherichia coli O111:NM str.
K6908]
gb|EZD63553.1| hypothetical protein BZ03_21635 [Escherichia coli O111:NM str.
K6904]
gb|EZD71413.1| hypothetical protein BZ06_20670 [Escherichia coli O157:H7 str.
K7140]
gb|EZD71671.1| hypothetical protein BZ05_03535 [Escherichia coli O111:NM str.
K6915]
gb|EZD82323.1| hypothetical protein BX04_13095 [Escherichia coli O157:H7 str.
08-4529]
gb|EZD84417.1| hypothetical protein P411_10525 [Escherichia coli O39:NM str.
F8704-2]
gb|EZD89391.1| hypothetical protein BX05_13180 [Escherichia coli O157:NM str.
08-4540]
gb|EZD95791.1| hypothetical protein BX07_02305 [Escherichia coli O91:H14 str.
2009C-3227]
gb|EZE02722.1| hypothetical protein BX08_14695 [Escherichia coli O103:H2 str.
2009C-3279]
gb|EZE08156.1| hypothetical protein BX06_16255 [Escherichia coli O69:H11 str.
08-4661]
gb|EZE19839.1| hypothetical protein BX14_17370 [Escherichia coli O45:H2 str.
2009C-3686]
gb|EZE30090.1| hypothetical protein BX12_05400 [Escherichia coli O69:H11 str.
2009C-3601]
gb|EZE31495.1| hypothetical protein BX11_08180 [Escherichia coli O123:H11 str.
2009C-3307]
gb|EZE36844.1| hypothetical protein BX16_24070 [Escherichia coli O91:NM str.
2009C-3745]
gb|EZE44358.1| hypothetical protein BX19_10910 [Escherichia coli O121:H19 str.
2009C-4050]
gb|EZE44507.1| hypothetical protein BX18_09900 [Escherichia coli O111:NM str.
2009C-4006]
gb|EZE50591.1| hypothetical protein BX20_11640 [Escherichia coli O111:NM str.
2009C-4052]
gb|EZE58085.1| hypothetical protein BX23_11350 [Escherichia coli O118:H16 str.
2009C-4446]
gb|EZE60051.1| hypothetical protein BX22_04995 [Escherichia coli O157:H7 str.
2009C-4258]
gb|EZE66784.1| hypothetical protein BX24_04010 [Escherichia coli O91:H21 str.
2009C-4646]
gb|EZE68399.1| hypothetical protein BX29_10600 [Escherichia coli O45:H2 str.
2009C-4780]
gb|EZE76286.1| hypothetical protein BX27_23720 [Escherichia coli O121:H19 str.
2009C-4750]
gb|EZE77023.1| hypothetical protein BX33_04135 [Escherichia coli O157:H7 str.
2009EL1449]
gb|EZE83488.1| hypothetical protein BX31_11930 [Escherichia coli O121:H19 str.
2009EL1302]
gb|EZE87135.1| hypothetical protein BX35_23615 [Escherichia coli O157:H7 str.
2009EL1913]
gb|EZE90817.1| hypothetical protein BX43_04575 [Escherichia coli O145:NM str.
2010C-3508]
gb|EZE97828.1| hypothetical protein BX53_07360 [Escherichia coli O121:H19 str.
2010C-3794]
gb|EZF07117.1| hypothetical protein BY36_04830 [Escherichia coli O157:H7 str.
2011EL-2290]
gb|EZF07242.1| hypothetical protein BY38_04465 [Escherichia coli O157:H7 str.
2011EL-2313]
gb|EZG32769.1| hypothetical protein AU10_05700 [Escherichia coli E1728]
gb|EZG47749.1| hypothetical protein BW86_20370 [Escherichia coli O26:H11 str.
06-3464]
gb|EZG53944.1| hypothetical protein BW81_26875 [Escherichia coli O26:H11 str.
03-3500]
gb|EZG61954.1| hypothetical protein BX64_06685 [Escherichia coli O26:H11 str.
2010C-4430]
gb|EZG65292.1| hypothetical protein BX78_06750 [Escherichia coli O26:H11 str.
2010C-4819]
gb|EZG74815.1| hypothetical protein BX85_19130 [Escherichia coli O26:H11 str.
2010C-5028]
gb|EZG75172.1| hypothetical protein BX80_02380 [Escherichia coli O26:H11 str.
2010C-4834]
gb|EZG85776.1| hypothetical protein BX88_00730 [Escherichia coli O26:H11 str.
2010EL-1699]
gb|EZG88970.1| hypothetical protein BX95_04465 [Escherichia coli O26:H11 str.
2011C-3270]
gb|EZG91104.1| hypothetical protein BY01_06780 [Escherichia coli O26:H11 str.
2011C-3506]
gb|EZG97180.1| hypothetical protein BX98_08420 [Escherichia coli O26:H11 str.
2011C-3387]
gb|EZH01027.1| hypothetical protein BX96_13790 [Escherichia coli O26:H11 str.
2011C-3282]
gb|EZH16327.1| hypothetical protein BX15_05245 [Escherichia coli O26:H11 str.
2009C-3689]
gb|EZH16788.1| hypothetical protein BY06_16795 [Escherichia coli O26:H11 str.
2011C-3655]
gb|EZH17367.1| hypothetical protein BX13_11285 [Escherichia coli O26:H11 str.
2009C-3612]
gb|EZH26909.1| hypothetical protein BX17_10970 [Escherichia coli O26:H11 str.
2009C-3996]
gb|EZH31600.1| hypothetical protein BX28_00815 [Escherichia coli O26:H11 str.
2009C-4760]
gb|EZH32341.1| hypothetical protein BX30_11920 [Escherichia coli O26:H11 str.
2009C-4826]
gb|EZH41147.1| hypothetical protein BX38_03890 [Escherichia coli O26:H11 str.
2010C-3051]
gb|EZH44077.1| hypothetical protein BX41_14565 [Escherichia coli O26:H11 str.
2010C-3472]
gb|EZH50287.1| hypothetical protein BX55_15865 [Escherichia coli O26:H11 str.
2010C-3871]
gb|EZH54573.1| hypothetical protein BX57_12300 [Escherichia coli O26:H11 str.
2010C-3902]
gb|EZH58188.1| hypothetical protein BX61_12145 [Escherichia coli O26:H11 str.
2010C-4244]
gb|EZJ18274.1| protein ygiW [Escherichia coli 1-182-04_S4_C3]
gb|EZJ20792.1| protein ygiW [Escherichia coli 1-176-05_S4_C3]
gb|EZJ34807.1| protein ygiW [Escherichia coli 1-250-04_S4_C2]
gb|EZJ36195.1| protein ygiW [Escherichia coli 2-005-03_S4_C3]
gb|EZJ40196.1| protein ygiW [Escherichia coli 1-182-04_S4_C2]
gb|EZJ48993.1| protein ygiW [Escherichia coli 2-005-03_S4_C2]
gb|EZJ52239.1| protein ygiW [Escherichia coli 1-250-04_S4_C1]
gb|EZJ59710.1| protein ygiW [Escherichia coli 1-182-04_S4_C1]
gb|EZJ67992.1| protein ygiW [Escherichia coli 1-176-05_S4_C1]
gb|EZJ68984.1| protein ygiW [Escherichia coli 1-392-07_S3_C3]
gb|EZJ70946.1| protein ygiW [Escherichia coli 1-182-04_S3_C3]
gb|EZJ82041.1| protein ygiW [Escherichia coli 1-182-04_S3_C2]
gb|EZJ83248.1| protein ygiW [Escherichia coli 1-250-04_S3_C1]
gb|EZJ90968.1| protein ygiW [Escherichia coli 1-182-04_S3_C1]
gb|EZJ93972.1| protein ygiW [Escherichia coli 1-182-04_S1_C3]
gb|EZJ95898.1| protein ygiW [Escherichia coli 1-250-04_S1_C3]
gb|EZK06504.1| protein ygiW [Escherichia coli 1-176-05_S1_C3]
gb|EZK12379.1| protein ygiW [Escherichia coli 2-005-03_S1_C3]
gb|EZK17149.1| protein ygiW [Escherichia coli 1-176-05_S1_C2]
gb|EZK20047.1| protein ygiW [Escherichia coli 2-011-08_S1_C2]
gb|EZK28627.1| protein ygiW [Escherichia coli 1-182-04_S1_C1]
gb|EZK30904.1| protein ygiW [Escherichia coli 2-005-03_S1_C2]
gb|EZK41632.1| protein ygiW [Escherichia coli 2-005-03_S1_C1]
gb|EZQ25563.1| hypothetical protein BX39_14020 [Escherichia coli O111:NM str.
2010C-3053]
gb|EZQ31715.1| hypothetical protein BX37_16330 [Escherichia coli O111:H8 str.
2009EL-2169]
gb|EZQ34899.1| hypothetical protein BX26_04410 [Escherichia coli O26:H1 str.
2009C-4747]
gb|EZQ44768.1| hypothetical protein BX21_00770 [Escherichia coli O111:H8 str.
2009C-4126]
gb|EZQ45534.1| hypothetical protein BX90_06850 [Escherichia coli O157: str.
2010EL-2045]
gb|EZQ46711.1| hypothetical protein BX99_07380 [Escherichia coli O111:H8 str.
2011C-3453]
gb|EZQ52047.1| hypothetical protein BX89_16785 [Escherichia coli O157: str.
2010EL-2044]
gb|EZQ69190.1| protein ygiW [Escherichia coli BIDMC 82]
gb|AHY66745.1| Protein ygiW precursor [Escherichia coli O145:H28 str. RM12761]
gb|AHY72397.1| Protein ygiW precursor [Escherichia coli O145:H28 str. RM12581]
gb|KCW95182.1| hypothetical protein DP79_13720 [Escherichia coli]
gb|KDA56477.1| protein ygiW [Escherichia coli 2-011-08_S1_C1]
gb|KDA62337.1| protein ygiW [Escherichia coli 2-052-05_S1_C1]
gb|KDA72316.1| protein ygiW [Escherichia coli 2-005-03_S3_C2]
gb|KDA78359.1| protein ygiW [Escherichia coli 2-011-08_S3_C2]
gb|KDA83461.1| protein ygiW [Escherichia coli 2-011-08_S3_C3]
gb|KDA88475.1| protein ygiW [Escherichia coli 1-176-05_S4_C2]
emb|CDP73900.1| Putative uncharacterized protein ygiW [Escherichia coli]
emb|CDP66314.1| Putative uncharacterized protein ygiW [Escherichia coli D6-113.11]
emb|CDP74716.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
gb|KDF65836.1| protein ygiW [Escherichia coli BIDMC 59]
gb|KDF71692.1| protein ygiW [Escherichia coli BIDMC 58]
gb|KDF84179.1| protein ygiW [Escherichia coli BIDMC 62]
gb|KDF85030.1| protein ygiW [Escherichia coli BIDMC 63]
gb|KDF90027.1| protein ygiW [Escherichia coli BIDMC 64]
gb|KDF96425.1| protein ygiW [Escherichia coli BIDMC 65]
gb|KDF99578.1| protein ygiW [Escherichia coli BIDMC 70]
gb|KDG03279.1| protein ygiW [Escherichia coli BIDMC 71]
gb|KDG13293.1| protein ygiW [Escherichia coli BIDMC 72]
gb|KDG15947.1| protein ygiW [Escherichia coli BIDMC 73]
gb|KDG20156.1| protein ygiW [Escherichia coli BIDMC 74]
gb|KDG23385.1| protein ygiW [Escherichia coli BIDMC 75]
gb|KDG26281.1| protein ygiW [Escherichia coli BIDMC 76]
gb|KDG38680.1| protein ygiW [Escherichia coli BIDMC 78]
gb|KDG40799.1| protein ygiW [Escherichia coli BIDMC 77]
gb|KDG43657.1| protein ygiW [Escherichia coli BIDMC 79]
gb|KDG49077.1| protein ygiW [Escherichia coli CHS 68]
gb|KDG54952.1| protein ygiW [Escherichia coli CHS 77]
gb|KDG58508.1| protein ygiW [Escherichia coli CHS 69]
gb|KDG61997.1| protein ygiW [Escherichia coli MGH 57]
gb|KDG69772.1| protein ygiW [Escherichia coli UCI 51]
gb|KDG72940.1| protein ygiW [Escherichia coli MGH 58]
gb|KDG76520.1| protein ygiW [Escherichia coli UCI 53]
gb|KDG83866.1| protein ygiW [Escherichia coli UCI 57]
gb|KDG87672.1| protein ygiW [Escherichia coli UCI 58]
gb|KDG92665.1| protein ygiW [Escherichia coli UCI 65]
gb|KDG94930.1| protein ygiW [Escherichia coli UCI 66]
gb|KDM72023.1| hypothetical protein DA88_16140 [Escherichia coli]
gb|KDM80137.1| hypothetical protein DC24_14120 [Escherichia coli]
gb|KDM83042.1| hypothetical protein DC23_08225 [Escherichia coli O145:H28 str.
4865/96]
gb|KDM89178.1| hypothetical protein DC22_17070 [Escherichia coli]
gb|KDN05974.1| Protein ygiW precursor [Escherichia coli]
gb|KDO89286.1| hypothetical protein DO98_15680 [Escherichia coli]
gb|KDP17855.1| hypothetical protein EP08_25975 [Escherichia coli]
gb|KDS97709.1| protein ygiW [Escherichia coli 2-011-08_S3_C1]
gb|KDS98329.1| protein ygiW [Escherichia coli 2-011-08_S1_C3]
gb|KDT04720.1| protein ygiW [Escherichia coli 2-011-08_S4_C1]
gb|KDT11465.1| protein ygiW [Escherichia coli 2-052-05_S1_C3]
gb|KDT17416.1| protein ygiW [Escherichia coli 2-011-08_S4_C3]
gb|KDT17734.1| protein ygiW [Escherichia coli 2-052-05_S3_C1]
gb|KDT25903.1| protein ygiW [Escherichia coli 2-052-05_S4_C1]
gb|KDT34238.1| protein ygiW [Escherichia coli 3-105-05_S1_C1]
gb|KDT39092.1| protein ygiW [Escherichia coli 3-105-05_S3_C1]
gb|KDT46071.1| protein ygiW [Escherichia coli 3-105-05_S4_C2]
gb|KDT49998.1| protein ygiW [Escherichia coli 3-105-05_S3_C2]
gb|KDT56295.1| protein ygiW [Escherichia coli 3-105-05_S4_C3]
gb|KDT63359.1| protein ygiW [Escherichia coli 3-267-03_S1_C3]
gb|KDT68332.1| protein ygiW [Escherichia coli 3-267-03_S3_C1]
gb|KDT72132.1| protein ygiW [Escherichia coli 3-373-03_S3_C1]
gb|KDT76120.1| protein ygiW [Escherichia coli 3-373-03_S3_C3]
gb|KDT77969.1| protein ygiW [Escherichia coli 3-373-03_S1_C2]
gb|KDT87710.1| protein ygiW [Escherichia coli 3-475-03_S1_C1]
gb|KDT89257.1| protein ygiW [Escherichia coli 3-475-03_S4_C1]
gb|KDT93412.1| protein ygiW [Escherichia coli 3-105-05_S4_C1]
gb|KDT97868.1| protein ygiW [Escherichia coli 3-267-03_S3_C2]
gb|KDU05385.1| protein ygiW [Escherichia coli 3-267-03_S1_C2]
gb|KDU09786.1| protein ygiW [Escherichia coli 3-105-05_S3_C3]
gb|KDU13464.1| protein ygiW [Escherichia coli 3-373-03_S3_C2]
gb|KDU20399.1| protein ygiW [Escherichia coli 3-267-03_S1_C1]
gb|KDU27341.1| protein ygiW [Escherichia coli 3-267-03_S4_C2]
gb|KDU32526.1| protein ygiW [Escherichia coli 3-373-03_S4_C2]
gb|KDU36935.1| protein ygiW [Escherichia coli 3-373-03_S1_C3]
gb|KDU39733.1| protein ygiW [Escherichia coli 3-073-06_S4_C1]
gb|KDU44672.1| protein ygiW [Escherichia coli 3-373-03_S1_C1]
gb|KDU52192.1| protein ygiW [Escherichia coli 3-373-03_S4_C1]
gb|KDU56270.1| protein ygiW [Escherichia coli 3-475-03_S4_C2]
gb|KDU60896.1| protein ygiW [Escherichia coli 4-203-08_S1_C1]
gb|KDU67374.1| protein ygiW [Escherichia coli 4-203-08_S4_C3]
gb|KDV15629.1| hypothetical protein BW73_23845 [Escherichia coli O111:NM str.
01-3076]
gb|KDV19522.1| hypothetical protein BW72_17965 [Escherichia coli O78:H12 str.
00-3279]
gb|KDV33940.1| hypothetical protein BU59_15220 [Escherichia coli O69:H11 str.
07-3763]
gb|KDV41341.1| hypothetical protein BU55_23195 [Escherichia coli O146:H21 str.
2010C-3325]
gb|KDV44830.1| hypothetical protein BU53_07045 [Escherichia coli O91:H21 str.
2009C-3740]
gb|KDV53375.1| hypothetical protein BU57_17475 [Escherichia coli O121:H19 str.
2011C-3609]
gb|KDV58173.1| hypothetical protein BU54_08450 [Escherichia coli O45:H2 str.
2010C-4211]
gb|KDV63605.1| hypothetical protein BU64_16370 [Escherichia coli O128:H2 str.
2011C-3317]
gb|KDV69041.1| hypothetical protein BU58_17365 [Escherichia coli O26:H11 str.
2011C-3274]
gb|KDV74700.1| hypothetical protein BU63_22735 [Escherichia coli O118:H16 str.
07-4255]
gb|KDV80669.1| protein ygiW [Escherichia coli 2-052-05_S4_C2]
gb|KDV81139.1| protein ygiW [Escherichia coli 2-052-05_S3_C3]
gb|KDV83152.1| protein ygiW [Escherichia coli 2-052-05_S4_C3]
gb|KDV99153.1| protein ygiW [Escherichia coli 2-156-04_S3_C1]
gb|KDW00331.1| protein ygiW [Escherichia coli 2-156-04_S1_C3]
gb|KDW06515.1| protein ygiW [Escherichia coli 2-156-04_S3_C3]
gb|KDW14379.1| protein ygiW [Escherichia coli 2-177-06_S3_C1]
gb|KDW29469.1| protein ygiW [Escherichia coli 2-156-04_S3_C2]
gb|KDW30517.1| protein ygiW [Escherichia coli 2-177-06_S1_C2]
gb|KDW38790.1| protein ygiW [Escherichia coli 2-177-06_S1_C3]
gb|KDW46814.1| protein ygiW [Escherichia coli 2-177-06_S4_C2]
gb|KDW53879.1| protein ygiW [Escherichia coli 2-210-07_S1_C3]
gb|KDW60240.1| protein ygiW [Escherichia coli 2-005-03_S3_C1]
gb|KDW61059.1| protein ygiW [Escherichia coli 1-392-07_S3_C2]
gb|KDW68922.1| protein ygiW [Escherichia coli 2-005-03_S3_C3]
gb|KDW71134.1| protein ygiW [Escherichia coli 2-005-03_S4_C1]
gb|KDW75291.1| protein ygiW [Escherichia coli 1-392-07_S1_C1]
gb|KDW84348.1| protein ygiW [Escherichia coli 1-392-07_S1_C2]
gb|KDW90099.1| protein ygiW [Escherichia coli 2-210-07_S4_C1]
gb|KDW94480.1| protein ygiW [Escherichia coli 2-210-07_S1_C2]
gb|KDX02181.1| protein ygiW [Escherichia coli 2-210-07_S3_C2]
gb|KDX04432.1| protein ygiW [Escherichia coli 1-392-07_S3_C1]
gb|KDX08038.1| protein ygiW [Escherichia coli 2-177-06_S4_C3]
gb|KDX18304.1| protein ygiW [Escherichia coli 2-210-07_S3_C3]
gb|KDX31703.1| protein ygiW [Escherichia coli 1-250-04_S1_C2]
gb|KDX33429.1| protein ygiW [Escherichia coli 1-250-04_S1_C1]
gb|KDX39607.1| protein ygiW [Escherichia coli 2-156-04_S4_C3]
gb|KDX43973.1| protein ygiW [Escherichia coli 2-177-06_S3_C2]
gb|KDX52200.1| protein ygiW [Escherichia coli 2-177-06_S4_C1]
gb|KDX56628.1| protein ygiW [Escherichia coli 2-210-07_S3_C1]
gb|KDX60568.1| protein ygiW [Escherichia coli 2-210-07_S4_C2]
gb|KDX67000.1| protein ygiW [Escherichia coli 2-210-07_S4_C3]
gb|KDX69094.1| protein ygiW [Escherichia coli 2-222-05_S1_C1]
gb|KDX77002.1| protein ygiW [Escherichia coli 2-222-05_S1_C2]
gb|KDX80787.1| protein ygiW [Escherichia coli 2-222-05_S1_C3]
gb|KDX85988.1| protein ygiW [Escherichia coli 2-222-05_S3_C3]
gb|KDX94411.1| protein ygiW [Escherichia coli 2-222-05_S4_C2]
gb|KDX97043.1| protein ygiW [Escherichia coli 2-316-03_S3_C1]
gb|KDY01235.1| protein ygiW [Escherichia coli 2-316-03_S3_C2]
gb|KDY05812.1| protein ygiW [Escherichia coli 2-316-03_S3_C3]
gb|KDY11848.1| protein ygiW [Escherichia coli 2-316-03_S4_C1]
gb|KDY16862.1| protein ygiW [Escherichia coli 2-316-03_S4_C2]
gb|KDY24658.1| protein ygiW [Escherichia coli 2-427-07_S1_C2]
gb|KDY27755.1| protein ygiW [Escherichia coli 2-427-07_S3_C3]
gb|KDY34218.1| protein ygiW [Escherichia coli 2-427-07_S3_C1]
gb|KDY44938.1| protein ygiW [Escherichia coli 2-427-07_S4_C2]
gb|KDY46873.1| protein ygiW [Escherichia coli 2-427-07_S4_C1]
gb|KDY52582.1| protein ygiW [Escherichia coli 2-460-02_S3_C1]
gb|KDY60966.1| protein ygiW [Escherichia coli 2-460-02_S3_C2]
gb|KDY63301.1| protein ygiW [Escherichia coli 2-460-02_S3_C3]
gb|KDY71683.1| protein ygiW [Escherichia coli 2-460-02_S4_C2]
gb|KDY78837.1| protein ygiW [Escherichia coli 2-460-02_S4_C3]
gb|KDY80216.1| protein ygiW [Escherichia coli 2-474-04_S1_C1]
gb|KDY84770.1| protein ygiW [Escherichia coli 2-474-04_S3_C1]
gb|KDY88751.1| protein ygiW [Escherichia coli 2-427-07_S1_C3]
gb|KDY89912.1| protein ygiW [Escherichia coli 2-474-04_S3_C2]
gb|KDZ04608.1| protein ygiW [Escherichia coli 2-474-04_S1_C2]
gb|KDZ06079.1| protein ygiW [Escherichia coli 2-474-04_S4_C2]
gb|KDZ12073.1| protein ygiW [Escherichia coli 2-474-04_S4_C3]
gb|KDZ12494.1| protein ygiW [Escherichia coli 2-474-04_S3_C3]
gb|KDZ26148.1| protein ygiW [Escherichia coli 3-020-07_S1_C1]
gb|KDZ28920.1| protein ygiW [Escherichia coli 3-020-07_S1_C2]
gb|KDZ35032.1| protein ygiW [Escherichia coli 3-020-07_S1_C3]
gb|KDZ38650.1| protein ygiW [Escherichia coli 3-020-07_S3_C1]
gb|KDZ44798.1| protein ygiW [Escherichia coli 3-020-07_S4_C2]
gb|KDZ52870.1| protein ygiW [Escherichia coli 3-020-07_S4_C3]
gb|KDZ60012.1| protein ygiW [Escherichia coli 3-073-06_S3_C1]
gb|KDZ60892.1| protein ygiW [Escherichia coli 3-073-06_S3_C2]
gb|KDZ67247.1| protein ygiW [Escherichia coli 3-073-06_S1_C2]
gb|KDZ75598.1| protein ygiW [Escherichia coli 3-073-06_S4_C2]
gb|KDZ80931.1| protein ygiW [Escherichia coli 3-105-05_S1_C2]
gb|KDZ85479.1| protein ygiW [Escherichia coli 3-073-06_S4_C3]
gb|KDZ90809.1| protein ygiW [Escherichia coli 3-105-05_S1_C3]
gb|KDZ94663.1| protein ygiW [Escherichia coli 2-427-07_S1_C1]
gb|KEJ10377.1| protein ygiW [Escherichia coli 6-175-07_S1_C2]
gb|KEJ22990.1| protein ygiW [Escherichia coli 2-316-03_S1_C1]
gb|KEJ24493.1| protein ygiW [Escherichia coli 2-316-03_S1_C2]
gb|KEJ38173.1| protein ygiW [Escherichia coli 2-460-02_S1_C3]
gb|KEJ44795.1| protein ygiW [Escherichia coli 2-427-07_S4_C3]
gb|KEJ48173.1| protein ygiW [Escherichia coli 2-460-02_S4_C1]
gb|KEJ58650.1| protein ygiW [Escherichia coli 3-267-03_S4_C1]
gb|KEJ66274.1| protein ygiW [Escherichia coli 3-020-07_S3_C2]
gb|KEJ72777.1| protein ygiW [Escherichia coli 5-366-08_S1_C3]
gb|KEJ75779.1| protein ygiW [Escherichia coli 6-175-07_S3_C2]
gb|KEK79538.1| protein ygiW [Escherichia coli 3-475-03_S3_C1]
gb|KEK85208.1| protein ygiW [Escherichia coli 3-475-03_S1_C2]
gb|KEK92411.1| protein ygiW [Escherichia coli 4-203-08_S1_C2]
gb|KEK97638.1| protein ygiW [Escherichia coli 4-203-08_S1_C3]
gb|KEK97843.1| protein ygiW [Escherichia coli 4-203-08_S3_C3]
gb|KEL08958.1| protein ygiW [Escherichia coli 4-203-08_S3_C2]
gb|KEL13473.1| protein ygiW [Escherichia coli 4-203-08_S4_C2]
gb|KEL19599.1| protein ygiW [Escherichia coli 4-203-08_S3_C1]
gb|KEL27746.1| protein ygiW [Escherichia coli 5-172-05_S4_C2]
gb|KEL28006.1| protein ygiW [Escherichia coli 3-373-03_S4_C3]
gb|KEL32551.1| protein ygiW [Escherichia coli 5-366-08_S4_C2]
gb|KEL39333.1| protein ygiW [Escherichia coli 5-172-05_S4_C1]
gb|KEL43367.1| protein ygiW [Escherichia coli 5-172-05_S3_C3]
gb|KEL51264.1| protein ygiW [Escherichia coli 6-175-07_S1_C1]
gb|KEL56561.1| protein ygiW [Escherichia coli 5-172-05_S3_C1]
gb|KEL60897.1| protein ygiW [Escherichia coli 5-172-05_S1_C3]
gb|KEL61867.1| protein ygiW [Escherichia coli 5-172-05_S4_C3]
gb|KEL69664.1| protein ygiW [Escherichia coli 5-366-08_S1_C1]
gb|KEL76620.1| protein ygiW [Escherichia coli 5-366-08_S3_C3]
gb|KEL87194.1| protein ygiW [Escherichia coli 5-366-08_S3_C2]
gb|KEL90627.1| protein ygiW [Escherichia coli 6-175-07_S3_C1]
gb|KEL92857.1| protein ygiW [Escherichia coli 5-366-08_S3_C1]
gb|KEM04239.1| protein ygiW [Escherichia coli 6-175-07_S4_C2]
gb|KEM05473.1| protein ygiW [Escherichia coli 6-175-07_S4_C1]
gb|KEM12345.1| protein ygiW [Escherichia coli 6-319-05_S1_C2]
gb|KEM19958.1| protein ygiW [Escherichia coli 6-319-05_S3_C1]
gb|KEM25252.1| protein ygiW [Escherichia coli 6-319-05_S1_C3]
gb|KEM28637.1| protein ygiW [Escherichia coli 6-319-05_S3_C2]
gb|KEM38862.1| protein ygiW [Escherichia coli 6-537-08_S1_C1]
gb|KEM46649.1| protein ygiW [Escherichia coli 6-175-07_S4_C3]
gb|KEM51256.1| protein ygiW [Escherichia coli 6-175-07_S1_C3]
gb|KEM59675.1| protein ygiW [Escherichia coli 6-319-05_S3_C3]
gb|KEM60989.1| protein ygiW [Escherichia coli 7-233-03_S1_C2]
gb|KEM71231.1| protein ygiW [Escherichia coli 7-233-03_S3_C1]
gb|KEM74508.1| protein ygiW [Escherichia coli 6-537-08_S3_C1]
gb|KEM82063.1| protein ygiW [Escherichia coli 6-537-08_S3_C3]
gb|KEM88332.1| protein ygiW [Escherichia coli 2-222-05_S4_C1]
gb|KEM89840.1| protein ygiW [Escherichia coli 6-537-08_S4_C1]
gb|KEM99121.1| protein ygiW [Escherichia coli 7-233-03_S1_C3]
gb|KEN00822.1| protein ygiW [Escherichia coli 6-319-05_S1_C1]
gb|KEN05425.1| protein ygiW [Escherichia coli 7-233-03_S3_C3]
gb|KEN11390.1| protein ygiW [Escherichia coli 7-233-03_S4_C2]
gb|KEN15987.1| protein ygiW [Escherichia coli 6-537-08_S3_C2]
gb|KEN22953.1| protein ygiW [Escherichia coli 7-233-03_S3_C2]
gb|KEN46159.1| protein ygiW [Escherichia coli 6-537-08_S1_C2]
gb|KEN52933.1| protein ygiW [Escherichia coli 6-537-08_S1_C3]
gb|KEN61798.1| protein ygiW [Escherichia coli 6-537-08_S4_C2]
gb|KEN65210.1| protein ygiW [Escherichia coli 1-392-07_S4_C3]
gb|KEN75335.1| protein ygiW [Escherichia coli 2-052-05_S3_C2]
gb|KEN83513.1| protein ygiW [Escherichia coli 2-474-04_S4_C1]
gb|KEN88302.1| protein ygiW [Escherichia coli 2-222-05_S3_C1]
gb|KEN95768.1| protein ygiW [Escherichia coli 2-222-05_S3_C2]
gb|KEN97813.1| protein ygiW [Escherichia coli 1-392-07_S4_C1]
gb|KEO08050.1| protein ygiW [Escherichia coli 2-177-06_S3_C3]
gb|KEO14807.1| protein ygiW [Escherichia coli 2-222-05_S4_C3]
gb|KEO22467.1| protein ygiW [Escherichia coli 5-366-08_S4_C1]
gb|KEO27925.1| protein ygiW [Escherichia coli 2-460-02_S1_C1]
gb|KEO29550.1| protein ygiW [Escherichia coli 1-250-04_S3_C2]
gb|KEO37798.1| protein ygiW [Escherichia coli 2-460-02_S1_C2]
gb|KEO97069.1| hypothetical protein EH66_02905 [Escherichia coli]
gb|KEP09267.1| hypothetical protein EH62_05690 [Escherichia coli]
gb|KEP17378.1| hypothetical protein EH63_18795 [Escherichia coli]
gb|KEP19441.1| hypothetical protein EH61_04890 [Escherichia coli]
gb|KEP78009.1| hypothetical protein AU08_0216230 [Escherichia coli E1140]
gb|AIF38331.1| hypothetical protein HQ24_15585 [Escherichia coli KLY]
gb|AIF63725.1| hypothetical protein L960_3902 [Escherichia coli B7A]
emb|CDU33682.1| Putative uncharacterized protein ygiW [Escherichia coli D6-113.11]
emb|CDU41091.1| Putative uncharacterized protein ygiW [Escherichia coli]
gb|AIF95572.1| Protein ygiW precursor [Escherichia coli O157:H7 str. SS17]
gb|AIG70395.1| Protein ygiW precursor [Escherichia coli O157:H7 str. EDL933]
gb|KFB96365.1| YgiW family protein [Escherichia coli DSM 30083 = JCM 1649 = ATCC
11775]
gb|KFD77752.1| hypothetical protein JD73_01030 [Escherichia coli]
gb|KFF38288.1| hypothetical protein BC97_0200755 [Escherichia coli]
gb|KFF53139.1| hypothetical protein BC99_0302610 [Escherichia coli]
gb|KFH76697.1| hypothetical protein GR04_18500 [Escherichia coli]
gb|KFH79229.1| hypothetical protein GR05_17645 [Escherichia coli]
gb|KFH84540.1| hypothetical protein GR03_10370 [Escherichia coli]
gb|KFH89492.1| hypothetical protein GR06_17090 [Escherichia coli]
gb|KFH96397.1| hypothetical protein GR07_05885 [Escherichia coli]
gb|KFH98253.1| hypothetical protein GR02_17265 [Escherichia coli]
gb|KFV23461.1| hypothetical protein GS40_03230 [Escherichia coli]
gb|KFV25008.1| hypothetical protein GS37_18315 [Escherichia coli]
gb|KFV32945.1| hypothetical protein GS38_24380 [Escherichia coli]
gb|KFV38455.1| hypothetical protein GS39_17945 [Escherichia coli]
emb|CEE07723.1| protein ygiW [Escherichia coli]
gb|AIN33375.1| hydrogen peroxide and cadmium resistance periplasmic protein;
stress-induced OB-fold protein [Escherichia coli
BW25113]
gb|KGA86360.1| hypothetical protein KV39_13440 [Escherichia coli]
emb|CDY61579.1| stress-induced protein [Escherichia coli]
emb|CDZ21808.1| stress-induced protein [Escherichia coli]
gb|KGI48683.1| Protein ygiW precursor [Escherichia coli]
gb|AIT36199.1| hypothetical protein LI75_18870 [Escherichia coli FAP1]
gb|KGL71273.1| hypothetical protein L670_04561 [Escherichia coli NCTC 50110]
gb|KGM62288.1| putative uncharacterized protein YgiW [Escherichia coli G3/10]
gb|KGM66379.1| putative uncharacterized protein YgiW [Escherichia coli]
gb|KGM72051.1| putative uncharacterized protein YgiW [Escherichia coli]
gb|KGM75941.1| putative uncharacterized protein YgiW [Escherichia coli]
gb|KGM83671.1| putative uncharacterized protein YgiW [Escherichia coli]
gb|KGM85602.1| putative uncharacterized protein YgiW [Escherichia coli]
gb|KGP12218.1| hypothetical protein JQ58_14760 [Escherichia coli]
gb|KGP13101.1| hypothetical protein JQ57_07195 [Escherichia coli]
gb|KGP18919.1| hypothetical protein JQ56_13380 [Escherichia coli]
gb|KGP39194.1| hypothetical protein JQ59_13565 [Escherichia coli]
gb|KGP48898.1| hypothetical protein LS89_14540 [Escherichia coli]
gb|KGP51552.1| hypothetical protein LS90_14350 [Escherichia coli]
gb|KGT07107.1| hypothetical protein GY32_04625 [Escherichia coli]
gb|KGT13087.1| hypothetical protein JO89_13685 [Escherichia coli]
gb|KGT16686.1| hypothetical protein JO90_21860 [Escherichia coli]
gb|KGT21477.1| hypothetical protein JO87_06135 [Escherichia coli]
gb|KGT28114.1| hypothetical protein JO88_05530 [Escherichia coli]
gb|KGT29819.1| hypothetical protein JO86_18650 [Escherichia coli]
gb|AIX64988.1| hypothetical protein ECONIH1_17980 [Escherichia coli]
gb|KHD39457.1| hypothetical protein LS39_13705 [Escherichia coli]
gb|KHD51285.1| hypothetical protein LS41_09465 [Escherichia coli]
gb|KHD52188.1| hypothetical protein LS40_11810 [Escherichia coli]
gb|KHD55463.1| hypothetical protein LS42_17455 [Escherichia coli]
gb|KHG73802.1| hypothetical protein PU77_13815 [Escherichia coli]
gb|KHG81462.1| hypothetical protein PU76_09665 [Escherichia coli]
gb|KHG83411.1| hypothetical protein PU75_07915 [Escherichia coli]
gb|KHG89905.1| hypothetical protein PU74_04280 [Escherichia coli]
gb|KHG97530.1| hypothetical protein PU73_03805 [Escherichia coli]
gb|KHG98360.1| hypothetical protein PU72_11700 [Escherichia coli]
gb|KHH05181.1| hypothetical protein PU71_04785 [Escherichia coli]
gb|KHH09559.1| hypothetical protein PU69_08505 [Escherichia coli]
gb|KHH14215.1| hypothetical protein PU68_15550 [Escherichia coli]
gb|KHH19937.1| hypothetical protein PU63_13155 [Escherichia coli]
gb|KHH23959.1| hypothetical protein PU67_01320 [Escherichia coli]
gb|KHH28175.1| hypothetical protein PU60_24875 [Escherichia coli]
gb|KHH32146.1| hypothetical protein PU62_05985 [Escherichia coli]
gb|KHH33034.1| hypothetical protein PU61_10255 [Escherichia coli]
gb|KHH45172.1| hypothetical protein PU59_03960 [Escherichia coli]
gb|KHH48183.1| hypothetical protein PU58_04575 [Escherichia coli]
gb|KHH55622.1| hypothetical protein PU56_04495 [Escherichia coli]
gb|KHH58045.1| hypothetical protein PU57_04925 [Escherichia coli]
gb|KHH64814.1| hypothetical protein PU55_02475 [Escherichia coli]
gb|KHH69198.1| hypothetical protein PU54_02460 [Escherichia coli]
gb|KHH70168.1| hypothetical protein PU52_10785 [Escherichia coli]
gb|KHH83396.1| hypothetical protein PU50_05080 [Escherichia coli]
gb|KHH85246.1| hypothetical protein PU49_06960 [Escherichia coli]
gb|KHH85733.1| hypothetical protein PU51_02980 [Escherichia coli]
gb|KHH94653.1| hypothetical protein PU47_01525 [Escherichia coli]
gb|KHH97235.1| hypothetical protein PU46_03120 [Escherichia coli]
gb|KHH99449.1| hypothetical protein PU44_20425 [Escherichia coli]
gb|KHI02899.1| hypothetical protein PU48_09785 [Escherichia coli]
gb|KHI11943.1| hypothetical protein PU43_01745 [Escherichia coli]
gb|KHI12950.1| hypothetical protein PU36_19720 [Escherichia coli]
gb|KHI20868.1| hypothetical protein PU35_20385 [Escherichia coli]
gb|KHI21754.1| hypothetical protein PU40_01210 [Escherichia coli]
gb|KHI34143.1| hypothetical protein PU34_01255 [Escherichia coli]
gb|KHI34547.1| hypothetical protein PU32_20155 [Escherichia coli]
gb|KHI42745.1| hypothetical protein PU31_15575 [Escherichia coli]
gb|KHI44841.1| hypothetical protein PU27_18120 [Escherichia coli]
gb|KHI58206.1| hypothetical protein PU24_02600 [Escherichia coli]
gb|KHI59585.1| hypothetical protein PU26_12110 [Escherichia coli]
gb|KHI62394.1| hypothetical protein PU22_08440 [Escherichia coli]
gb|KHI66230.1| hypothetical protein PU20_18570 [Escherichia coli]
gb|KHI73486.1| hypothetical protein PU19_08290 [Escherichia coli]
gb|KHI77634.1| hypothetical protein PU18_20620 [Escherichia coli]
gb|KHI78060.1| hypothetical protein PU16_14295 [Escherichia coli]
gb|KHI85766.1| hypothetical protein PU15_25960 [Escherichia coli]
gb|KHI87725.1| hypothetical protein PU14_13115 [Escherichia coli]
gb|KHI98141.1| hypothetical protein PU11_17825 [Escherichia coli]
gb|KHJ01376.1| hypothetical protein PU12_06115 [Escherichia coli]
gb|KHJ09314.1| hypothetical protein PU08_05830 [Escherichia coli]
gb|KHJ10820.1| hypothetical protein PU10_19535 [Escherichia coli]
gb|KHJ12829.1| hypothetical protein PU06_26400 [Escherichia coli]
gb|KHJ26484.1| hypothetical protein PU03_07995 [Escherichia coli]
gb|KHJ29810.1| hypothetical protein PU04_00885 [Escherichia coli]
gb|AIZ29493.1| hypothetical protein ER2796_3114 [Escherichia coli ER2796]
gb|AIZ52818.1| hypothetical protein ER3413_3114 [Escherichia coli K-12]
gb|AIZ84091.1| hypothetical protein HW42_19965 [Escherichia coli]
gb|AIZ88669.1| hypothetical protein HW43_20050 [Escherichia coli]
gb|AIZ89953.1| hypothetical protein EO53_02665 [Escherichia coli str. K-12 substr.
MG1655]
gb|AJA28027.1| Protein ygiW precursor [Escherichia coli O157:H7 str. SS52]
gb|KHO60471.1| hypothetical protein RT53_01535 [Escherichia coli]
emb|CEK06897.1| conserved hypothetical protein [Escherichia coli O26:H11]
gb|AJB36244.1| hypothetical protein L282_1261 [Escherichia coli APEC IMT5155]
gb|AJB53069.1| hypothetical protein RR31_15890 [Escherichia coli]
emb|CCQ30549.2| hypothetical protein HUS2011_3671 [Escherichia coli]
gb|KIE68167.1| hypothetical protein GT41_10975 [Escherichia coli]
gb|KIE72521.1| hypothetical protein EP21_25020 [Escherichia coli]
gb|KIE77989.1| hypothetical protein GT42_11175 [Escherichia coli]
gb|KIE82190.1| hypothetical protein SC80_09035 [Escherichia coli RS218]
gb|KIG24116.1| hypothetical protein ECC69171_24970 [Escherichia coli C691-71
(14b)]
gb|KIG29439.1| hypothetical protein PU66_23465 [Escherichia coli]
gb|KIG39993.1| hypothetical protein PU64_19850 [Escherichia coli]
gb|KIG43733.1| hypothetical protein PU65_07440 [Escherichia coli]
gb|KIG48972.1| hypothetical protein PU45_24205 [Escherichia coli]
gb|KIG51224.1| hypothetical protein PU53_15390 [Escherichia coli]
gb|KIG58095.1| hypothetical protein PU42_17390 [Escherichia coli]
gb|KIG65839.1| hypothetical protein PU41_21135 [Escherichia coli]
gb|KIG68813.1| hypothetical protein PU39_03850 [Escherichia coli]
gb|KIG75020.1| hypothetical protein PU38_24675 [Escherichia coli]
gb|KIG78874.1| hypothetical protein PU37_02885 [Escherichia coli]
gb|KIG86930.1| hypothetical protein PU30_13320 [Escherichia coli]
gb|KIG91398.1| hypothetical protein PU29_10050 [Escherichia coli]
gb|KIH00373.1| hypothetical protein PU25_13945 [Escherichia coli]
gb|KIH00652.1| hypothetical protein PU23_02545 [Escherichia coli]
gb|KIH04983.1| hypothetical protein PU21_12695 [Escherichia coli]
gb|KIH13881.1| hypothetical protein PU17_13895 [Escherichia coli]
gb|KIH16238.1| hypothetical protein PU09_01675 [Escherichia coli]
gb|KIH24627.1| hypothetical protein PU13_16240 [Escherichia coli]
gb|KIH27436.1| hypothetical protein PU05_08335 [Escherichia coli]
gb|KIH29927.1| hypothetical protein PU07_04045 [Escherichia coli]
gb|KIH35127.1| hypothetical protein PD07_15935 [Escherichia coli]
gb|AJE57585.1| protein YgiW precursor [Escherichia coli]
gb|KII09706.1| hypothetical protein LS43_06760 [Escherichia coli]
gb|AJF57847.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli 1303]
gb|AJF78155.1| hypothetical protein TH69_15075 [Escherichia coli]
gb|KIN85616.1| hypothetical protein PU28_13185 [Escherichia coli]
gb|AJG10049.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli ECC-1470]
gb|KIO40599.1| hypothetical protein SU67_11240 [Escherichia coli O139:H28 str.
E24377A]
gb|AJH11671.1| hypothetical protein SR36_14870 [Escherichia coli]
gb|KIO84862.1| TIGR00156 family protein [Escherichia coli 97.0264]
gb|KIQ43087.1| hypothetical protein IY33_00390 [Escherichia coli]
gb|KIQ46584.1| hypothetical protein IY32_10155 [Escherichia coli]
gb|AJM75247.1| hypothetical protein W817_17220 [Escherichia coli RS218]
gb|AJO85103.1| hypothetical protein SY51_17500 [Escherichia coli]
gb|KIY28007.1| hypothetical protein TB57_14300 [Escherichia coli]
gb|KIZ08211.1| hypothetical protein UC39_26760 [Escherichia coli]
gb|KIZ58895.1| hypothetical protein UH28_18365 [Escherichia coli]
gb|KIZ65724.1| hypothetical protein UH34_08435 [Escherichia coli]
gb|KIZ72249.1| hypothetical protein UH35_16695 [Escherichia coli]
gb|KIZ77412.1| hypothetical protein UH32_14100 [Escherichia coli]
gb|KIZ81102.1| hypothetical protein UH29_20505 [Escherichia coli]
gb|KIZ87409.1| hypothetical protein UH37_14540 [Escherichia coli]
gb|KIZ89951.1| hypothetical protein UH33_20020 [Escherichia coli]
gb|KIZ96146.1| hypothetical protein UH36_16975 [Escherichia coli]
gb|KJA04294.1| hypothetical protein UH27_02500 [Escherichia coli]
gb|KJA05681.1| hypothetical protein UH30_16130 [Escherichia coli]
gb|KJD60911.1| hypothetical protein LT79_21625 [Escherichia coli]
gb|KJD66193.1| hypothetical protein LP50_21085 [Escherichia coli]
gb|KJD75104.1| hypothetical protein LR66_17125 [Escherichia coli]
gb|KJD75420.1| hypothetical protein LR67_20295 [Escherichia coli]
gb|KJD83686.1| hypothetical protein LR65_07900 [Escherichia coli]
gb|KJD93490.1| hypothetical protein LV67_00255 [Escherichia coli]
gb|KJD93723.1| hypothetical protein LV68_12440 [Escherichia coli]
gb|KJG99144.1| hypothetical protein UC40_03980 [Escherichia coli]
gb|KJH04111.1| hypothetical protein TS82_03140 [Escherichia coli]
gb|KJH07281.1| hypothetical protein UC41_12800 [Escherichia coli]
gb|KJI02219.1| hypothetical protein UO94_16260 [Escherichia coli]
gb|KJI11122.1| hypothetical protein UO92_09945 [Escherichia coli]
gb|KJI14222.1| hypothetical protein UO95_23155 [Escherichia coli]
gb|KJJ46449.1| hypothetical protein VM92_13600 [Escherichia coli]
gb|KJJ67568.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|KJJ80341.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|KJW28552.1| hypothetical protein UN87_20395 [Escherichia coli]
gb|KJW29088.1| hypothetical protein UN88_06275 [Escherichia coli]
gb|KJW31585.1| hypothetical protein UN86_16245 [Escherichia coli]
gb|KJW42052.1| hypothetical protein UN89_08555 [Escherichia coli]
gb|KJW48427.1| hypothetical protein UN91_14800 [Escherichia coli]
gb|KJW52859.1| hypothetical protein UN90_04210 [Escherichia coli]
gb|KJW57086.1| hypothetical protein UN92_16520 [Escherichia coli]
gb|KJW73313.1| hypothetical protein UN95_15695 [Escherichia coli]
gb|KJY13537.1| hypothetical protein UC21_01545 [Escherichia coli]
gb|AKA92211.1| protein YgiW [Escherichia coli VR50]
emb|CQR82455.1| hypothetical protein b3024 [Escherichia coli K-12]
gb|KKA58619.1| TIGR00156 family protein [Escherichia coli 9.1649]
gb|KKB20801.1| hypothetical protein VP69_02705 [Escherichia coli]
gb|KKB21843.1| hypothetical protein VP68_12150 [Escherichia coli]
gb|AKC14810.1| hypothetical protein VK74_20220 [Escherichia coli]
gb|AKD62483.1| hypothetical protein SH05_19395 [Escherichia coli K-12]
gb|AKD66856.1| hypothetical protein SH02_19350 [Escherichia coli K-12]
gb|AKD71211.1| hypothetical protein SH08_19390 [Escherichia coli K-12]
gb|AKD75577.1| hypothetical protein SH03_19290 [Escherichia coli K-12]
gb|AKD79986.1| hypothetical protein SH06_19595 [Escherichia coli K-12]
gb|AKD84355.1| hypothetical protein SH04_19280 [Escherichia coli K-12]
gb|AKD88712.1| hypothetical protein SH07_19285 [Escherichia coli K-12]
gb|AKD93142.1| hypothetical protein SF31_19635 [Escherichia coli K-12]
gb|KKF77810.1| hypothetical protein XE90_13060 [Escherichia coli O157:H7]
gb|KKF83650.1| hypothetical protein XF37_12295 [Escherichia coli O157:H7]
gb|KKJ11274.1| hypothetical protein T638_20660 [Escherichia coli MRSN 10204]
gb|AKE82683.1| hypothetical protein AAF13_00470 [Escherichia coli O104:H4 str.
C227-11]
gb|KKK00660.1| hypothetical protein CR63_15085 [Escherichia coli NB8]
gb|KKK31476.1| hypothetical protein WY12_17830 [Escherichia coli]
gb|KKO26573.1| hypothetical protein XA43_11035 [Escherichia coli]
gb|KKO31626.1| hypothetical protein XA40_04930 [Escherichia coli]
gb|KKO33211.1| hypothetical protein XA41_14505 [Escherichia coli]
gb|KKO39812.1| hypothetical protein XA44_05320 [Escherichia coli]
gb|AKF22230.1| hypothetical protein DP32_17955 [Escherichia coli]
gb|AKF56805.1| hydrogen peroxide and cadmium resistance periplasmic protein,
stress-induced OB-fold protein [Escherichia coli]
gb|AKF60945.1| hydrogen peroxide and cadmium resistance periplasmic protein,
stress-induced OB-fold protein [Escherichia coli]
gb|AKF65083.1| hydrogen peroxide and cadmium resistance periplasmic protein,
stress-induced OB-fold protein [Escherichia coli]
gb|AKF69223.1| hydrogen peroxide and cadmium resistance periplasmic protein,
stress-induced OB-fold protein [Escherichia coli]
gb|AKF73362.1| hydrogen peroxide and cadmium resistance periplasmic protein,
stress-induced OB-fold protein [Escherichia coli]
gb|KKY46142.1| hypothetical protein AAY45_17940 [Escherichia coli O157:H7]
gb|AKH23717.1| hypothetical protein AA102_07200 [Escherichia coli]
gb|KLD46169.1| hypothetical protein XB01_14140 [Escherichia coli]
gb|KLD52724.1| hypothetical protein XB00_04990 [Escherichia coli]
gb|KLG34123.1| hypothetical protein WQ65_04005 [Escherichia coli]
gb|KLG37197.1| hypothetical protein WQ86_07005 [Escherichia coli]
gb|KLG42985.1| hypothetical protein WQ92_09095 [Escherichia coli]
gb|KLG45515.1| hypothetical protein WR16_12975 [Escherichia coli]
gb|KLG54714.1| hypothetical protein WQ74_06235 [Escherichia coli]
gb|KLG57556.1| hypothetical protein WQ68_04935 [Escherichia coli]
gb|KLG61287.1| hypothetical protein WQ95_12895 [Escherichia coli]
gb|KLG67663.1| hypothetical protein WR00_10185 [Escherichia coli]
gb|KLG73791.1| hypothetical protein WR24_04155 [Escherichia coli]
gb|KLG80386.1| hypothetical protein WR12_00660 [Escherichia coli]
gb|KLG84375.1| hypothetical protein WR01_04260 [Escherichia coli]
gb|KLG89286.1| hypothetical protein WQ77_10505 [Escherichia coli]
gb|KLG89974.1| hypothetical protein WR05_18140 [Escherichia coli]
gb|KLG98702.1| hypothetical protein WR03_11820 [Escherichia coli]
gb|KLH03370.1| hypothetical protein WQ88_19955 [Escherichia coli]
gb|KLH06094.1| hypothetical protein WQ71_06165 [Escherichia coli]
gb|KLH16107.1| hypothetical protein WR23_04945 [Escherichia coli]
gb|KLH16448.1| hypothetical protein WQ72_15810 [Escherichia coli]
gb|KLH22111.1| hypothetical protein WR13_14915 [Escherichia coli]
gb|KLH28361.1| hypothetical protein WR17_11680 [Escherichia coli]
gb|KLH34487.1| hypothetical protein WQ69_15485 [Escherichia coli]
gb|KLH34656.1| hypothetical protein WQ96_13685 [Escherichia coli]
gb|KLH45881.1| hypothetical protein WQ84_00660 [Escherichia coli]
gb|KLH49763.1| hypothetical protein WQ99_13605 [Escherichia coli]
gb|KLH50072.1| hypothetical protein WQ70_15325 [Escherichia coli]
gb|KLH61453.1| hypothetical protein WQ64_01040 [Escherichia coli]
gb|KLH68778.1| hypothetical protein WQ66_16770 [Escherichia coli]
gb|KLH69169.1| hypothetical protein WQ79_06920 [Escherichia coli]
gb|KLH74730.1| hypothetical protein WQ73_01285 [Escherichia coli]
gb|KLH78041.1| hypothetical protein WR19_17575 [Escherichia coli]
gb|KLH87387.1| hypothetical protein WR04_05345 [Escherichia coli]
gb|KLH90965.1| hypothetical protein WQ91_04595 [Escherichia coli]
gb|KLH92991.1| hypothetical protein WR18_14815 [Escherichia coli]
gb|AKI67917.1| hypothetical protein ABE81_16240 [Shigella boydii]
gb|AKK49865.1| hypothetical protein PPECC33_03346 [Escherichia coli PCN033]
gb|AKK44199.1| hypothetical protein NMECO18_16165 [Escherichia coli]
gb|AKM36540.1| hypothetical protein PCN061_3073 [Escherichia coli PCN061]
gb|KLU97094.1| hypothetical protein N621_06195 [Escherichia coli]
gb|KLW97330.1| protein YgiW [Escherichia coli]
gb|KLW97794.1| protein YgiW [Escherichia coli]
gb|KLX02850.1| protein YgiW [Escherichia coli]
gb|KLX21244.1| protein YgiW [Escherichia coli]
gb|KLX26980.1| protein YgiW [Escherichia coli]
gb|KLX31359.1| protein YgiW [Escherichia coli]
gb|KLX34363.1| protein YgiW [Escherichia coli]
gb|KLX53435.1| protein YgiW [Escherichia coli]
gb|KLX57990.1| protein YgiW [Escherichia coli]
gb|KLX64014.1| protein YgiW [Escherichia coli]
gb|KLX69614.1| protein YgiW [Escherichia coli]
gb|KLX73465.1| protein YgiW [Escherichia coli]
gb|KLX74114.1| protein YgiW [Escherichia coli]
gb|KLX82264.1| protein YgiW [Escherichia coli]
gb|KLX86577.1| protein YgiW [Escherichia coli]
gb|KLX93414.1| protein YgiW [Escherichia coli]
gb|KLX94930.1| protein YgiW [Escherichia coli]
gb|KLY00415.1| protein YgiW [Escherichia coli]
gb|KLY05958.1| protein YgiW [Escherichia coli]
gb|KME67593.1| protein YgiW [Escherichia coli]
gb|AKN48910.1| hypothetical protein TZ57_14940 [Escherichia coli]
gb|AKO58499.1| hypothetical protein AA953_21950 [Escherichia coli]
gb|AKP85932.1| hypothetical protein J444_3249 [Escherichia coli ACN001]
gb|KMV38293.1| hypothetical protein ACM16_16605 [Escherichia coli]
gb|KMV43516.1| hypothetical protein ACM17_17175 [Escherichia coli]
gb|KMV46536.1| hypothetical protein ACM18_16250 [Escherichia coli]
gb|KMV48336.1| hypothetical protein ACM19_16605 [Escherichia coli]
gb|KMV61460.1| hypothetical protein ACM20_16875 [Escherichia coli]
gb|EEH85525.2| protein ygiW [Escherichia sp. 3_2_53FAA]
gb|AKR21852.1| hypothetical protein ADS71_15520 [Escherichia coli]
gb|AKR26207.1| hypothetical protein ADZ27_15520 [Escherichia coli]
gb|AKR30670.1| hypothetical protein ADZ28_15520 [Escherichia coli]
gb|KNA43085.1| OB fold protein [Escherichia coli M114]
emb|CTD12281.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD03301.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD00017.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP63604.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC86463.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR96644.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC87643.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR44142.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO96183.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ54406.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ66119.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP33165.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP15827.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG41187.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC77464.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP56292.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG33486.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ51391.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE95271.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP55005.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE35568.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC76008.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ38279.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ43603.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN94198.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR66004.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH26415.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP15482.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR26594.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO20893.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ91538.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR04394.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE59794.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE30003.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE69756.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN89170.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE41983.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ10234.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN85002.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ03342.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR45334.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN95608.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO91248.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG34856.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF10644.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF14441.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO15203.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE99066.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ86345.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP14350.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO83546.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ64124.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ93933.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE53100.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ16865.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE82678.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR23047.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC73158.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR26707.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ98932.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ31610.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE74835.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF75878.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE80974.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF71218.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG30465.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS82255.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF06779.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO62968.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE70624.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ21662.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR97500.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE76314.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP33501.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ56423.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO42366.1| Protein ygiW precursor [Shigella sonnei]
emb|CST53426.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO63755.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF89815.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ91012.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP15322.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG38949.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN77955.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP83133.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR41233.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR15347.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR66994.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM61732.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ72622.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO26124.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM66438.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO98605.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP01123.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE32829.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO00467.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO31378.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO86819.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO14341.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK86147.1| Protein ygiW precursor [Shigella sonnei]
emb|CST51821.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR58171.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE49303.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE92575.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM92835.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO52052.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP25229.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO71550.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN75799.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP14380.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU07909.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ36789.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO64032.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO73406.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ41247.1| Protein ygiW precursor [Shigella sonnei]
emb|CST34036.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP41048.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM88193.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF89248.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ14266.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ43331.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP81091.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK00378.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ63204.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR39610.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS65951.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR82788.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ15805.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS96257.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW48734.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO67074.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM58250.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE80156.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL65989.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE99030.1| Protein ygiW precursor [Shigella sonnei]
emb|CTP65494.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF28857.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU79759.1| Protein ygiW precursor [Shigella sonnei]
emb|CST11862.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS58418.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV67845.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL53488.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF46136.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF15296.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV57884.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO02703.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL51253.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO72160.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS82027.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ17308.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO62665.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU08165.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE34513.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP73384.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR71093.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS78130.1| Protein ygiW precursor [Shigella sonnei]
emb|CST83451.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF23486.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO37385.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR39490.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR87585.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV37470.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF45138.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF39455.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG58683.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN24937.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP76015.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO78640.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM05980.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI92312.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW66837.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE30512.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV07243.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC43234.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF03526.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC50047.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX26197.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF59332.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ72736.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA13880.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW54872.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL48356.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR46434.1| Protein ygiW precursor [Shigella sonnei]
emb|CST04036.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU66196.1| Protein ygiW precursor [Shigella sonnei]
emb|CTP67328.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF63288.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR74197.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR30005.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS31273.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF55813.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL86965.1| Protein ygiW precursor [Shigella sonnei]
emb|CST61411.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR90087.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN25097.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ51614.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL59782.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY68200.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU69306.1| Protein ygiW precursor [Shigella sonnei]
emb|CST63784.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG85102.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV22335.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV20912.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU93228.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL74015.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW86588.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI99144.1| Protein ygiW precursor [Shigella sonnei]
emb|CST01150.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW96084.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR76438.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY11310.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU35486.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR05123.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL29255.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW25901.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR72461.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX90582.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ53128.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO16022.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF34509.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX07773.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV23196.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ38178.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK35101.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS44028.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV02749.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL43059.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU12842.1| Protein ygiW precursor [Shigella sonnei]
emb|CTP65290.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI66131.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO10050.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW71385.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG87201.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX78586.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK61503.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS28099.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ87862.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL26041.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV78325.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU69627.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ76864.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF50534.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU18666.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX28586.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL29856.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ23495.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX04194.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK32510.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE55381.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR66062.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN00421.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL81910.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS23611.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV09284.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV36401.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ47590.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX82902.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ76549.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ66261.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK70325.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY07962.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI04685.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ17064.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU86437.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ66574.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI85866.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL13529.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB07448.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU32933.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR41482.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM13677.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR25300.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK23906.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU34070.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI63496.1| Protein ygiW precursor [Shigella sonnei]
emb|CST94676.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL02317.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK40811.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL28591.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS40944.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK69800.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX27312.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU06405.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ07349.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ75220.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX24928.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV35666.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL63207.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX30065.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF72617.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA79275.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU78394.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR54583.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH39213.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR28572.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL16210.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL60183.1| Protein ygiW precursor [Shigella sonnei]
emb|CST73084.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV27398.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB49997.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ24635.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ93424.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF14438.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ83184.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU59618.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW21402.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX79472.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV34959.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX32756.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI51726.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ92393.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ59219.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY32034.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ38860.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX83234.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF50008.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG46649.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV20072.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM50485.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR16515.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB70284.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC40687.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY24306.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU66268.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ89725.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY75146.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB31274.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV68558.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX98502.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV78993.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM24270.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ74040.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX83380.1| Protein ygiW precursor [Shigella sonnei]
emb|CSF14033.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ35841.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH04590.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ65565.1| Protein ygiW precursor [Shigella sonnei]
emb|CST78445.1| Protein ygiW precursor [Shigella sonnei]
emb|CSE93092.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI76527.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL81028.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD73411.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL78093.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV35134.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ24981.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS37341.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY36509.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG84225.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI61352.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU75779.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM19795.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU76025.1| Protein ygiW precursor [Shigella sonnei]
emb|CSN66584.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS34985.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV41433.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM00444.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH72381.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU68868.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX73062.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX98369.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY11302.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX29179.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ39048.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO83553.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB85787.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO60453.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ44216.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX52553.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL88018.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW70886.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG92098.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB37129.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX84454.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD62760.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU81155.1| Protein ygiW precursor [Shigella sonnei]
emb|CST73757.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW97027.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU45929.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA04739.1| Protein ygiW precursor [Shigella sonnei]
emb|CSV65168.1| Protein ygiW precursor [Shigella sonnei]
emb|CSO17463.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR07584.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX17427.1| Protein ygiW precursor [Shigella sonnei]
emb|CSQ99647.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ27239.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH56183.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB37200.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH43377.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX00890.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH94362.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX27391.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY18465.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB60845.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ28285.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH48725.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX04032.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX23883.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM50588.1| Protein ygiW precursor [Shigella sonnei]
emb|CSP01502.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH65652.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU38440.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK03403.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ35581.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC75606.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU65195.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ24738.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB33007.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU64219.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX60564.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX09136.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH65155.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS01973.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB36186.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR94067.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU85485.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB51464.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI50392.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM17999.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH63965.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ32482.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH09737.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA11866.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM35045.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL64287.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ10871.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ81085.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ49603.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ02809.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM51205.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB93359.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB33835.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD78019.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC34976.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB44015.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC26997.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL74701.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX75993.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ75292.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY07628.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH05763.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC09224.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX19444.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU48472.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ54780.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC08752.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH52696.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS49232.1| Protein ygiW precursor [Shigella sonnei]
emb|CST38193.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM00437.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC54410.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU41238.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU57839.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY43932.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ04814.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX86958.1| Protein ygiW precursor [Shigella sonnei]
emb|CST81611.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB44657.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ23617.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH00973.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU16583.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC63723.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX86091.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX06942.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH12411.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG75426.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI68151.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG93963.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU63728.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG45200.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK05281.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY88400.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC18723.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM33892.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ37525.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY06056.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ45058.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU48455.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU92593.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG62937.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU56312.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH98924.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH49631.1| Protein ygiW precursor [Shigella sonnei]
emb|CSU83946.1| Protein ygiW precursor [Shigella sonnei]
emb|CSW86906.1| Protein ygiW precursor [Shigella sonnei]
emb|CSX32939.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG95421.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG58871.1| Protein ygiW precursor [Shigella sonnei]
emb|CSG53212.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA90528.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA86258.1| Protein ygiW precursor [Shigella sonnei]
emb|CSZ90578.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA84509.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA39394.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA26110.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH58187.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH80170.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM55706.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS43135.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH27714.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM98864.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY03284.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH18327.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL80134.1| Protein ygiW precursor [Shigella sonnei]
emb|CSR81088.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM16790.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA48543.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM41658.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM31493.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM04263.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB05102.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH50912.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL91374.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB02532.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM35440.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH43811.1| Protein ygiW precursor [Shigella sonnei]
emb|CSS62821.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM50400.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA16773.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM18339.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA63414.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB19557.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA23221.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM18029.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ55851.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ62211.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH44158.1| Protein ygiW precursor [Shigella sonnei]
emb|CSL95381.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ30839.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB21762.1| Protein ygiW precursor [Shigella sonnei]
emb|CSM15785.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB33928.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA59737.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA83633.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH22898.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA51468.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB11608.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA56597.1| Protein ygiW precursor [Shigella sonnei]
emb|CTC25246.1| Protein ygiW precursor [Shigella sonnei]
emb|CSH27165.1| Protein ygiW precursor [Shigella sonnei]
emb|CSI20432.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA31628.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA66051.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA93947.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA40897.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB36921.1| Protein ygiW precursor [Shigella sonnei]
emb|CTA55763.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ92993.1| Protein ygiW precursor [Shigella sonnei]
emb|CSJ75589.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK40403.1| Protein ygiW precursor [Shigella sonnei]
emb|CTB89205.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK24396.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK12963.1| Protein ygiW precursor [Shigella sonnei]
emb|CSK04750.1| Protein ygiW precursor [Shigella sonnei]
emb|CSY06541.1| Protein ygiW precursor [Shigella sonnei]
gb|KNF17967.1| hypothetical protein WQ85_12915 [Escherichia coli]
gb|KNF19445.1| hypothetical protein WQ94_04885 [Escherichia coli]
gb|KNF22066.1| hypothetical protein WQ81_10525 [Escherichia coli]
gb|KNF32011.1| hypothetical protein WQ82_05610 [Escherichia coli]
gb|KNF33520.1| hypothetical protein WR10_08195 [Escherichia coli]
gb|KNF41150.1| hypothetical protein WR26_05240 [Escherichia coli]
gb|KNF44635.1| hypothetical protein WR22_07260 [Escherichia coli]
gb|KNF48715.1| hypothetical protein WR02_10910 [Escherichia coli]
gb|KNF54852.1| hypothetical protein WQ76_09190 [Escherichia coli]
gb|KNF58866.1| hypothetical protein WQ98_13580 [Escherichia coli]
gb|KNF65220.1| hypothetical protein WQ67_12935 [Escherichia coli]
gb|KNF69830.1| hypothetical protein WR15_10485 [Escherichia coli]
gb|KNF75277.1| hypothetical protein WQ83_12510 [Escherichia coli]
gb|KNF81281.1| hypothetical protein WQ89_07510 [Escherichia coli]
gb|KNF86621.1| hypothetical protein WQ78_06700 [Escherichia coli]
gb|KNF90153.1| hypothetical protein WQ75_21375 [Escherichia coli]
gb|KNF93022.1| hypothetical protein WR14_16595 [Escherichia coli]
gb|KNF98958.1| hypothetical protein WQ80_19840 [Escherichia coli]
gb|KNG08264.1| hypothetical protein WR06_17235 [Escherichia coli]
gb|KNG08716.1| hypothetical protein WQ90_16535 [Escherichia coli]
gb|KNG15692.1| hypothetical protein WQ93_13965 [Escherichia coli]
gb|KNG23945.1| hypothetical protein WQ97_14100 [Escherichia coli]
gb|KNG25756.1| hypothetical protein WQ87_08675 [Escherichia coli]
gb|KNG31750.1| hypothetical protein WR21_12680 [Escherichia coli]
gb|KNG41218.1| hypothetical protein WR20_06855 [Escherichia coli]
gb|KNG41690.1| hypothetical protein WR11_07030 [Escherichia coli]
gb|KNY02891.1| hypothetical protein AB747_04835 [Escherichia coli]
gb|KNY53827.1| hypothetical protein AGA24_19390 [Escherichia coli]
gb|KNY65469.1| hypothetical protein AGA22_06185 [Escherichia coli]
gb|KNY66593.1| hypothetical protein AGA21_01260 [Escherichia coli]
gb|KNY71237.1| hypothetical protein AGA25_11370 [Escherichia coli]
gb|KNY75869.1| hypothetical protein AGA27_21915 [Escherichia coli]
gb|KNY86926.1| hypothetical protein AGA28_12225 [Escherichia coli]
gb|KNY92246.1| hypothetical protein AGA29_01485 [Escherichia coli]
gb|KNY94511.1| hypothetical protein AGA31_23790 [Escherichia coli]
gb|KNZ00314.1| hypothetical protein AGA37_01620 [Escherichia coli]
gb|KNZ10103.1| hypothetical protein AGA36_04155 [Escherichia coli]
gb|KNZ15669.1| hypothetical protein AGA30_08340 [Escherichia coli]
gb|KNZ16944.1| hypothetical protein AGA20_01945 [Escherichia coli]
gb|KNZ18952.1| hypothetical protein AGA23_22170 [Escherichia coli]
gb|KNZ28272.1| hypothetical protein AGA32_01270 [Escherichia coli]
gb|KNZ99464.1| hypothetical protein AKG99_09275 [Escherichia coli]
gb|KOA24148.1| hypothetical protein AC065_14070 [Escherichia coli]
gb|KOA27219.1| hypothetical protein AC067_24520 [Escherichia coli]
gb|KOA30185.1| hypothetical protein AC066_07540 [Escherichia coli]
emb|CTX19505.1| protein YgiW [Escherichia coli]
emb|CTW88192.1| protein YgiW [Escherichia coli]
emb|CTW46706.1| protein YgiW [Escherichia coli]
emb|CTX13865.1| protein YgiW [Escherichia coli]
emb|CTW79613.1| protein YgiW [Escherichia coli]
emb|CTW78340.1| protein YgiW [Escherichia coli]
emb|CTR53154.1| protein YgiW [Escherichia coli]
emb|CTR14708.1| protein YgiW [Escherichia coli]
emb|CTU68767.1| protein YgiW [Escherichia coli]
emb|CTU34458.1| protein YgiW [Escherichia coli]
emb|CTR16505.1| protein YgiW [Escherichia coli]
emb|CTU54941.1| protein YgiW [Escherichia coli]
emb|CTR74711.1| protein YgiW [Escherichia coli]
emb|CTR42844.1| protein YgiW [Escherichia coli]
emb|CTR14855.1| protein YgiW [Escherichia coli]
emb|CTU44828.1| protein YgiW [Escherichia coli]
emb|CTU42846.1| protein YgiW [Escherichia coli]
emb|CTS75367.1| protein YgiW [Escherichia coli]
emb|CTU40555.1| protein YgiW [Escherichia coli]
emb|CTT66270.1| protein YgiW [Escherichia coli]
emb|CTT66617.1| protein YgiW [Escherichia coli]
emb|CTU65696.1| protein YgiW [Escherichia coli]
emb|CTR44617.1| protein YgiW [Escherichia coli]
emb|CTU11238.1| protein YgiW [Escherichia coli]
emb|CTS97266.1| protein YgiW [Escherichia coli]
emb|CTU88914.1| protein YgiW [Escherichia coli]
emb|CTS21905.1| protein YgiW [Escherichia coli]
emb|CTW71595.1| protein YgiW [Escherichia coli]
emb|CTU09008.1| protein YgiW [Escherichia coli]
emb|CTV58467.1| protein YgiW [Escherichia coli]
emb|CTR95436.1| protein YgiW [Escherichia coli]
emb|CTR49883.1| protein YgiW [Escherichia coli]
emb|CTW27569.1| protein YgiW [Escherichia coli]
emb|CTU36412.1| protein YgiW [Escherichia coli]
emb|CTS37172.1| protein YgiW [Escherichia coli]
emb|CTR57167.1| protein YgiW [Escherichia coli]
emb|CTT97088.1| protein YgiW [Escherichia coli]
emb|CTR56942.1| protein YgiW [Escherichia coli]
emb|CTV27242.1| protein YgiW [Escherichia coli]
emb|CTU71791.1| protein YgiW [Escherichia coli]
emb|CTT30993.1| protein YgiW [Escherichia coli]
emb|CTS21678.1| protein YgiW [Escherichia coli]
emb|CTS79272.1| protein YgiW [Escherichia coli]
emb|CTR22632.1| protein YgiW [Escherichia coli]
emb|CTV57775.1| protein YgiW [Escherichia coli]
emb|CTW50715.1| protein YgiW [Escherichia coli]
emb|CTV69896.1| protein YgiW [Escherichia coli]
emb|CTX05744.1| protein YgiW [Escherichia coli]
emb|CTV46800.1| protein YgiW [Escherichia coli]
emb|CTS68381.1| protein YgiW [Escherichia coli]
emb|CTV40358.1| protein YgiW [Escherichia coli]
emb|CTV80910.1| protein YgiW [Escherichia coli]
emb|CTS74575.1| protein YgiW [Escherichia coli]
emb|CTU81044.1| protein YgiW [Escherichia coli]
emb|CTS91329.1| protein YgiW [Escherichia coli]
emb|CTS77416.1| protein YgiW [Escherichia coli]
emb|CTS57252.1| protein YgiW [Escherichia coli]
emb|CTU77974.1| protein YgiW [Escherichia coli]
emb|CTW24478.1| protein YgiW [Escherichia coli]
emb|CTR65126.1| protein YgiW [Escherichia coli]
emb|CTU39785.1| protein YgiW [Escherichia coli]
emb|CTV53035.1| protein YgiW [Escherichia coli]
emb|CTS31786.1| protein YgiW [Escherichia coli]
emb|CTS80815.1| protein YgiW [Escherichia coli]
emb|CTV54207.1| protein YgiW [Escherichia coli]
emb|CTS76098.1| protein YgiW [Escherichia coli]
emb|CTR54379.1| protein YgiW [Escherichia coli]
emb|CTU05240.1| protein YgiW [Escherichia coli]
emb|CTR44293.1| protein YgiW [Escherichia coli]
emb|CTS02172.1| protein YgiW [Escherichia coli]
emb|CTR56046.1| protein YgiW [Escherichia coli]
emb|CTV21071.1| protein YgiW [Escherichia coli]
emb|CTW68458.1| protein YgiW [Escherichia coli]
emb|CTS15720.1| protein YgiW [Escherichia coli]
emb|CTV47656.1| protein YgiW [Escherichia coli]
emb|CTT57860.1| protein YgiW [Escherichia coli]
emb|CTV08495.1| protein YgiW [Escherichia coli]
emb|CTT85308.1| protein YgiW [Escherichia coli]
emb|CTU72932.1| protein YgiW [Escherichia coli]
emb|CTU23693.1| protein YgiW [Escherichia coli]
emb|CTT12992.1| protein YgiW [Escherichia coli]
emb|CTV40196.1| protein YgiW [Escherichia coli]
emb|CTS49607.1| protein YgiW [Escherichia coli]
emb|CTR77214.1| protein YgiW [Escherichia coli]
emb|CTT39149.1| protein YgiW [Escherichia coli]
emb|CTV04542.1| protein YgiW [Escherichia coli]
emb|CTU99017.1| protein YgiW [Escherichia coli]
emb|CTV80464.1| protein YgiW [Escherichia coli]
emb|CTS95989.1| protein YgiW [Escherichia coli]
emb|CTV72369.1| protein YgiW [Escherichia coli]
emb|CTV30289.1| protein YgiW [Escherichia coli]
emb|CTU80485.1| protein YgiW [Escherichia coli]
emb|CTS28649.1| protein YgiW [Escherichia coli]
emb|CTS71646.1| protein YgiW [Escherichia coli]
emb|CTR84800.1| protein YgiW [Escherichia coli]
emb|CTU81702.1| protein YgiW [Escherichia coli]
emb|CTS82978.1| protein YgiW [Escherichia coli]
emb|CTV94719.1| protein YgiW [Escherichia coli]
emb|CTS05484.1| protein YgiW [Escherichia coli]
emb|CTV20815.1| protein YgiW [Escherichia coli]
emb|CTT08737.1| protein YgiW [Escherichia coli]
emb|CTV59322.1| protein YgiW [Escherichia coli]
emb|CTV73350.1| protein YgiW [Escherichia coli]
emb|CTT32537.1| protein YgiW [Escherichia coli]
emb|CTW37739.1| protein YgiW [Escherichia coli]
emb|CTR41648.1| protein YgiW [Escherichia coli]
emb|CTS22464.1| protein YgiW [Escherichia coli]
emb|CTR78703.1| protein YgiW [Escherichia coli]
emb|CTS33086.1| protein YgiW [Escherichia coli]
emb|CTW82981.1| protein YgiW [Escherichia coli]
emb|CTW12443.1| protein YgiW [Escherichia coli]
emb|CTS67820.1| protein YgiW [Escherichia coli]
emb|CTT70089.1| protein YgiW [Escherichia coli]
emb|CTV53173.1| protein YgiW [Escherichia coli]
emb|CTW04060.1| protein YgiW [Escherichia coli]
emb|CTT57061.1| protein YgiW [Escherichia coli]
emb|CTU86386.1| protein YgiW [Escherichia coli]
emb|CTR78862.1| protein YgiW [Escherichia coli]
emb|CTV19969.1| protein YgiW [Escherichia coli]
emb|CTS60289.1| protein YgiW [Escherichia coli]
emb|CTU93253.1| protein YgiW [Escherichia coli]
emb|CTS93519.1| protein YgiW [Escherichia coli]
emb|CTT87137.1| protein YgiW [Escherichia coli]
emb|CTY13167.1| protein YgiW [Escherichia coli]
emb|CTY22755.1| protein YgiW [Escherichia coli]
emb|CTX85108.1| protein YgiW [Escherichia coli]
emb|CTY41050.1| protein YgiW [Escherichia coli]
emb|CTY52822.1| protein YgiW [Escherichia coli]
emb|CTX86524.1| protein YgiW [Escherichia coli]
emb|CTY55605.1| protein YgiW [Escherichia coli]
emb|CTY72780.1| protein YgiW [Escherichia coli]
emb|CTY53706.1| protein YgiW [Escherichia coli]
emb|CTZ15503.1| protein YgiW [Escherichia coli]
emb|CTY55054.1| protein YgiW [Escherichia coli]
emb|CTZ08575.1| protein YgiW [Escherichia coli]
emb|CTZ20988.1| protein YgiW [Escherichia coli]
emb|CTY47259.1| protein YgiW [Escherichia coli]
emb|CTZ33959.1| protein YgiW [Escherichia coli]
emb|CTX39465.1| protein YgiW [Escherichia coli]
emb|CTZ19984.1| protein YgiW [Escherichia coli]
emb|CTY46959.1| protein YgiW [Escherichia coli]
emb|CTY92133.1| protein YgiW [Escherichia coli]
emb|CTX80035.1| protein YgiW [Escherichia coli]
emb|CTX49781.1| protein YgiW [Escherichia coli]
emb|CTX89669.1| protein YgiW [Escherichia coli]
emb|CTZ66330.1| protein YgiW [Escherichia coli]
emb|CTY65887.1| protein YgiW [Escherichia coli]
emb|CTY50952.1| protein YgiW [Escherichia coli]
emb|CTZ91717.1| protein YgiW [Escherichia coli]
emb|CTX61729.1| protein YgiW [Escherichia coli]
emb|CTZ44070.1| protein YgiW [Escherichia coli]
emb|CTY80007.1| protein YgiW [Escherichia coli]
emb|CTZ72686.1| protein YgiW [Escherichia coli]
emb|CTZ54823.1| protein YgiW [Escherichia coli]
emb|CTY55688.1| protein YgiW [Escherichia coli]
emb|CTY87142.1| protein YgiW [Escherichia coli]
emb|CTZ28238.1| protein YgiW [Escherichia coli]
emb|CTY60612.1| protein YgiW [Escherichia coli]
emb|CTZ83275.1| protein YgiW [Escherichia coli]
emb|CTZ15662.1| protein YgiW [Escherichia coli]
emb|CTY07004.1| protein YgiW [Escherichia coli]
emb|CTY36422.1| protein YgiW [Escherichia coli]
emb|CTY28339.1| protein YgiW [Escherichia coli]
emb|CTZ87246.1| protein YgiW [Escherichia coli]
emb|CTZ83123.1| protein YgiW [Escherichia coli]
emb|CTZ85417.1| protein YgiW [Escherichia coli]
emb|CUA06853.1| protein YgiW [Escherichia coli]
emb|CUA01596.1| protein YgiW [Escherichia coli]
emb|CUA02589.1| protein YgiW [Escherichia coli]
emb|CUA03368.1| protein YgiW [Escherichia coli]
emb|CUA61163.1| protein YgiW [Escherichia coli]
emb|CUA37959.1| protein YgiW [Escherichia coli]
emb|CUA61494.1| protein YgiW [Escherichia coli]
emb|CUA28971.1| protein YgiW [Escherichia coli]
emb|CUA38613.1| protein YgiW [Escherichia coli]
emb|CUA25121.1| protein YgiW [Escherichia coli]
emb|CUA38223.1| protein YgiW [Escherichia coli]
emb|CUA34800.1| protein YgiW [Escherichia coli]
gb|KOR02353.1| hypothetical protein ABW50_14220 [Escherichia coli]
gb|ALB33069.1| hypothetical protein SR35_15425 [Escherichia coli]
gb|ALD23579.1| hypothetical protein AN206_03655 [Escherichia coli]
gb|ALD38523.1| hypothetical protein AN203_03580 [Escherichia coli]
gb|ALD28801.1| hypothetical protein AN205_03590 [Escherichia coli]
gb|ALD33757.1| hypothetical protein AN204_03680 [Escherichia coli]
emb|CUH57291.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli KRX]
gb|KOZ08588.1| hypothetical protein ACP59_13955 [Escherichia coli]
gb|KOZ09660.1| hypothetical protein AC814_07580 [Escherichia coli]
gb|KOZ17126.1| hypothetical protein ACP60_06235 [Escherichia coli]
gb|KOZ25134.1| hypothetical protein ACP62_00960 [Escherichia coli]
gb|KOZ27501.1| hypothetical protein ACP61_19370 [Escherichia coli]
gb|KOZ28878.1| hypothetical protein ACP63_12040 [Escherichia coli]
gb|KOZ38536.1| hypothetical protein ACP64_11430 [Escherichia coli]
gb|KOZ46942.1| hypothetical protein ACP65_09480 [Escherichia coli]
gb|KOZ48608.1| hypothetical protein ACP66_04445 [Escherichia coli]
gb|KOZ54571.1| hypothetical protein ACP68_10230 [Escherichia coli]
gb|KOZ59064.1| hypothetical protein ACP69_13765 [Escherichia coli]
gb|KOZ66288.1| hypothetical protein ACP74_01430 [Escherichia coli]
gb|KOZ71968.1| hypothetical protein ACP70_04245 [Escherichia coli]
gb|KOZ73587.1| hypothetical protein ACP71_16525 [Escherichia coli]
gb|KOZ78876.1| hypothetical protein ACP72_19680 [Escherichia coli]
gb|KOZ88646.1| hypothetical protein ACP73_01650 [Escherichia coli]
gb|KOZ90854.1| hypothetical protein ACP75_10070 [Escherichia coli]
gb|KOZ95328.1| hypothetical protein ACP67_14655 [Escherichia coli]
emb|CUK07083.1| Uncharacterized conserved protein [Achromobacter sp. ATCC35328]
gb|KPH30907.1| hypothetical protein ACZ78_18485 [Escherichia coli]
gb|KPH36223.1| hypothetical protein ACZ77_17055 [Escherichia coli]
gb|KPH45420.1| hypothetical protein ABT67_07480 [Escherichia coli]
gb|KPH49095.1| hypothetical protein ACZ84_02595 [Escherichia coli]
emb|CUQ98269.1| Protein ygiW precursor [Escherichia coli]
emb|CTX83345.1| protein YgiW [Escherichia coli]
emb|CTX76710.1| protein YgiW [Escherichia coli]
emb|CTX59495.1| protein YgiW [Escherichia coli]
emb|CTX43558.1| protein YgiW [Escherichia coli]
emb|CTX40825.1| protein YgiW [Escherichia coli]
emb|CTX38082.1| protein YgiW [Escherichia coli]
emb|CTX55070.1| protein YgiW [Escherichia coli]
emb|CTX38971.1| protein YgiW [Escherichia coli]
emb|CTX90441.1| protein YgiW [Escherichia coli]
emb|CTD45007.1| Protein ygiW precursor [Shigella sonnei]
emb|CTD42024.1| Protein ygiW precursor [Shigella sonnei]
emb|CTX59638.1| protein YgiW [Escherichia coli]
emb|CTX28891.1| protein YgiW [Escherichia coli]
gb|ALH92299.1| hypothetical protein AO055_19475 [Escherichia coli O157:H7]
gb|ALI39274.1| hypothetical protein QQ24_07255 [Escherichia coli str. K-12 substr.
MG1655]
gb|ALI43675.1| hypothetical protein QR62_07260 [Escherichia coli]
gb|ALI48070.1| hypothetical protein QR63_07260 [Escherichia coli]
gb|KPO13810.1| hypothetical protein ACU62_04970 [Escherichia coli]
gb|KPO16299.1| hypothetical protein ACU57_05140 [Escherichia coli]
gb|KPO17197.1| hypothetical protein VM39_02645 [Escherichia coli]
gb|KPO19957.1| hypothetical protein ACU58_15490 [Escherichia coli]
gb|KPO28210.1| hypothetical protein ACU65_08005 [Escherichia coli]
gb|KPO32825.1| hypothetical protein ACU81_23525 [Escherichia coli]
gb|KPO34232.1| hypothetical protein ACU70_11525 [Escherichia coli]
gb|KPO42724.1| hypothetical protein ACU75_02285 [Escherichia coli]
gb|KPO44866.1| hypothetical protein ACU79_25475 [Escherichia coli]
gb|KPO52819.1| hypothetical protein ACU82_04635 [Escherichia coli]
gb|KPO54602.1| hypothetical protein ACU90_12430 [Escherichia coli]
gb|KPO57027.1| hypothetical protein ACU60_26015 [Escherichia coli]
gb|KPO65100.1| hypothetical protein ACU64_15550 [Escherichia coli]
gb|KPO72117.1| hypothetical protein ACU80_16735 [Escherichia coli]
gb|KPO81327.1| hypothetical protein ACU87_26610 [Escherichia coli]
gb|KPO81667.1| hypothetical protein ACU72_14835 [Escherichia coli]
gb|KPO83027.1| hypothetical protein ACU91_06655 [Escherichia coli]
gb|KPO90763.1| hypothetical protein ACU88_23925 [Escherichia coli]
gb|KPO96571.1| hypothetical protein ACU83_16335 [Escherichia coli]
gb|KPP04340.1| hypothetical protein ACU98_08850 [Escherichia coli]
gb|KPP15548.1| hypothetical protein ACU67_05570 [Escherichia coli]
gb|KPP20474.1| hypothetical protein ACU66_03835 [Escherichia coli]
gb|KPP24674.1| hypothetical protein ACU68_08150 [Escherichia coli]
gb|KPP26159.1| hypothetical protein ACU99_23805 [Escherichia coli]
gb|KPP32032.1| hypothetical protein ACU86_04790 [Escherichia coli]
gb|KPP43742.1| hypothetical protein ACU94_03145 [Escherichia coli]
gb|KPP46813.1| hypothetical protein ACU96_25835 [Escherichia coli]
gb|KPP48981.1| hypothetical protein ACU77_10170 [Escherichia coli]
gb|KPP50146.1| hypothetical protein ACU76_00990 [Escherichia coli]
gb|KPQ48921.1| Protein YgiW [Escherichia coli TW10598]
gb|ALJ95722.1| hydrogen peroxide and cadmium resistanceperiplasmic protein
stress-induced OB-fold protein [Escherichia coli K-12]
gb|ALJ96299.1| hydrogen peroxide and cadmium resistanceperiplasmic protein
stress-induced OB-fold protein [Escherichia coli K-12]
gb|KQB26832.1| hypothetical protein APV31_11890 [Escherichia coli]
gb|KQC25510.1| hypothetical protein AML92_15505 [Escherichia coli]
gb|KQI78186.1| hypothetical protein AM258_01185 [Escherichia coli]
gb|KQI79882.1| hypothetical protein AM259_16040 [Escherichia coli]
gb|KQI86357.1| hypothetical protein AM260_09815 [Escherichia coli]
gb|KQI92706.1| hypothetical protein AM261_00190 [Escherichia coli]
gb|KQI99284.1| hypothetical protein AM263_02725 [Escherichia coli]
gb|KQJ02261.1| hypothetical protein AM262_01295 [Escherichia coli]
gb|KQJ04749.1| hypothetical protein AM264_13585 [Escherichia coli]
gb|KQJ10136.1| hypothetical protein AM265_06955 [Escherichia coli]
gb|KQJ16138.1| hypothetical protein AM266_09965 [Escherichia coli]
gb|KQJ22883.1| hypothetical protein AM267_00505 [Escherichia coli]
gb|KQJ23204.1| hypothetical protein AM268_16860 [Escherichia coli]
gb|KQJ31423.1| hypothetical protein AM269_02465 [Escherichia coli]
gb|KQJ35942.1| hypothetical protein AM271_01310 [Escherichia coli]
gb|KQJ44225.1| hypothetical protein AM272_03270 [Escherichia coli]
gb|KQJ50695.1| hypothetical protein AM273_03850 [Escherichia coli]
gb|ALL88865.1| hypothetical protein MJ49_15230 [Escherichia coli]
gb|ALL95117.1| hypothetical protein AKK22_21500 [Escherichia coli]
gb|KQL80784.1| hypothetical protein ExPEC_0197 [Escherichia coli]
gb|KRQ08047.1| hypothetical protein ASO15_20150 [Escherichia coli O157:H7]
gb|KRR53206.1| hypothetical protein EC2732_11084 [Escherichia coli VL2732]
gb|KRR59267.1| hypothetical protein ECK71_09407 [Escherichia coli K71]
gb|KRR62646.1| hypothetical protein EC2874_06978 [Escherichia coli VL2874]
gb|ALN47102.1| hypothetical protein ASE18_13890 [Escherichia coli]
gb|KRT20310.1| hypothetical protein ASU34_04760 [Escherichia coli]
gb|KRV71119.1| hypothetical protein AO733_03985 [Escherichia coli]
gb|KRW00794.1| hypothetical protein AO743_02955 [Escherichia coli]
gb|KRW01518.1| hypothetical protein AO737_02420 [Escherichia coli]
gb|KST28350.1| TIGR00156 family protein [Escherichia coli]
gb|KST30601.1| hypothetical protein APZ13_02400 [Escherichia coli]
gb|ALQ57952.1| hypothetical protein AB850_05305 [Escherichia coli]
gb|ALQ71361.1| hypothetical protein ATL78_01285 [Escherichia coli]
gb|KSW84412.1| hypothetical protein APT75_19830 [Escherichia coli]
gb|KSX60881.1| hypothetical protein APT88_23375 [Escherichia coli]
gb|KSX78554.1| hypothetical protein APT93_16540 [Escherichia coli]
gb|KSX94502.1| hypothetical protein APT94_26035 [Escherichia coli]
gb|KSY05888.1| hypothetical protein APT97_07715 [Escherichia coli]
gb|KSY19567.1| hypothetical protein APT99_03555 [Escherichia coli]
gb|KSY33834.1| hypothetical protein APU01_26275 [Escherichia coli]
gb|KSY49879.1| hypothetical protein APU06_00570 [Escherichia coli]
gb|KSY53455.1| hypothetical protein APU07_04425 [Escherichia coli]
gb|KSY65242.1| hypothetical protein APU10_09835 [Escherichia coli]
gb|KSY83598.1| hypothetical protein APU12_19705 [Escherichia coli]
gb|KSY89289.1| hypothetical protein APU13_23765 [Escherichia coli]
gb|KSY96975.1| hypothetical protein APU16_09070 [Escherichia coli]
gb|KSZ13808.1| hypothetical protein APU18_17245 [Escherichia coli]
emb|CRL89956.1| conserved hypothetical protein [Escherichia coli]
gb|ALT50928.1| hypothetical protein AUO99_13605 [Escherichia coli]
gb|KUG75929.1| hypothetical protein ARC97_06300 [Escherichia coli]
gb|KUG77662.1| hypothetical protein ARC81_03890 [Escherichia coli]
gb|KUG77736.1| hypothetical protein ARC96_03855 [Escherichia coli]
gb|KUG85458.1| hypothetical protein ARC88_12410 [Escherichia coli]
gb|KUG86667.1| hypothetical protein ARC95_12440 [Escherichia coli]
gb|KUG88164.1| hypothetical protein ARC90_07180 [Escherichia coli]
gb|KUG93703.1| hypothetical protein ARC92_18960 [Escherichia coli]
gb|KUH00092.1| hypothetical protein ARC93_05740 [Escherichia coli]
gb|KUH01343.1| hypothetical protein ARC82_17935 [Escherichia coli]
gb|KUH08839.1| hypothetical protein ARC99_20120 [Escherichia coli]
gb|KUH09705.1| hypothetical protein ARC83_10005 [Escherichia coli]
gb|KUH15642.1| hypothetical protein ARC94_17370 [Escherichia coli]
gb|KUH18413.1| hypothetical protein ARC89_18055 [Escherichia coli]
gb|KUH26126.1| hypothetical protein ARC98_14005 [Escherichia coli]
gb|KUH29676.1| hypothetical protein ARC91_09740 [Escherichia coli]
gb|ALV70508.1| hypothetical protein FH07_21035 [Escherichia coli]
gb|ALX53937.1| hypothetical protein AVR67_17565 [Escherichia coli]
gb|ALX59143.1| hypothetical protein AVR68_17575 [Escherichia coli]
gb|ALX63980.1| hypothetical protein AVR73_18070 [Escherichia coli]
gb|ALY14559.1| hypothetical protein ACN002_3101 [Escherichia coli]
emb|CUW80849.1| conserved hypothetical protein [Escherichia coli]
gb|KUR29247.1| hypothetical protein AWF56_11910 [Escherichia coli]
gb|ALZ57238.1| Protein ygiW precursor [Shigella sonnei]
gb|KUR87695.1| hypothetical protein AWE63_15730 [Escherichia coli]
gb|KUR87976.1| hypothetical protein AWE64_07295 [Escherichia coli]
gb|KUS08569.1| hypothetical protein AWE61_11885 [Escherichia coli]
gb|KUS16961.1| hypothetical protein AWE62_14090 [Escherichia coli]
gb|KUS19435.1| hypothetical protein AWE59_05765 [Escherichia coli]
gb|KUS25855.1| hypothetical protein AWE67_19220 [Escherichia coli]
gb|KUS29099.1| hypothetical protein AWE56_06895 [Escherichia coli]
gb|KUS34640.1| hypothetical protein AWE68_15520 [Escherichia coli]
gb|KUS38927.1| hypothetical protein AWE69_18590 [Escherichia coli]
gb|KUS41290.1| hypothetical protein AWE70_07230 [Escherichia coli]
gb|KUS50370.1| hypothetical protein AWE71_08065 [Escherichia coli]
gb|KUS57816.1| hypothetical protein AWE60_06810 [Escherichia coli]
gb|KUS71638.1| hypothetical protein AWE73_15980 [Escherichia coli]
gb|KUS71891.1| hypothetical protein AWE53_15680 [Escherichia coli]
gb|KUS74388.1| hypothetical protein AWE72_05995 [Escherichia coli]
gb|KUS75325.1| hypothetical protein AWE77_09405 [Escherichia coli]
gb|KUS81199.1| hypothetical protein AWE76_10825 [Escherichia coli]
gb|KUS81256.1| hypothetical protein AWE78_13015 [Escherichia coli]
gb|KUS87108.1| hypothetical protein AWE74_08110 [Escherichia coli]
gb|KUS98306.1| hypothetical protein AWE80_06235 [Escherichia coli]
gb|KUS98886.1| hypothetical protein AWE79_08475 [Escherichia coli]
gb|KUT09644.1| hypothetical protein AWE83_04545 [Escherichia coli]
gb|KUT16848.1| hypothetical protein AWE81_08655 [Escherichia coli]
gb|KUT17120.1| hypothetical protein AWE82_07795 [Escherichia coli]
gb|KUT22461.1| hypothetical protein AWE84_15030 [Escherichia coli]
gb|KUT24042.1| hypothetical protein AWE95_05120 [Escherichia coli]
gb|KUT43442.1| hypothetical protein AWE98_13955 [Escherichia coli]
gb|KUT56727.1| hypothetical protein AWF01_16220 [Escherichia coli]
gb|KUT58173.1| hypothetical protein AWF02_16290 [Escherichia coli]
gb|KUT65639.1| hypothetical protein AWF03_14965 [Escherichia coli]
gb|KUT67573.1| hypothetical protein AWF00_01325 [Escherichia coli]
gb|KUT70591.1| hypothetical protein AWF05_13595 [Escherichia coli]
gb|KUT76034.1| hypothetical protein AWF06_03750 [Escherichia coli]
gb|KUT79915.1| hypothetical protein AWF07_16935 [Escherichia coli]
gb|KUT90942.1| hypothetical protein AWF08_09010 [Escherichia coli]
gb|KUT93442.1| hypothetical protein AWF09_01615 [Escherichia coli]
gb|KUT94942.1| hypothetical protein AWF12_19240 [Escherichia coli]
gb|KUU14798.1| hypothetical protein AWF13_04780 [Escherichia coli]
gb|KUU17791.1| hypothetical protein AWF16_10730 [Escherichia coli]
gb|KUU19991.1| hypothetical protein AWF19_08065 [Escherichia coli]
gb|KUU31117.1| hypothetical protein AWF20_09545 [Escherichia coli]
gb|KUU35441.1| hypothetical protein AWF17_05555 [Escherichia coli]
gb|KUU35816.1| hypothetical protein AWF18_21705 [Escherichia coli]
gb|KUU39330.1| hypothetical protein AWF21_20015 [Escherichia coli]
gb|KUU47843.1| hypothetical protein AWF22_21025 [Escherichia coli]
gb|KUU48663.1| hypothetical protein AWF23_14705 [Escherichia coli]
gb|KUU58439.1| hypothetical protein AWF26_05010 [Escherichia coli]
gb|KUU62039.1| hypothetical protein AWF24_22915 [Escherichia coli]
gb|KUU68459.1| hypothetical protein AWF29_02385 [Escherichia coli]
gb|KUU70082.1| hypothetical protein AWF30_17150 [Escherichia coli]
gb|KUU72680.1| hypothetical protein AWF27_18325 [Escherichia coli]
gb|KUU83188.1| hypothetical protein AWF34_13160 [Escherichia coli]
gb|KUU85341.1| hypothetical protein AWF32_07600 [Escherichia coli]
gb|KUU91417.1| hypothetical protein AWF33_03640 [Escherichia coli]
gb|KUU99969.1| hypothetical protein AWF37_18925 [Escherichia coli]
gb|KUV06247.1| hypothetical protein AWF39_19080 [Escherichia coli]
gb|KUV08375.1| hypothetical protein AWF38_14410 [Escherichia coli]
gb|KUV22047.1| hypothetical protein AWF41_10540 [Escherichia coli]
gb|KUV25566.1| hypothetical protein AWF42_02780 [Escherichia coli]
gb|KUV31987.1| hypothetical protein AWF43_00885 [Escherichia coli]
gb|KUV43404.1| hypothetical protein AWE91_15150 [Escherichia coli]
gb|KUV50233.1| hypothetical protein AWE89_23325 [Escherichia coli]
gb|KUV61274.1| hypothetical protein AWF45_00825 [Escherichia coli]
gb|KUV62409.1| hypothetical protein AWE92_03690 [Escherichia coli]
gb|KUV66809.1| hypothetical protein AWF47_20675 [Escherichia coli]
gb|KUV68580.1| hypothetical protein AWE93_01585 [Escherichia coli]
gb|KUV77677.1| hypothetical protein AWF46_01430 [Escherichia coli]
gb|KUV79656.1| hypothetical protein AWF48_22430 [Escherichia coli]
gb|KUV80047.1| hypothetical protein AWF49_14915 [Escherichia coli]
gb|KUV83342.1| hypothetical protein AWF50_19240 [Escherichia coli]
gb|KUV95431.1| hypothetical protein AWF51_22785 [Escherichia coli]
gb|KUV99728.1| hypothetical protein AWF54_15370 [Escherichia coli]
gb|KUW11129.1| hypothetical protein AWF53_04595 [Escherichia coli]
gb|KUW16780.1| hypothetical protein AWF58_16375 [Escherichia coli]
gb|KUW19096.1| hypothetical protein AWF55_01375 [Escherichia coli]
gb|KUW27073.1| hypothetical protein AWF61_03715 [Escherichia coli]
gb|KUW37330.1| hypothetical protein AWF60_05240 [Escherichia coli]
gb|KUW41622.1| hypothetical protein AWF63_13790 [Escherichia coli]
gb|KUW48798.1| hypothetical protein AWF64_08050 [Escherichia coli]
gb|KUW58605.1| hypothetical protein AWF67_13910 [Escherichia coli]
gb|KUW64976.1| hypothetical protein AWF66_06270 [Escherichia coli]
gb|KUW67805.1| hypothetical protein AWF68_04905 [Escherichia coli]
gb|KUW68963.1| hypothetical protein AWF70_04075 [Escherichia coli]
gb|KUW69868.1| hypothetical protein AWF69_12400 [Escherichia coli]
gb|KUW77483.1| hypothetical protein AWF71_11240 [Escherichia coli]
gb|KUW82741.1| hypothetical protein AWF72_07370 [Escherichia coli]
gb|KUW91843.1| hypothetical protein AWF73_09780 [Escherichia coli]
gb|KUW95595.1| hypothetical protein AWF74_04385 [Escherichia coli]
gb|KUW97991.1| hypothetical protein AWF75_11440 [Escherichia coli]
gb|KUX11008.1| hypothetical protein AWF77_07520 [Escherichia coli]
gb|KUX13730.1| hypothetical protein AWF76_01330 [Escherichia coli]
gb|KUX14481.1| hypothetical protein AWF78_09000 [Escherichia coli]
gb|KUX14926.1| hypothetical protein AWF79_18065 [Escherichia coli]
gb|KUX23536.1| hypothetical protein AWF80_08330 [Escherichia coli]
gb|KUX26836.1| hypothetical protein AWF81_08955 [Escherichia coli]
gb|KUX28687.1| hypothetical protein AWF82_21300 [Escherichia coli]
gb|KUX36009.1| hypothetical protein AWF83_00775 [Escherichia coli]
gb|KUX37031.1| hypothetical protein AWF85_04240 [Escherichia coli]
gb|KUX47225.1| hypothetical protein AWF86_26690 [Escherichia coli]
gb|KUX49884.1| hypothetical protein AWF88_15205 [Escherichia coli]
gb|KUX61833.1| hypothetical protein AWF89_09535 [Escherichia coli]
gb|KUX67611.1| hypothetical protein AWF91_15970 [Escherichia coli]
gb|KUX74580.1| hypothetical protein AWF92_02435 [Escherichia coli]
gb|KUX77233.1| hypothetical protein AWF90_21990 [Escherichia coli]
gb|KUX84180.1| hypothetical protein AWF94_03610 [Escherichia coli]
gb|KUX85000.1| hypothetical protein AWF93_12210 [Escherichia coli]
gb|KUX95569.1| hypothetical protein AWF95_06135 [Escherichia coli]
gb|KUY01407.1| hypothetical protein AWF97_11160 [Escherichia coli]
gb|KUY06368.1| hypothetical protein AWF96_05585 [Escherichia coli]
gb|KUY06761.1| hypothetical protein AWF98_09725 [Escherichia coli]
gb|KUY12452.1| hypothetical protein AWF99_07345 [Escherichia coli]
gb|KVI17430.1| hypothetical protein AWF84_12500 [Escherichia coli]
gb|KVI19254.1| hypothetical protein AWE90_10845 [Escherichia coli]
gb|KVI19764.1| hypothetical protein AWF31_09115 [Escherichia coli]
gb|KWV19236.1| hypothetical protein AWH70_16860 [Escherichia coli]
gb|AMB52884.1| hypothetical protein AWB62_03045 [Escherichia coli]
gb|AMC95933.1| hypothetical protein AW869_06715 [Escherichia coli str. K-12
substr. MG1655]
gb|KXC11882.1| hypothetical protein AWE30_14640 [Escherichia coli]
gb|AMG76578.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AMH23678.1| hypothetical protein C2566_18495 [Escherichia coli B]
gb|AMH27995.1| hypothetical protein C3029_19115 [Escherichia coli B]
gb|AMH31648.1| hypothetical protein DHB4_15305 [Escherichia coli K-12]
gb|AMH36368.1| hypothetical protein C3026_16520 [Escherichia coli K-12]
gb|KXG63707.1| hypothetical protein LT28_03101 [Escherichia coli]
gb|KXG64852.1| hypothetical protein LT31_00104 [Escherichia coli]
gb|KXG72345.1| hypothetical protein LT30_01403 [Escherichia coli]
gb|AMF90329.1| TIGR00156 family protein [Escherichia coli]
gb|KXG99368.1| TIGR00156 family protein [Escherichia coli]
gb|KXH95497.1| hypothetical protein AXE67_00990 [Escherichia coli]
gb|KXH97550.1| hypothetical protein AXE68_21955 [Escherichia coli]
gb|KXI00271.1| hypothetical protein AXE66_10160 [Escherichia coli]
gb|KXI08479.1| hypothetical protein AXE69_11115 [Escherichia coli]
emb|CUW22415.1| hypothetical protein JF733_2909 [Escherichia coli]
gb|AML00466.1| hypothetical protein AWN69_10720 [Escherichia coli str. K-12
substr. MG1655]
gb|AML06298.1| hypothetical protein AVR74_16660 [Escherichia coli]
gb|AML10981.1| hypothetical protein AVR75_15810 [Escherichia coli]
gb|AML15990.1| hypothetical protein AVR72_17585 [Escherichia coli]
gb|AML20925.1| hypothetical protein AVR69_17400 [Escherichia coli]
gb|KXK75313.1| hypothetical protein AUS51_02880 [Escherichia coli]
gb|KXK75793.1| hypothetical protein AUS13_21195 [Escherichia coli]
gb|KXK86438.1| hypothetical protein AUS52_09510 [Escherichia coli]
gb|KXK94866.1| hypothetical protein AXH17_19940 [Escherichia coli]
gb|KXK96462.1| hypothetical protein AXH15_04745 [Escherichia coli]
gb|KXL03575.1| hypothetical protein AXH13_02910 [Escherichia coli]
gb|KXL08928.1| hypothetical protein AXH19_09900 [Escherichia coli]
gb|KXL09043.1| hypothetical protein AXH16_22345 [Escherichia coli]
gb|KXL22437.1| hypothetical protein AXH11_22255 [Escherichia coli]
gb|KXL28689.1| hypothetical protein AXH12_20010 [Escherichia coli]
gb|KXL33395.1| hypothetical protein AXH18_15135 [Escherichia coli]
gb|KXL40795.1| hypothetical protein AXH10_10855 [Escherichia coli]
gb|KXL58945.1| hypothetical protein AUS22_00305 [Escherichia coli]
gb|KXL60852.1| hypothetical protein AUS12_16260 [Escherichia coli]
gb|KXL62770.1| hypothetical protein AUS26_10855 [Escherichia coli]
gb|KXL72904.1| hypothetical protein AUS48_21710 [Escherichia coli]
gb|KXL75248.1| hypothetical protein AUS15_03095 [Escherichia coli]
gb|KXL78655.1| hypothetical protein AUS14_12990 [Escherichia coli]
gb|KXL96500.1| hypothetical protein AUS16_05340 [Escherichia coli]
gb|KXL97364.1| hypothetical protein AUS49_16535 [Escherichia coli]
gb|KXM01545.1| hypothetical protein AUS17_06115 [Escherichia coli]
gb|KXM06312.1| hypothetical protein AUS19_20665 [Escherichia coli]
gb|KXM06417.1| hypothetical protein AUS50_17245 [Escherichia coli]
gb|KXM07191.1| hypothetical protein AUS24_21935 [Escherichia coli]
gb|KXM22911.1| hypothetical protein AUS21_17615 [Escherichia coli]
gb|KXM25788.1| hypothetical protein AUS20_08105 [Escherichia coli]
gb|KXM34173.1| hypothetical protein AUS23_15980 [Escherichia coli]
gb|KXM36668.1| hypothetical protein AUS25_21570 [Escherichia coli]
gb|KXM49252.1| hypothetical protein AUS28_07370 [Escherichia coli]
gb|KXM50052.1| hypothetical protein AUS29_02850 [Escherichia coli]
gb|KXM53277.1| hypothetical protein AUS30_17450 [Escherichia coli]
gb|KXM53356.1| hypothetical protein AUS32_02160 [Escherichia coli]
gb|KXM61005.1| hypothetical protein AUS33_10660 [Escherichia coli]
gb|KXM77542.1| hypothetical protein AUS36_17410 [Escherichia coli]
gb|KXM82322.1| hypothetical protein AUS34_02900 [Escherichia coli]
gb|KXM83311.1| hypothetical protein AUS31_24685 [Escherichia coli]
gb|KXM85046.1| hypothetical protein AUS39_21925 [Escherichia coli]
gb|KXM86613.1| hypothetical protein AUS41_16110 [Escherichia coli]
gb|KXM87841.1| hypothetical protein AUS37_05025 [Escherichia coli]
gb|KXN03985.1| hypothetical protein AUS38_13495 [Escherichia coli]
gb|KXN05617.1| hypothetical protein AUS46_12765 [Escherichia coli]
gb|KXN05865.1| hypothetical protein AUS47_21785 [Escherichia coli]
gb|KXN17635.1| hypothetical protein AUS40_24575 [Escherichia coli]
gb|KXN19384.1| hypothetical protein AUS18_22285 [Escherichia coli]
gb|KXN30555.1| hypothetical protein AUS45_04315 [Escherichia coli]
gb|KXN36811.1| hypothetical protein AUS53_21670 [Escherichia coli]
gb|KXN36905.1| hypothetical protein AUS35_17060 [Escherichia coli]
gb|KXN51557.1| hypothetical protein AUS42_03215 [Escherichia coli]
gb|KXN56141.1| hypothetical protein AUS44_04120 [Escherichia coli]
gb|KXN57942.1| hypothetical protein AUS27_14405 [Escherichia coli]
gb|KXN62303.1| hypothetical protein AUS43_24535 [Escherichia coli]
gb|KXP21749.1| hypothetical protein AUQ36_13280 [Escherichia coli]
gb|KXP22297.1| hypothetical protein AUP76_06010 [Escherichia coli]
gb|KXP28604.1| hypothetical protein AUP75_01280 [Escherichia coli]
gb|KXP33603.1| hypothetical protein AUP79_13880 [Escherichia coli]
gb|KXP34691.1| hypothetical protein AUQ35_12760 [Escherichia coli]
gb|KXP41551.1| hypothetical protein AUP97_06075 [Escherichia coli]
gb|KXP47826.1| hypothetical protein AUQ30_06950 [Escherichia coli]
gb|KXP48896.1| hypothetical protein AUQ19_17565 [Escherichia coli]
gb|KXP52191.1| hypothetical protein AUQ34_12445 [Escherichia coli]
gb|KXP59669.1| hypothetical protein AUP86_08325 [Escherichia coli]
gb|KXP61378.1| hypothetical protein AUP84_22155 [Escherichia coli]
gb|KXP69627.1| hypothetical protein AUP82_09160 [Escherichia coli]
gb|KXP74834.1| hypothetical protein AUQ08_06680 [Escherichia coli]
gb|KXP78071.1| hypothetical protein AUP83_07185 [Escherichia coli]
gb|KXP87515.1| hypothetical protein AUP78_01285 [Escherichia coli]
gb|KXP88101.1| hypothetical protein AUP77_07200 [Escherichia coli]
gb|KXP90183.1| hypothetical protein AUP80_12110 [Escherichia coli]
gb|KXQ00933.1| hypothetical protein AUP85_04520 [Escherichia coli]
gb|KXQ02480.1| hypothetical protein AUP90_04245 [Escherichia coli]
gb|KXQ10254.1| hypothetical protein AUP98_08500 [Escherichia coli]
gb|KXQ12103.1| hypothetical protein AUP95_23215 [Escherichia coli]
gb|KXQ14956.1| hypothetical protein AUP96_00940 [Escherichia coli]
gb|KXQ21794.1| hypothetical protein AUP94_20505 [Escherichia coli]
gb|KXQ23333.1| hypothetical protein AUP92_04005 [Escherichia coli]
gb|KXQ31660.1| hypothetical protein AUQ03_11530 [Escherichia coli]
gb|KXQ38188.1| hypothetical protein AUP88_01465 [Escherichia coli]
gb|KXQ38549.1| hypothetical protein AUQ01_17150 [Escherichia coli]
gb|KXQ47865.1| hypothetical protein AUP89_04620 [Escherichia coli]
gb|KXQ51817.1| hypothetical protein AUP93_03175 [Escherichia coli]
gb|KXQ56761.1| hypothetical protein AUQ04_05125 [Escherichia coli]
gb|KXQ62467.1| hypothetical protein AUQ09_00545 [Escherichia coli]
gb|KXQ63842.1| hypothetical protein AUQ07_08600 [Escherichia coli]
gb|KXQ67107.1| hypothetical protein AUQ00_09720 [Escherichia coli]
gb|KXQ72268.1| hypothetical protein AUQ10_08710 [Escherichia coli]
gb|KXQ75840.1| hypothetical protein AUP99_16295 [Escherichia coli]
gb|KXQ79893.1| hypothetical protein AUQ18_14820 [Escherichia coli]
gb|KXQ84274.1| hypothetical protein AUQ02_13495 [Escherichia coli]
gb|KXQ89722.1| hypothetical protein AUQ06_14645 [Escherichia coli]
gb|KXQ93380.1| hypothetical protein AUQ05_21845 [Escherichia coli]
gb|KXQ94453.1| hypothetical protein AUQ17_17660 [Escherichia coli]
gb|KXR12166.1| hypothetical protein AUQ15_08255 [Escherichia coli]
gb|KXR12298.1| hypothetical protein AUQ14_01150 [Escherichia coli]
gb|KXR13104.1| hypothetical protein AUQ12_08720 [Escherichia coli]
gb|KXR19433.1| hypothetical protein AUQ16_13005 [Escherichia coli]
gb|KXR24312.1| hypothetical protein AUQ21_06675 [Escherichia coli]
gb|KXR25974.1| hypothetical protein AUQ20_20430 [Escherichia coli]
gb|KXR33237.1| hypothetical protein AUQ22_12345 [Escherichia coli]
gb|KXR39150.1| hypothetical protein AUQ24_02005 [Escherichia coli]
gb|KXR41971.1| hypothetical protein AUQ31_21975 [Escherichia coli]
gb|KXR44106.1| hypothetical protein AUQ27_05395 [Escherichia coli]
gb|KXR51755.1| hypothetical protein AUQ26_10755 [Escherichia coli]
gb|KXR60373.1| hypothetical protein AUQ32_02525 [Escherichia coli]
gb|KXR61975.1| hypothetical protein AUQ11_14610 [Escherichia coli]
gb|KXR63725.1| hypothetical protein AUQ28_06420 [Escherichia coli]
gb|KXR71145.1| hypothetical protein AUQ23_17230 [Escherichia coli]
gb|KXR74863.1| hypothetical protein AUQ33_02745 [Escherichia coli]
gb|KXR79235.1| hypothetical protein AUQ25_18460 [Escherichia coli]
gb|KXR83484.1| hypothetical protein AUQ29_12930 [Escherichia coli]
gb|KXR93889.1| hypothetical protein AUQ13_02230 [Escherichia coli]
gb|KXR99901.1| hypothetical protein AUP91_02480 [Escherichia coli]
gb|KXS01609.1| hypothetical protein AUP81_06070 [Escherichia coli]
gb|AMM37983.1| hypothetical protein AVR76_17295 [Escherichia coli]
emb|CUU95233.1| conserved hypothetical protein [Escherichia coli]
gb|KXU67033.1| hypothetical protein AWN71_12540 [Escherichia coli]
gb|KXU69664.1| hypothetical protein AWN70_11580 [Escherichia coli]
gb|KXU77548.1| hypothetical protein AWN72_20960 [Escherichia coli]
emb|CUX83486.1| conserved hypothetical protein [Escherichia coli]
gb|AMQ52851.1| hypothetical protein AX202_17675 [Escherichia coli JJ1887]
gb|AMR24564.1| TIGR00156 family protein [Shigella sp. PAMC 28760]
gb|KYL38469.1| hypothetical protein ECEG1_16150 [Escherichia coli]
gb|KYN60800.1| TIGR00156 family protein [Escherichia coli]
gb|KYN61428.1| TIGR00156 family protein [Escherichia coli]
gb|KYO68849.1| hypothetical protein LT26_03183 [Escherichia coli]
gb|KYO69623.1| hypothetical protein LT27_01858 [Escherichia coli]
gb|KYR06582.1| TIGR00156 family protein [Escherichia coli]
gb|KYR13928.1| TIGR00156 family protein [Escherichia coli]
gb|KYR14341.1| TIGR00156 family protein [Escherichia coli]
gb|KYR23179.1| TIGR00156 family protein [Escherichia coli]
gb|KYR25350.1| TIGR00156 family protein [Escherichia coli]
gb|KYR34890.1| TIGR00156 family protein [Escherichia coli]
gb|KYR35145.1| TIGR00156 family protein [Escherichia coli]
gb|KYR39995.1| TIGR00156 family protein [Escherichia coli]
gb|KYR50558.1| TIGR00156 family protein [Escherichia coli]
gb|KYR51580.1| TIGR00156 family protein [Escherichia coli]
gb|KYR62986.1| TIGR00156 family protein [Escherichia coli]
gb|KYR73032.1| TIGR00156 family protein [Escherichia coli]
gb|KYR73730.1| TIGR00156 family protein [Escherichia coli]
gb|KYR74573.1| TIGR00156 family protein [Escherichia coli]
gb|KYR79394.1| TIGR00156 family protein [Escherichia coli]
gb|KYR85580.1| TIGR00156 family protein [Escherichia coli]
gb|KYR86687.1| TIGR00156 family protein [Escherichia coli]
gb|KYR91194.1| TIGR00156 family protein [Escherichia coli]
gb|KYR98356.1| TIGR00156 family protein [Escherichia coli]
gb|KYS10164.1| TIGR00156 family protein [Escherichia coli]
gb|KYS15523.1| TIGR00156 family protein [Escherichia coli]
gb|KYS17981.1| TIGR00156 family protein [Escherichia coli]
gb|KYS21743.1| TIGR00156 family protein [Escherichia coli]
gb|KYS23601.1| TIGR00156 family protein [Escherichia coli]
gb|KYS36039.1| TIGR00156 family protein [Escherichia coli]
gb|KYS37281.1| TIGR00156 family protein [Escherichia coli]
gb|KYS43713.1| TIGR00156 family protein [Escherichia coli]
gb|KYS51126.1| TIGR00156 family protein [Escherichia coli]
gb|KYS56971.1| TIGR00156 family protein [Escherichia coli]
gb|KYS58353.1| TIGR00156 family protein [Escherichia coli]
gb|KYS61496.1| TIGR00156 family protein [Escherichia coli]
gb|KYS67662.1| TIGR00156 family protein [Escherichia coli]
gb|KYS72943.1| TIGR00156 family protein [Escherichia coli]
gb|KYS78445.1| TIGR00156 family protein [Escherichia coli]
gb|KYS83119.1| TIGR00156 family protein [Escherichia coli]
gb|KYS93191.1| TIGR00156 family protein [Escherichia coli]
gb|KYS97569.1| TIGR00156 family protein [Escherichia coli]
gb|KYS97679.1| TIGR00156 family protein [Escherichia coli]
gb|KYT05504.1| TIGR00156 family protein [Escherichia coli]
gb|KYT13851.1| TIGR00156 family protein [Escherichia coli]
gb|KYT17091.1| TIGR00156 family protein [Escherichia coli]
gb|KYT21253.1| TIGR00156 family protein [Escherichia coli]
gb|KYT21322.1| TIGR00156 family protein [Escherichia coli]
gb|KYT33306.1| TIGR00156 family protein [Escherichia coli]
gb|KYT40310.1| hypothetical protein AML29_12760 [Escherichia coli]
gb|KYT45163.1| hypothetical protein AML38_13940 [Escherichia coli]
gb|KYT51926.1| hypothetical protein AML49_05675 [Escherichia coli]
gb|KYT60636.1| hypothetical protein AML45_03220 [Escherichia coli]
gb|KYT63234.1| hypothetical protein AML50_17890 [Escherichia coli]
gb|KYT70807.1| hypothetical protein AML52_11855 [Escherichia coli]
gb|KYT72314.1| hypothetical protein AML54_09210 [Escherichia coli]
gb|KYT86351.1| hypothetical protein AML78_13525 [Escherichia coli]
gb|KYT87002.1| hypothetical protein AML64_08655 [Escherichia coli]
gb|KYT89983.1| hypothetical protein AML60_24110 [Escherichia coli]
gb|KYU04024.1| hypothetical protein AML55_01820 [Escherichia coli]
gb|KYU04476.1| hypothetical protein AML66_11450 [Escherichia coli]
gb|KYU05956.1| hypothetical protein AML53_04295 [Escherichia coli]
gb|KYU08092.1| hypothetical protein AML58_04175 [Escherichia coli]
gb|KYU16139.1| hypothetical protein AML57_01640 [Escherichia coli]
gb|KYU22641.1| hypothetical protein AML61_22960 [Escherichia coli]
gb|KYU26445.1| hypothetical protein AML59_18595 [Escherichia coli]
gb|KYU35122.1| hypothetical protein AML63_21110 [Escherichia coli]
gb|KYU37399.1| hypothetical protein AML62_03570 [Escherichia coli]
gb|KYU39782.1| hypothetical protein AML65_19280 [Escherichia coli]
gb|KYU50331.1| hypothetical protein AML67_00725 [Escherichia coli]
gb|KYU50867.1| hypothetical protein AML68_25395 [Escherichia coli]
gb|KYU61382.1| hypothetical protein AML72_00985 [Escherichia coli]
gb|KYU62255.1| hypothetical protein AML71_01245 [Escherichia coli]
gb|KYU68220.1| hypothetical protein AML73_21765 [Escherichia coli]
gb|KYU76599.1| hypothetical protein AML75_15035 [Escherichia coli]
gb|KYU79578.1| hypothetical protein AML76_16140 [Escherichia coli]
gb|KYU91715.1| hypothetical protein AML77_11320 [Escherichia coli]
gb|KYU97683.1| hypothetical protein AML79_10090 [Escherichia coli]
gb|KYV05796.1| hypothetical protein AML69_15235 [Escherichia coli]
gb|KYV08102.1| hypothetical protein AML80_05395 [Escherichia coli]
gb|KYV09590.1| hypothetical protein AML81_09525 [Escherichia coli]
gb|KYV15609.1| hypothetical protein AML70_17105 [Escherichia coli]
gb|KYV16174.1| hypothetical protein AML36_19980 [Escherichia coli]
gb|KYV18797.1| hypothetical protein AML37_05080 [Escherichia coli]
gb|KYV26098.1| hypothetical protein AMK77_21325 [Escherichia coli]
gb|KYV33812.1| hypothetical protein AML39_07460 [Escherichia coli]
gb|KYV35923.1| hypothetical protein AMK76_09040 [Escherichia coli]
gb|KYV44944.1| hypothetical protein AMK78_23830 [Escherichia coli]
gb|KYV47665.1| hypothetical protein AMK79_14665 [Escherichia coli]
gb|KYV54461.1| hypothetical protein AMK80_14445 [Escherichia coli]
gb|KYV59664.1| hypothetical protein AMK81_23665 [Escherichia coli]
gb|KYV68345.1| hypothetical protein AMK83_17765 [Escherichia coli]
gb|KYV74299.1| hypothetical protein AMK84_00590 [Escherichia coli]
gb|KYV86317.1| hypothetical protein AMK87_19640 [Escherichia coli]
gb|KYV86797.1| hypothetical protein AMK86_09700 [Escherichia coli]
gb|KYV90191.1| hypothetical protein AMK85_06460 [Escherichia coli]
gb|KYV97002.1| hypothetical protein AMK88_20490 [Escherichia coli]
gb|KYW02630.1| hypothetical protein AMK89_12175 [Escherichia coli]
gb|KYW03633.1| hypothetical protein AMK90_14405 [Escherichia coli]
gb|KYW07775.1| hypothetical protein AMK91_02300 [Escherichia coli]
gb|KYW18984.1| hypothetical protein AMK93_13850 [Escherichia coli]
gb|KYW33192.1| hypothetical protein AMK92_07590 [Escherichia coli]
gb|KYW36666.1| hypothetical protein AMK94_04765 [Escherichia coli]
gb|KYW37972.1| hypothetical protein AMK95_00530 [Escherichia coli]
gb|KYW40173.1| hypothetical protein AML82_06335 [Escherichia coli]
gb|KYW46076.1| hypothetical protein AMK97_11340 [Escherichia coli]
gb|KYW53247.1| hypothetical protein AML83_01550 [Escherichia coli]
gb|KYW65000.1| hypothetical protein AML84_00295 [Escherichia coli]
gb|KYW65654.1| hypothetical protein AML85_10145 [Escherichia coli]
gb|KYW75672.1| hypothetical protein AML86_10325 [Escherichia coli]
gb|KYW78449.1| hypothetical protein AML87_01270 [Escherichia coli]
gb|AMU83614.1| hypothetical protein Y979_16275 [Escherichia coli str. Sanji]
gb|KYZ89603.1| hypothetical protein ACM48_10375 [Escherichia coli]
gb|KYZ94259.1| hypothetical protein ACM47_02745 [Escherichia coli]
gb|KYZ95907.1| hypothetical protein ACM49_19985 [Escherichia coli]
gb|AMW42822.1| TIGR00156 family protein [Escherichia coli]
gb|AMW48185.1| TIGR00156 family protein [Escherichia coli]
gb|AMX14285.1| TIGR00156 family protein [Escherichia coli]
gb|AMX30613.1| TIGR00156 family protein [Escherichia coli]
gb|AMX34860.1| TIGR00156 family protein [Escherichia coli]
gb|AMX41072.1| TIGR00156 family protein [Escherichia coli]
gb|KZF27948.1| hypothetical protein AZE29_04125 [Escherichia coli APEC O2]
gb|KZG95661.1| TIGR00156 family protein [Escherichia coli]
gb|KZG96226.1| TIGR00156 family protein [Escherichia coli]
gb|KZH05796.1| TIGR00156 family protein [Escherichia coli]
gb|KZH08072.1| TIGR00156 family protein [Escherichia coli]
gb|KZH16049.1| TIGR00156 family protein [Escherichia coli]
gb|KZH27274.1| TIGR00156 family protein [Escherichia coli]
gb|KZH28658.1| TIGR00156 family protein [Escherichia coli]
gb|KZH31874.1| TIGR00156 family protein [Escherichia coli]
gb|KZH40626.1| TIGR00156 family protein [Escherichia coli]
gb|KZH46157.1| TIGR00156 family protein [Escherichia coli]
gb|KZH49430.1| TIGR00156 family protein [Escherichia coli]
gb|KZH55507.1| TIGR00156 family protein [Escherichia coli]
gb|KZH60525.1| TIGR00156 family protein [Escherichia coli]
gb|KZH72120.1| TIGR00156 family protein [Escherichia coli]
gb|KZH72251.1| TIGR00156 family protein [Escherichia coli]
gb|KZH76441.1| TIGR00156 family protein [Escherichia coli]
gb|KZH81585.1| TIGR00156 family protein [Escherichia coli]
gb|KZH84695.1| TIGR00156 family protein [Escherichia coli]
gb|KZH92241.1| TIGR00156 family protein [Escherichia coli]
gb|KZH95948.1| TIGR00156 family protein [Escherichia coli]
gb|KZI03719.1| TIGR00156 family protein [Escherichia coli]
gb|KZI06958.1| TIGR00156 family protein [Escherichia coli]
gb|KZI12858.1| TIGR00156 family protein [Escherichia coli]
gb|KZI20679.1| TIGR00156 family protein [Escherichia coli]
gb|KZI21812.1| TIGR00156 family protein [Escherichia coli]
gb|KZI26101.1| TIGR00156 family protein [Escherichia coli]
gb|KZI31427.1| TIGR00156 family protein [Escherichia coli]
gb|KZI37804.1| TIGR00156 family protein [Escherichia coli]
gb|KZI42820.1| TIGR00156 family protein [Escherichia coli]
gb|KZI44844.1| TIGR00156 family protein [Escherichia coli]
gb|KZI54539.1| TIGR00156 family protein [Escherichia coli]
gb|KZI55373.1| TIGR00156 family protein [Escherichia coli]
gb|KZI56186.1| TIGR00156 family protein [Escherichia coli]
gb|KZI69447.1| TIGR00156 family protein [Escherichia coli]
gb|KZI72202.1| TIGR00156 family protein [Escherichia coli]
gb|KZI93834.1| TIGR00156 family protein [Escherichia coli]
gb|KZI97401.1| TIGR00156 family protein [Escherichia coli]
gb|KZI98317.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ03917.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ10105.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ10217.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ12388.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ26618.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ27112.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ42946.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ43528.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ47600.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ62237.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ63116.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ65411.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ68707.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ70551.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ78021.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ86858.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ95354.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ96167.1| TIGR00156 family protein [Escherichia coli]
gb|KZJ99869.1| TIGR00156 family protein [Escherichia coli]
gb|KZO69205.1| hypothetical protein AAW07_00370 [Escherichia coli]
gb|KZO71881.1| hypothetical protein AAW09_08565 [Escherichia coli]
gb|KZO77349.1| hypothetical protein TH56_04090 [Escherichia coli]
gb|KZO78603.1| hypothetical protein AAW05_14980 [Escherichia coli]
gb|KZO86892.1| hypothetical protein TH55_10800 [Escherichia coli]
gb|KZO87918.1| hypothetical protein TH54_01210 [Escherichia coli]
gb|KZP43241.1| hypothetical protein XF29_02085 [Escherichia coli]
gb|OAC01723.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC03453.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC10698.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC12380.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC19444.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC22567.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC29718.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC33991.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC39728.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAC42989.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|OAE57103.1| TIGR00156 family protein [Escherichia coli]
gb|OAE73774.1| TIGR00156 family protein [Escherichia coli]
gb|OAF22698.1| hypothetical protein AVR70_13405 [Escherichia coli]
gb|OAF25774.1| hypothetical protein AXK32_18840 [Escherichia coli]
gb|OAF29293.1| hypothetical protein AXK31_08190 [Escherichia coli]
gb|OAF35613.1| hypothetical protein AXK34_00905 [Escherichia coli]
gb|OAF43325.1| hypothetical protein AXK33_11430 [Escherichia coli]
gb|OAF43770.1| hypothetical protein AXK29_01845 [Escherichia coli]
gb|OAF52421.1| hypothetical protein AXK35_01755 [Escherichia coli]
gb|OAF92267.1| Protein ygiW [Escherichia coli PCN079]
gb|OAF92544.1| Protein ygiW [Escherichia coli PCN009]
gb|OAI33427.1| TIGR00156 family protein [Escherichia coli]
gb|ANE59357.1| TIGR00156 family protein [Escherichia coli]
gb|ANE64047.1| TIGR00156 family protein [Escherichia coli]
gb|OAJ79021.1| TIGR00156 family protein [Escherichia coli]
gb|OAJ83701.1| TIGR00156 family protein [Escherichia coli]
gb|OAM48072.1| TIGR00156 family protein [Escherichia coli]
emb|SBL08719.1| protein ygiW [Klebsiella oxytoca]
gb|OAN07642.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OAO42277.1| hypothetical protein OP01_01915 [Escherichia coli]
gb|OAO46634.1| hypothetical protein OP02_10275 [Escherichia coli]
gb|OAO49289.1| hypothetical protein OO99_11700 [Escherichia coli]
gb|OAO58394.1| hypothetical protein OP00_16515 [Escherichia coli]
gb|OAO67323.1| hypothetical protein OO97_01270 [Escherichia coli]
gb|OAO69118.1| hypothetical protein OO96_11420 [Escherichia coli]
gb|OAO74259.1| hypothetical protein OK10_09695 [Escherichia coli]
gb|ANG70423.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|ANG75919.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|ANG81602.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OAP70648.1| TIGR00156 family protein [Escherichia coli]
gb|OAR94051.1| hypothetical protein AYO02_12600 [Escherichia coli]
gb|OAR95648.1| hypothetical protein AYO03_01000 [Escherichia coli]
gb|OAS07080.1| hypothetical protein AYO07_11315 [Escherichia coli]
gb|OAS85583.1| TIGR00156 family protein [Escherichia coli]
gb|OAT63599.1| TIGR00156 family protein [Escherichia coli]
gb|OAV57937.1| TIGR00156 family protein [Escherichia coli]
gb|ANJ33705.1| TIGR00156 family protein [Escherichia coli]
gb|ANJ39553.1| TIGR00156 family protein [Escherichia coli]
gb|OAY13158.1| TIGR00156 family protein [Escherichia coli]
gb|ANK07928.1| TIGR00156 family protein [Escherichia coli]
emb|CTQ83461.1| conserved hypothetical protein [Escherichia coli]
gb|ANK54723.1| TIGR00156 family protein [Escherichia coli]
gb|ANM83815.1| TIGR00156 family protein [Escherichia coli]
gb|ANK33856.1| hypothetical protein WM48_16845 [Escherichia coli]
gb|OBU91273.1| TIGR00156 family protein [Escherichia coli]
gb|ANO90935.1| hypothetical protein GJ11_19880 [Escherichia coli]
gb|ANP09037.1| hypothetical protein CP48_18625 [Escherichia coli]
gb|ANP19860.1| hypothetical protein GJ12_19455 [Escherichia coli]
gb|ANP34003.1| hypothetical protein AB847_19740 [Escherichia coli]
gb|ANO79598.1| hypothetical protein CO57_19110 [Escherichia coli]
gb|ANQ02393.1| TIGR00156 family protein [Escherichia coli]
gb|ANO28353.1| TIGR00156 family protein [Escherichia coli]
gb|ANR82860.1| TIGR00156 family protein [Escherichia coli]
gb|OBZ37128.1| TIGR00156 family protein [Escherichia coli]
gb|OBZ38323.1| TIGR00156 family protein [Escherichia coli]
gb|OBZ47276.1| TIGR00156 family protein [Escherichia coli]
gb|OCC36252.1| hypothetical protein AWZ64_13175 [Shigella sonnei]
gb|OCC40946.1| hypothetical protein AWZ63_08815 [Shigella sonnei]
gb|OCC42445.1| hypothetical protein AWZ62_02435 [Shigella sonnei]
gb|OCC49534.1| hypothetical protein AWZ65_13175 [Shigella sonnei]
gb|OCC49970.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC51629.1| hypothetical protein AWZ66_10870 [Shigella sonnei]
gb|OCC60171.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC60513.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC64569.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC70041.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC72177.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC79316.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC84295.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC85190.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC93042.1| TIGR00156 family protein [Shigella sonnei]
gb|OCC96865.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD00880.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD05017.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD11278.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD12671.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD17346.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD23986.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD29921.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD33388.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD37656.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD40330.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD41919.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD49880.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD54866.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD56093.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD63524.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD64925.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD70987.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD73618.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD73877.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD84285.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD85034.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD90432.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD99120.1| TIGR00156 family protein [Shigella sonnei]
gb|OCD99832.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE02572.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE07518.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE12285.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE13260.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE21836.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE28194.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE29204.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE37696.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE41139.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE42062.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE47437.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE56059.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE57589.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE58997.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE62287.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE66511.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE66651.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE74373.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE78134.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE79129.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE90187.1| TIGR00156 family protein [Shigella sonnei]
gb|OCE92905.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF02295.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF03043.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF06110.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF11424.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF15328.1| TIGR00156 family protein [Shigella sonnei]
gb|OCF20140.1| TIGR00156 family protein [Shigella sonnei]
emb|SCA72888.1| protein YgiW [Escherichia coli]
gb|OCJ85747.1| TIGR00156 family protein [Escherichia coli]
gb|OCJ90542.1| TIGR00156 family protein [Escherichia coli]
gb|OCJ93849.1| TIGR00156 family protein [Escherichia coli]
gb|OCJ96873.1| TIGR00156 family protein [Escherichia coli]
gb|OCK01479.1| TIGR00156 family protein [Escherichia coli]
gb|OCK71370.1| TIGR00156 family protein [Escherichia coli]
gb|ANW30254.1| TIGR00156 family protein [Escherichia coli]
gb|ANW41957.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OCO25899.1| TIGR00156 family protein [Escherichia coli]
gb|OCQ15132.1| hypothetical protein AGA39_12070 [Escherichia coli]
gb|OCQ19325.1| TIGR00156 family protein [Escherichia coli]
gb|OCQ33181.1| TIGR00156 family protein [Escherichia coli]
gb|OCQ45545.1| TIGR00156 family protein [Escherichia coli]
gb|OCS54352.1| TIGR00156 family protein [Escherichia coli]
gb|OCS57651.1| TIGR00156 family protein [Escherichia coli]
gb|OCS62489.1| TIGR00156 family protein [Escherichia coli]
gb|OCS71949.1| TIGR00156 family protein [Escherichia coli]
gb|OCS75072.1| TIGR00156 family protein [Escherichia coli]
gb|OCS79634.1| TIGR00156 family protein [Escherichia coli]
gb|OCT10261.1| TIGR00156 family protein [Escherichia coli]
gb|OCW55432.1| TIGR00156 family protein [Escherichia coli]
gb|OCW79391.1| TIGR00156 family protein [Escherichia coli]
gb|AOD09851.1| TIGR00156 family protein [Escherichia coli]
gb|ODA88923.1| TIGR00156 family protein [Escherichia coli]
gb|ODB48037.1| TIGR00156 family protein [Escherichia coli]
gb|ODB51005.1| TIGR00156 family protein [Escherichia coli]
gb|ODG68246.1| TIGR00156 family protein [Shigella sp. FC1661]
gb|ODG75251.1| TIGR00156 family protein [Shigella sp. FC2045]
gb|ODG82543.1| TIGR00156 family protein [Shigella sp. FC1764]
gb|ODG83436.1| TIGR00156 family protein [Shigella sp. FC2928]
gb|ODH17977.1| TIGR00156 family protein [Escherichia coli]
gb|ODH22828.1| TIGR00156 family protein [Escherichia coli]
gb|ODH31784.1| TIGR00156 family protein [Escherichia coli]
gb|ODH36770.1| TIGR00156 family protein [Escherichia coli]
gb|ODH43376.1| TIGR00156 family protein [Escherichia coli]
gb|ODJ23443.1| TIGR00156 family protein [Shigella sp. FC2383]
gb|ODJ29786.1| TIGR00156 family protein [Shigella sp. FC2833]
gb|ODJ36150.1| TIGR00156 family protein [Escherichia coli]
gb|ODJ40789.1| TIGR00156 family protein [Escherichia coli]
gb|AOM43781.1| Protein ygiW precursor [Escherichia coli]
gb|AOM71524.1| hypothetical protein MS6198_34970 [Escherichia coli]
gb|AOO71250.1| TIGR00156 family protein [Escherichia coli]
gb|OEB96707.1| TIGR00156 family protein [Escherichia coli]
gb|OEG27699.1| TIGR00156 family protein [Shigella sp. FC2117]
gb|OEG40328.1| TIGR00156 family protein [Shigella sp. FC2710]
gb|OEG68559.1| TIGR00156 family protein [Escherichia coli]
gb|AOR21259.1| TIGR00156 family protein [Escherichia coli]
gb|OEH99653.1| TIGR00156 family protein [Escherichia coli]
gb|OEI04307.1| TIGR00156 family protein [Escherichia coli]
gb|OEI12949.1| TIGR00156 family protein [Escherichia coli]
gb|OEI18842.1| TIGR00156 family protein [Escherichia coli]
gb|OEI27675.1| TIGR00156 family protein [Escherichia coli]
gb|OEI35183.1| TIGR00156 family protein [Escherichia coli]
gb|OEI45685.1| TIGR00156 family protein [Escherichia coli]
gb|OEI50765.1| TIGR00156 family protein [Escherichia coli]
gb|OEI51231.1| TIGR00156 family protein [Escherichia coli]
gb|OEI65327.1| TIGR00156 family protein [Escherichia coli]
gb|OEI96173.1| TIGR00156 family protein [Shigella sp. FC1567]
gb|OEL40962.1| TIGR00156 family protein [Escherichia coli]
gb|OEL44631.1| TIGR00156 family protein [Escherichia coli]
gb|OEL51874.1| TIGR00156 family protein [Escherichia coli]
gb|OEL52890.1| TIGR00156 family protein [Escherichia coli]
gb|OEL60386.1| TIGR00156 family protein [Escherichia coli]
gb|OEL63523.1| TIGR00156 family protein [Escherichia coli]
gb|OEL70533.1| TIGR00156 family protein [Escherichia coli]
gb|OEL80628.1| TIGR00156 family protein [Escherichia coli]
gb|OEL83130.1| TIGR00156 family protein [Escherichia coli]
gb|OEL89846.1| TIGR00156 family protein [Escherichia coli]
gb|OEL92823.1| TIGR00156 family protein [Escherichia coli]
gb|OEL99447.1| TIGR00156 family protein [Escherichia coli]
gb|OEM02778.1| TIGR00156 family protein [Escherichia coli]
gb|OEM10060.1| TIGR00156 family protein [Escherichia coli]
gb|OEM14595.1| TIGR00156 family protein [Escherichia coli]
gb|OEM17047.1| TIGR00156 family protein [Escherichia coli]
gb|OEM17522.1| TIGR00156 family protein [Escherichia coli]
gb|OEM28652.1| TIGR00156 family protein [Escherichia coli]
gb|OEM30132.1| TIGR00156 family protein [Escherichia coli]
gb|OEM36298.1| TIGR00156 family protein [Escherichia coli]
gb|OEM39951.1| TIGR00156 family protein [Escherichia coli]
gb|OEM46269.1| TIGR00156 family protein [Escherichia coli]
gb|OEM51820.1| TIGR00156 family protein [Escherichia coli]
gb|OEM59233.1| TIGR00156 family protein [Escherichia coli]
gb|OEM61212.1| TIGR00156 family protein [Escherichia coli]
gb|OEM66064.1| TIGR00156 family protein [Escherichia coli]
gb|OEM69386.1| TIGR00156 family protein [Escherichia coli]
gb|OEM75989.1| TIGR00156 family protein [Escherichia coli]
gb|OEM80028.1| TIGR00156 family protein [Escherichia coli]
gb|OEM87196.1| TIGR00156 family protein [Escherichia coli]
gb|OEM90608.1| TIGR00156 family protein [Escherichia coli]
gb|OEM92488.1| TIGR00156 family protein [Escherichia coli]
gb|OEN03138.1| TIGR00156 family protein [Escherichia coli]
gb|OEN05310.1| TIGR00156 family protein [Escherichia coli]
gb|OEN10359.1| TIGR00156 family protein [Escherichia coli]
gb|OEN14943.1| TIGR00156 family protein [Escherichia coli]
gb|OEN21998.1| TIGR00156 family protein [Escherichia coli]
gb|OEN25143.1| TIGR00156 family protein [Escherichia coli]
gb|OEN29216.1| TIGR00156 family protein [Escherichia coli]
gb|OEN36694.1| TIGR00156 family protein [Escherichia coli]
gb|OEN38948.1| TIGR00156 family protein [Escherichia coli]
gb|OEN43280.1| TIGR00156 family protein [Escherichia coli]
gb|OEN49739.1| TIGR00156 family protein [Escherichia coli]
gb|OEN51189.1| TIGR00156 family protein [Escherichia coli]
gb|OEN58627.1| TIGR00156 family protein [Escherichia coli]
gb|OEN60492.1| TIGR00156 family protein [Escherichia coli]
gb|OEN69411.1| TIGR00156 family protein [Escherichia coli]
gb|OEN72492.1| TIGR00156 family protein [Escherichia coli]
gb|OEN81638.1| TIGR00156 family protein [Escherichia coli]
gb|OEN87907.1| TIGR00156 family protein [Escherichia coli]
gb|OEN88188.1| TIGR00156 family protein [Escherichia coli]
gb|OEN97875.1| TIGR00156 family protein [Escherichia coli]
gb|OEN98005.1| TIGR00156 family protein [Escherichia coli]
gb|OEO01816.1| TIGR00156 family protein [Escherichia coli]
gb|OEO05356.1| TIGR00156 family protein [Escherichia coli]
gb|OEO12167.1| TIGR00156 family protein [Escherichia coli]
gb|OEO14646.1| TIGR00156 family protein [Escherichia coli]
gb|AOT31256.1| Protein ygiW precursor [Escherichia coli]
gb|AOV20055.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV25411.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV30761.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV36133.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV41541.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV46890.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|AOV52302.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OFE22172.1| TIGR00156 family protein [Escherichia coli]
emb|SDO55024.1| TIGR00156 family protein [Shigella sonnei]
gb|AOX50656.1| TIGR00156 family protein [Escherichia coli]
gb|AOX56059.1| TIGR00156 family protein [Escherichia coli]
gb|OHV13201.1| TIGR00156 family protein [Escherichia coli]
gb|OHW34418.1| TIGR00156 family protein [Escherichia coli]
emb|SEQ30963.1| TIGR00156 family protein [Escherichia coli]
gb|APA24910.1| hypothetical protein ATO45_05655 [Escherichia coli]
gb|OII50735.1| TIGR00156 family protein [Escherichia coli]
gb|OII55540.1| TIGR00156 family protein [Escherichia coli]
gb|APA40591.1| TIGR00156 family protein [Escherichia coli]
gb|OII81122.1| TIGR00156 family protein [Escherichia coli]
gb|OII91442.1| TIGR00156 family protein [Escherichia coli]
gb|OII92650.1| TIGR00156 family protein [Escherichia coli]
gb|OII96883.1| TIGR00156 family protein [Escherichia coli]
gb|OII98496.1| TIGR00156 family protein [Escherichia coli]
gb|OIJ07818.1| TIGR00156 family protein [Escherichia coli]
emb|SCQ11838.1| hypothetical protein ECK802_3498 [Escherichia coli]
gb|OIU74820.1| TIGR00156 family protein [Escherichia coli]
gb|OIU81831.1| TIGR00156 family protein [Escherichia coli]
gb|APC53196.1| TIGR00156 family protein [Escherichia coli str. K-12 substr. W3110]
gb|OIY21985.1| TIGR00156 family protein [Escherichia coli]
gb|OIY29272.1| TIGR00156 family protein [Escherichia coli]
gb|OIY32473.1| TIGR00156 family protein [Escherichia coli]
gb|OIY44939.1| TIGR00156 family protein [Escherichia coli]
gb|OIY46611.1| TIGR00156 family protein [Escherichia coli]
gb|OIY49415.1| TIGR00156 family protein [Escherichia coli]
gb|OIY51181.1| TIGR00156 family protein [Escherichia coli]
gb|OIY60471.1| TIGR00156 family protein [Escherichia coli]
gb|OIY64697.1| TIGR00156 family protein [Escherichia coli]
gb|OIY70947.1| TIGR00156 family protein [Escherichia coli]
gb|OIY72614.1| TIGR00156 family protein [Escherichia coli]
gb|OIY77282.1| TIGR00156 family protein [Escherichia coli]
gb|OIY82652.1| TIGR00156 family protein [Escherichia coli]
gb|OIY87665.1| TIGR00156 family protein [Escherichia coli]
gb|OIY92289.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ02731.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ06727.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ09981.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ18216.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ18974.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ27871.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ28847.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ70910.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ73790.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ81916.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ90606.1| TIGR00156 family protein [Escherichia coli]
gb|OIZ91642.1| TIGR00156 family protein [Escherichia coli]
gb|OJF21631.1| TIGR00156 family protein [Escherichia coli]
gb|OJF25543.1| TIGR00156 family protein [Escherichia coli]
gb|OJF27868.1| TIGR00156 family protein [Escherichia coli]
gb|OJF37383.1| TIGR00156 family protein [Escherichia coli]
gb|OJF38848.1| TIGR00156 family protein [Escherichia coli]
gb|OJF47702.1| TIGR00156 family protein [Escherichia coli]
gb|OJF54020.1| TIGR00156 family protein [Escherichia coli]
gb|OJF55051.1| TIGR00156 family protein [Escherichia coli]
gb|OJF63858.1| TIGR00156 family protein [Escherichia coli]
gb|OJF87962.1| hypothetical protein AQF51_03965 [Escherichia coli]
gb|APE54781.1| TIGR00156 family protein [Escherichia coli]
gb|APE59731.1| TIGR00156 family protein [Escherichia coli]
gb|APE64610.1| TIGR00156 family protein [Escherichia coli]
gb|APE69446.1| TIGR00156 family protein [Escherichia coli]
gb|APE78314.1| Protein ygiW precursor [Escherichia coli]
gb|APE90501.1| Protein ygiW precursor [Escherichia coli]
gb|OJH22422.1| TIGR00156 family protein [Escherichia coli NA114]
gb|APG35114.1| TIGR00156 family protein [Escherichia coli]
gb|API00159.1| TIGR00156 family protein [Escherichia coli]
gb|API05682.1| TIGR00156 family protein [Escherichia coli]
gb|API11235.1| TIGR00156 family protein [Escherichia coli]
gb|API16835.1| TIGR00156 family protein [Escherichia coli]
gb|API22485.1| TIGR00156 family protein [Escherichia coli]
gb|API27973.1| TIGR00156 family protein [Escherichia coli]
gb|API33637.1| TIGR00156 family protein [Escherichia coli]
gb|API39286.1| TIGR00156 family protein [Escherichia coli]
gb|API48962.1| TIGR00156 family protein [Escherichia coli]
gb|OJK15557.1| TIGR00156 family protein [Escherichia coli]
gb|OJK16058.1| TIGR00156 family protein [Escherichia coli]
gb|OJK16797.1| TIGR00156 family protein [Escherichia coli]
gb|OJK29235.1| TIGR00156 family protein [Escherichia coli]
gb|OJK33057.1| TIGR00156 family protein [Escherichia coli]
gb|OJK34769.1| TIGR00156 family protein [Escherichia coli]
gb|OJK37951.1| TIGR00156 family protein [Escherichia coli]
gb|OJK49950.1| TIGR00156 family protein [Escherichia coli]
gb|OJK52937.1| TIGR00156 family protein [Escherichia coli]
gb|OJK59837.1| TIGR00156 family protein [Escherichia coli]
gb|OJK61442.1| TIGR00156 family protein [Escherichia coli]
gb|OJK66338.1| TIGR00156 family protein [Escherichia coli]
gb|OJK74051.1| TIGR00156 family protein [Escherichia coli]
gb|OJK82793.1| TIGR00156 family protein [Escherichia coli]
gb|OJK87092.1| TIGR00156 family protein [Escherichia coli]
gb|OJK89783.1| TIGR00156 family protein [Escherichia coli]
gb|OJK94059.1| TIGR00156 family protein [Escherichia coli]
gb|OJK98334.1| TIGR00156 family protein [Escherichia coli]
gb|OJL05399.1| TIGR00156 family protein [Escherichia coli]
gb|OJL09541.1| TIGR00156 family protein [Escherichia coli]
gb|OJL19556.1| TIGR00156 family protein [Escherichia coli]
gb|OJL25040.1| TIGR00156 family protein [Escherichia coli]
gb|OJL36133.1| TIGR00156 family protein [Escherichia coli]
gb|OJL44416.1| TIGR00156 family protein [Escherichia coli]
gb|OJL51051.1| TIGR00156 family protein [Escherichia coli]
gb|OJL54531.1| TIGR00156 family protein [Escherichia coli]
gb|OJL66588.1| TIGR00156 family protein [Escherichia coli]
gb|OJL68961.1| TIGR00156 family protein [Escherichia coli]
gb|OJL75660.1| TIGR00156 family protein [Escherichia coli]
gb|OJL81971.1| TIGR00156 family protein [Escherichia coli]
gb|OJL82088.1| TIGR00156 family protein [Escherichia coli]
gb|OJL89554.1| TIGR00156 family protein [Escherichia coli]
gb|OJL98407.1| TIGR00156 family protein [Escherichia coli]
gb|OJM05273.1| TIGR00156 family protein [Escherichia coli]
gb|OJM06940.1| TIGR00156 family protein [Escherichia coli]
gb|OJM15352.1| TIGR00156 family protein [Escherichia coli]
gb|OJM25147.1| TIGR00156 family protein [Escherichia coli]
gb|OJM25188.1| TIGR00156 family protein [Escherichia coli]
gb|OJM33337.1| TIGR00156 family protein [Escherichia coli]
gb|OJM36478.1| TIGR00156 family protein [Escherichia coli]
gb|OJM40446.1| TIGR00156 family protein [Escherichia coli]
gb|OJM46914.1| TIGR00156 family protein [Escherichia coli]
gb|OJM52906.1| TIGR00156 family protein [Escherichia coli]
gb|OJM57572.1| TIGR00156 family protein [Escherichia coli]
gb|OJM58306.1| TIGR00156 family protein [Escherichia coli]
gb|OJM66007.1| TIGR00156 family protein [Escherichia coli]
gb|OJM70030.1| TIGR00156 family protein [Escherichia coli]
gb|OJM74779.1| TIGR00156 family protein [Escherichia coli]
gb|OJM78399.1| TIGR00156 family protein [Escherichia coli]
gb|OJM90439.1| TIGR00156 family protein [Escherichia coli]
gb|OJM93286.1| TIGR00156 family protein [Escherichia coli]
gb|OJM95921.1| TIGR00156 family protein [Escherichia coli]
gb|OJN04146.1| TIGR00156 family protein [Escherichia coli]
gb|OJN07594.1| TIGR00156 family protein [Escherichia coli]
gb|OJN07665.1| TIGR00156 family protein [Escherichia coli]
gb|OJN16558.1| TIGR00156 family protein [Escherichia coli]
gb|OJN22474.1| TIGR00156 family protein [Escherichia coli]
gb|OJN26824.1| TIGR00156 family protein [Escherichia coli]
gb|OJN29299.1| TIGR00156 family protein [Escherichia coli]
gb|OJN35814.1| TIGR00156 family protein [Escherichia coli]
gb|OJN48519.1| TIGR00156 family protein [Escherichia coli]
gb|OJN49954.1| TIGR00156 family protein [Escherichia coli]
gb|OJN52573.1| TIGR00156 family protein [Escherichia coli]
gb|OJN57599.1| TIGR00156 family protein [Escherichia coli]
gb|OJN62462.1| TIGR00156 family protein [Escherichia coli]
gb|OJN66604.1| TIGR00156 family protein [Escherichia coli]
gb|OJN72767.1| TIGR00156 family protein [Escherichia coli]
gb|OJN78191.1| TIGR00156 family protein [Escherichia coli]
gb|OJN82300.1| TIGR00156 family protein [Escherichia coli]
gb|OJN87032.1| TIGR00156 family protein [Escherichia coli]
gb|OJN97249.1| TIGR00156 family protein [Escherichia coli]
gb|OJN98136.1| TIGR00156 family protein [Escherichia coli]
gb|OJO05390.1| TIGR00156 family protein [Escherichia coli]
gb|OJO09933.1| TIGR00156 family protein [Escherichia coli]
gb|OJO22333.1| TIGR00156 family protein [Escherichia coli]
gb|OJO23437.1| TIGR00156 family protein [Escherichia coli]
gb|OJO28433.1| TIGR00156 family protein [Escherichia coli]
gb|OJO36076.1| TIGR00156 family protein [Escherichia coli]
gb|OJO41227.1| TIGR00156 family protein [Escherichia coli]
gb|OJO43044.1| TIGR00156 family protein [Escherichia coli]
gb|OJO54784.1| TIGR00156 family protein [Escherichia coli]
gb|OJO61761.1| TIGR00156 family protein [Escherichia coli]
gb|OJO66160.1| TIGR00156 family protein [Escherichia coli]
gb|OJO79677.1| TIGR00156 family protein [Escherichia coli]
gb|OJO80523.1| TIGR00156 family protein [Escherichia coli]
gb|OJO82833.1| TIGR00156 family protein [Escherichia coli]
gb|OJO96341.1| TIGR00156 family protein [Escherichia coli]
gb|OJP03972.1| TIGR00156 family protein [Escherichia coli]
gb|OJP10258.1| TIGR00156 family protein [Escherichia coli]
gb|OJP13751.1| TIGR00156 family protein [Escherichia coli]
gb|OJP21870.1| TIGR00156 family protein [Escherichia coli]
gb|OJP23382.1| TIGR00156 family protein [Escherichia coli]
gb|OJP28343.1| TIGR00156 family protein [Escherichia coli]
gb|OJP35317.1| TIGR00156 family protein [Escherichia coli]
gb|OJP35953.1| TIGR00156 family protein [Escherichia coli]
gb|OJP48908.1| TIGR00156 family protein [Escherichia coli]
gb|OJP51334.1| TIGR00156 family protein [Escherichia coli]
gb|OJP55236.1| TIGR00156 family protein [Escherichia coli]
gb|OJP61706.1| TIGR00156 family protein [Escherichia coli]
gb|OJP65483.1| TIGR00156 family protein [Escherichia coli]
gb|OJP71341.1| TIGR00156 family protein [Escherichia coli]
gb|OJP73958.1| TIGR00156 family protein [Escherichia coli]
gb|OJP77003.1| TIGR00156 family protein [Escherichia coli]
gb|OJP81326.1| TIGR00156 family protein [Escherichia coli]
gb|OJP85080.1| TIGR00156 family protein [Escherichia coli]
gb|OJP89698.1| TIGR00156 family protein [Escherichia coli]
gb|OJP92920.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ00199.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ05956.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ09363.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ11617.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ12740.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ23197.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ29958.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ37154.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ40385.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ44292.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ47769.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ49048.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ60333.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ66703.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ69387.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ72849.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ77506.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ82473.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ86623.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ94488.1| TIGR00156 family protein [Escherichia coli]
gb|OJQ96105.1| TIGR00156 family protein [Escherichia coli]
gb|OJR02819.1| TIGR00156 family protein [Escherichia coli]
gb|OJR05023.1| TIGR00156 family protein [Escherichia coli]
gb|OJR13998.1| TIGR00156 family protein [Escherichia coli]
gb|OJR15759.1| TIGR00156 family protein [Escherichia coli]
gb|OJR26225.1| TIGR00156 family protein [Escherichia coli]
gb|OJR32577.1| TIGR00156 family protein [Escherichia coli]
gb|OJR35119.1| TIGR00156 family protein [Escherichia coli]
gb|OJR38575.1| TIGR00156 family protein [Escherichia coli]
gb|OJR56844.1| TIGR00156 family protein [Escherichia coli]
gb|OJR60017.1| TIGR00156 family protein [Escherichia coli]
gb|OJR64168.1| TIGR00156 family protein [Escherichia coli]
gb|OJR71704.1| TIGR00156 family protein [Escherichia coli]
gb|OJR73453.1| TIGR00156 family protein [Escherichia coli]
gb|OJR80448.1| TIGR00156 family protein [Escherichia coli]
gb|OJR87742.1| TIGR00156 family protein [Escherichia coli]
gb|OJR94158.1| TIGR00156 family protein [Escherichia coli]
gb|OJR97338.1| TIGR00156 family protein [Escherichia coli]
gb|OJS01297.1| TIGR00156 family protein [Escherichia coli]
gb|OJS07076.1| TIGR00156 family protein [Escherichia coli]
gb|OJS14426.1| TIGR00156 family protein [Escherichia coli]
gb|OJS16970.1| TIGR00156 family protein [Escherichia coli]
gb|OJS21900.1| TIGR00156 family protein [Escherichia coli]
gb|OJS26707.1| TIGR00156 family protein [Escherichia coli]
gb|OJS28200.1| TIGR00156 family protein [Escherichia coli]
gb|OJS40049.1| TIGR00156 family protein [Escherichia coli]
gb|OJS41440.1| TIGR00156 family protein [Escherichia coli]
gb|OJS43175.1| TIGR00156 family protein [Escherichia coli]
gb|OJS48021.1| TIGR00156 family protein [Escherichia coli]
gb|OJS56088.1| TIGR00156 family protein [Escherichia coli]
gb|OJS60556.1| TIGR00156 family protein [Escherichia coli]
gb|OJS72967.1| TIGR00156 family protein [Escherichia coli]
gb|OJS80039.1| TIGR00156 family protein [Escherichia coli]
gb|OJS89229.1| TIGR00156 family protein [Escherichia coli]
gb|OJZ32393.1| TIGR00156 family protein [Escherichia coli]
gb|APJ59822.1| hypothetical protein RC72_22475 [Escherichia coli]
gb|APJ64130.1| hypothetical protein RG25_21055 [Escherichia coli]
gb|APJ66992.1| hypothetical protein RG26_11990 [Escherichia coli]
gb|APJ78398.1| hypothetical protein RG28_19965 [Escherichia coli]
gb|APJ83644.1| hypothetical protein RG30_18785 [Escherichia coli]
gb|APJ85769.1| hypothetical protein RG31_04240 [Escherichia coli]
gb|APJ89514.1| hypothetical protein RG32_00620 [Escherichia coli]
gb|APJ96866.1| hypothetical protein RG33_15270 [Escherichia coli]
gb|APK02159.1| hypothetical protein RG34_16405 [Escherichia coli]
gb|APK04975.1| hypothetical protein RG35_04585 [Escherichia coli]
gb|APK12329.1| hypothetical protein RG36_19515 [Escherichia coli]
gb|APK16984.1| hypothetical protein RG37_17725 [Escherichia coli]
gb|APK20709.1| hypothetical protein RG38_12635 [Escherichia coli]
gb|APK25753.1| hypothetical protein RG39_13995 [Escherichia coli]
gb|APK30609.1| hypothetical protein RG40_15235 [Escherichia coli]
gb|APK40556.1| hypothetical protein RG42_18545 [Escherichia coli]
gb|APK42464.1| hypothetical protein RG43_03885 [Escherichia coli]
gb|APK46245.1| hypothetical protein RG43_24960 [Escherichia coli]
gb|APK48209.1| hypothetical protein RG44_08230 [Escherichia coli]
gb|APK52148.1| hypothetical protein RG45_04970 [Escherichia coli]
gb|APK59552.1| hypothetical protein RG46_21535 [Escherichia coli]
gb|APK60415.1| hypothetical protein RG47_02235 [Escherichia coli]
gb|APK65378.1| hypothetical protein RG48_04495 [Escherichia coli]
gb|APK72415.1| hypothetical protein RG49_18205 [Escherichia coli]
gb|APK75257.1| hypothetical protein RG50_09060 [Escherichia coli]
gb|APK81296.1| hypothetical protein RG51_15345 [Escherichia coli]
gb|APK84891.1| hypothetical protein RG52_10065 [Escherichia coli]
gb|APK90242.1| hypothetical protein RG53_14760 [Escherichia coli]
gb|APK93968.1| hypothetical protein RG54_10295 [Escherichia coli]
gb|APK99557.1| hypothetical protein RG55_14165 [Escherichia coli]
gb|APL04758.1| hypothetical protein RG56_16325 [Escherichia coli]
gb|APL08838.1| hypothetical protein RG57_11075 [Escherichia coli]
gb|APL14541.1| hypothetical protein RG58_16305 [Escherichia coli]
gb|APL18167.1| hypothetical protein RG59_08625 [Escherichia coli]
gb|APL25703.1| hypothetical protein RG60_24485 [Escherichia coli]
gb|APL26924.1| hypothetical protein RG61_03510 [Escherichia coli]
gb|APL33115.1| hypothetical protein RG62_10185 [Escherichia coli]
gb|APL40594.1| hypothetical protein RG63_24705 [Escherichia coli]
gb|APL41353.1| hypothetical protein RG64_01295 [Escherichia coli]
gb|APL45808.1| hypothetical protein RG65_01310 [Escherichia coli]
gb|APL57035.1| hypothetical protein RG67_13115 [Escherichia coli]
gb|APL61280.1| hypothetical protein RG68_12125 [Escherichia coli]
gb|APL64674.1| hypothetical protein RG69_04285 [Escherichia coli]
gb|APL67917.1| hypothetical protein RG69_21800 [Escherichia coli]
gb|APL71785.1| hypothetical protein RG70_15290 [Escherichia coli]
gb|APL75879.1| hypothetical protein RG71_12795 [Escherichia coli]
gb|APL79336.1| hypothetical protein RG72_05920 [Escherichia coli]
gb|APL85274.1| hypothetical protein RG29_12030 [Escherichia coli]
gb|APL88712.1| hypothetical protein RG73_02345 [Escherichia coli]
gb|APL52070.1| hypothetical protein RG66_11415 [Escherichia coli]
gb|OKA57680.1| TIGR00156 family protein [Escherichia coli]
gb|OKB70748.1| TIGR00156 family protein [Escherichia coli]
gb|OKB73771.1| TIGR00156 family protein [Escherichia coli]
gb|OKB84211.1| TIGR00156 family protein [Escherichia coli]
gb|OKB91466.1| TIGR00156 family protein [Escherichia coli]
gb|OKB94277.1| TIGR00156 family protein [Escherichia coli]
gb|OKL78883.1| protein YgiW [Escherichia coli]
gb|OKL97114.1| protein YgiW [Escherichia coli]
gb|OKO60015.1| TIGR00156 family protein [Escherichia coli]
gb|OKP59745.1| TIGR00156 family protein [Escherichia coli]
gb|OKS70821.1| TIGR00156 family protein [Escherichia coli]
gb|OKS91395.1| TIGR00156 family protein [Escherichia coli]
gb|OKS95056.1| TIGR00156 family protein [Escherichia coli]
gb|OKS98148.1| TIGR00156 family protein [Escherichia coli]
gb|OKT05908.1| TIGR00156 family protein [Escherichia coli]
gb|OKT14527.1| TIGR00156 family protein [Escherichia coli]
gb|OKT17815.1| TIGR00156 family protein [Escherichia coli]
gb|OKT22034.1| TIGR00156 family protein [Escherichia coli]
gb|OKT27412.1| TIGR00156 family protein [Escherichia coli]
gb|OKT35509.1| TIGR00156 family protein [Escherichia coli]
gb|OKT45640.1| TIGR00156 family protein [Escherichia coli]
gb|OKT46693.1| TIGR00156 family protein [Escherichia coli]
gb|OKT49839.1| TIGR00156 family protein [Escherichia coli]
gb|OKT55408.1| TIGR00156 family protein [Escherichia coli]
gb|OKT58500.1| TIGR00156 family protein [Escherichia coli]
gb|OKT63174.1| TIGR00156 family protein [Escherichia coli]
gb|OKT73898.1| TIGR00156 family protein [Escherichia coli]
gb|OKT76115.1| TIGR00156 family protein [Escherichia coli]
gb|OKT84132.1| TIGR00156 family protein [Escherichia coli]
gb|OKT90220.1| TIGR00156 family protein [Escherichia coli]
gb|OKT91320.1| TIGR00156 family protein [Escherichia coli]
gb|OKT99333.1| TIGR00156 family protein [Escherichia coli]
gb|OKU02510.1| TIGR00156 family protein [Escherichia coli]
gb|OKU08390.1| TIGR00156 family protein [Escherichia coli]
gb|OKU13150.1| TIGR00156 family protein [Escherichia coli]
gb|OKU17257.1| TIGR00156 family protein [Escherichia coli]
gb|OKU20067.1| TIGR00156 family protein [Escherichia coli]
gb|OKU25402.1| TIGR00156 family protein [Escherichia coli]
gb|OKU36458.1| TIGR00156 family protein [Escherichia coli]
gb|OKU38079.1| TIGR00156 family protein [Escherichia coli]
gb|OKU45693.1| TIGR00156 family protein [Escherichia coli]
gb|OKU48654.1| TIGR00156 family protein [Escherichia coli]
gb|OKU54893.1| TIGR00156 family protein [Escherichia coli]
gb|OKU64969.1| TIGR00156 family protein [Escherichia coli]
gb|OKU65808.1| TIGR00156 family protein [Escherichia coli]
gb|OKU66003.1| TIGR00156 family protein [Escherichia coli]
gb|OKU75699.1| TIGR00156 family protein [Escherichia coli]
gb|OKU76035.1| TIGR00156 family protein [Escherichia coli]
gb|OKU86680.1| TIGR00156 family protein [Escherichia coli]
gb|OKU93345.1| TIGR00156 family protein [Escherichia coli]
gb|OKU97728.1| TIGR00156 family protein [Escherichia coli]
gb|OKV00438.1| TIGR00156 family protein [Escherichia coli]
gb|OKV06953.1| TIGR00156 family protein [Escherichia coli]
gb|OKV13689.1| TIGR00156 family protein [Escherichia coli]
gb|OKV14446.1| TIGR00156 family protein [Escherichia coli]
gb|OKV19772.1| TIGR00156 family protein [Escherichia coli]
gb|OKV32814.1| TIGR00156 family protein [Escherichia coli]
gb|OKV33711.1| TIGR00156 family protein [Escherichia coli]
gb|OKV36128.1| TIGR00156 family protein [Escherichia coli]
gb|OKV44878.1| TIGR00156 family protein [Escherichia coli]
gb|OKV48021.1| TIGR00156 family protein [Escherichia coli]
gb|OKV53313.1| TIGR00156 family protein [Escherichia coli]
gb|OKV58459.1| TIGR00156 family protein [Escherichia coli]
gb|OKV64363.1| TIGR00156 family protein [Escherichia coli]
gb|OKV66911.1| TIGR00156 family protein [Escherichia coli]
gb|OKV71501.1| TIGR00156 family protein [Escherichia coli]
gb|OKV85114.1| TIGR00156 family protein [Escherichia coli]
gb|OKV89703.1| TIGR00156 family protein [Escherichia coli]
gb|OKV96358.1| TIGR00156 family protein [Escherichia coli]
gb|OKV97735.1| TIGR00156 family protein [Escherichia coli]
gb|OKW02930.1| TIGR00156 family protein [Escherichia coli]
gb|OKW12234.1| TIGR00156 family protein [Escherichia coli]
gb|OKW21324.1| TIGR00156 family protein [Escherichia coli]
gb|OKW22800.1| TIGR00156 family protein [Escherichia coli]
gb|OKW29739.1| TIGR00156 family protein [Escherichia coli]
gb|OKW30871.1| TIGR00156 family protein [Escherichia coli]
gb|OKW37974.1| TIGR00156 family protein [Escherichia coli]
gb|OKW46764.1| TIGR00156 family protein [Escherichia coli]
gb|OKW47105.1| TIGR00156 family protein [Escherichia coli]
gb|OKW59173.1| TIGR00156 family protein [Escherichia coli]
gb|OKW61461.1| TIGR00156 family protein [Escherichia coli]
gb|OKW75251.1| TIGR00156 family protein [Escherichia coli]
gb|OKW77279.1| TIGR00156 family protein [Escherichia coli]
gb|OKW79082.1| TIGR00156 family protein [Escherichia coli]
gb|OKW85191.1| TIGR00156 family protein [Escherichia coli]
gb|OKW91586.1| TIGR00156 family protein [Escherichia coli]
gb|OKW97347.1| TIGR00156 family protein [Escherichia coli]
gb|OKW98734.1| TIGR00156 family protein [Escherichia coli]
gb|OKX02943.1| TIGR00156 family protein [Escherichia coli]
gb|OKX08084.1| TIGR00156 family protein [Escherichia coli]
gb|OKX13341.1| TIGR00156 family protein [Escherichia coli]
gb|OKX24104.1| TIGR00156 family protein [Escherichia coli]
gb|OKX24904.1| TIGR00156 family protein [Escherichia coli]
gb|OKX32109.1| TIGR00156 family protein [Escherichia coli]
gb|OKX39315.1| TIGR00156 family protein [Escherichia coli]
gb|OKX50270.1| TIGR00156 family protein [Escherichia coli]
gb|OKX53366.1| TIGR00156 family protein [Escherichia coli]
gb|OKX59464.1| TIGR00156 family protein [Escherichia coli]
gb|OKX72458.1| TIGR00156 family protein [Escherichia coli]
gb|OKX75717.1| TIGR00156 family protein [Escherichia coli]
gb|APQ20101.1| hypothetical protein BTD92_00708 [Escherichia coli]
gb|OLL68767.1| TIGR00156 family protein [Escherichia coli]
gb|APT01172.1| TIGR00156 family protein [Escherichia coli]
gb|OLN76966.1| hypothetical protein UG47_21960 [Escherichia coli]
gb|OLO98027.1| TIGR00156 family protein [Escherichia coli]
gb|APT60977.1| TIGR00156 family protein [Escherichia coli]
gb|OLR35631.1| hypothetical protein UG58_12680 [Escherichia coli O25b:H4-ST131]
gb|OLR88909.1| TIGR00156 family protein [Escherichia coli]
gb|OLS69898.1| TIGR00156 family protein [Escherichia coli]
gb|OLS70705.1| TIGR00156 family protein [Escherichia coli]
gb|OLS86895.1| TIGR00156 family protein [Escherichia coli]
gb|OLS88627.1| TIGR00156 family protein [Escherichia coli]
gb|OLS94073.1| TIGR00156 family protein [Escherichia coli]
gb|OLY56164.1| TIGR00156 family protein [Escherichia coli]
gb|OLY87807.1| TIGR00156 family protein [Escherichia coli O157:H43]
gb|OMG94317.1| TIGR00156 family protein [Escherichia coli]
gb|OMH06470.1| TIGR00156 family protein [Escherichia coli]
gb|OMH07368.1| TIGR00156 family protein [Escherichia coli]
gb|APW92167.1| TIGR00156 family protein [Escherichia coli]
gb|OMI42503.1| hypothetical protein MP33_20070 [Escherichia coli N37058PS]
gb|OMI52289.1| hypothetical protein MP35_19850 [Escherichia coli N40513]
gb|OMI52536.1| hypothetical protein Q676_14775 [Escherichia coli N40607]
gb|OMI54567.1| hypothetical protein MP34_04860 [Escherichia coli N37122PS]
gb|OMI63424.1| hypothetical protein EP55_23365 [Escherichia coli N37139PS]
gb|OMI70619.1| hypothetical protein MP31_14580 [Escherichia coli N36254PS]
gb|OMI72401.1| hypothetical protein MP32_04770 [Escherichia coli N36410PS]
emb|SIX17165.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW96852.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC78644.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC18511.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB16094.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC08723.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX16149.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI90142.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX45039.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH35690.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC63516.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB29397.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC32950.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC35507.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX03955.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA97129.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB76362.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC22302.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB72606.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB00256.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX17034.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB83468.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB02570.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX01517.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI12778.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX06021.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH37230.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA53826.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH72486.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA88077.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH30956.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW91303.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH36517.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB00003.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA86098.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB23573.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB25574.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB30831.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB47173.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH99070.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC07881.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB07447.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH97354.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW93026.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB33926.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ06355.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW75107.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW82927.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX08423.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX18368.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW77833.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI84528.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH76154.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW79315.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA28409.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA32693.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ33038.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC77601.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY37698.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA00345.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG28623.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH71973.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF43279.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH75482.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX04984.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA86374.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH51324.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH74069.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH06537.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW95936.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA68828.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG09081.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH72226.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC51013.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC18484.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB37314.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG16837.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA02396.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG37409.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG72415.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ10032.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ75097.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ95457.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW76349.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF91114.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA09242.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ39195.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ87714.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG11557.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG65628.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ02262.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ35376.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK28551.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA23507.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB12414.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY84333.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA95381.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF03453.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX13258.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW96926.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ58282.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA08556.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH22203.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI25809.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW89175.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ91052.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW93292.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH97184.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ09423.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ74623.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW95035.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB16698.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG77683.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ34100.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG80423.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK33557.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX92553.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW80661.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI09066.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA07862.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK28500.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ94020.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY79753.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX17378.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ04274.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI71514.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW77338.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI47775.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI11053.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI09982.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW73897.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ35065.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY91405.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI22334.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX11396.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF77017.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY84242.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA81643.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ09726.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA91499.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX46385.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC06471.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY97509.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI03988.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG96818.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ38945.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW78992.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK24474.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI03781.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW75176.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI78269.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ32107.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ30501.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ28906.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW86133.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW91227.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH86383.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI55892.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA82134.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ34465.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI72930.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG45287.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG02188.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI82692.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA55935.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA71072.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW70241.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ15921.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ71643.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX39580.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW74403.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG08938.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW72538.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI42636.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY96125.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ61568.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG35416.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG21287.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI65624.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY80031.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ92253.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH66137.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB59447.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY99132.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW88215.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX25605.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE49329.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI48623.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY89163.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ28825.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK07867.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE96359.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ91420.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ41485.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA43863.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI16440.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI72650.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ81777.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX46387.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ42251.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ00588.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG57496.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ98955.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY85171.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG30120.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ41505.1| Protein ygiW precursor [Shigella sonnei]
emb|SJH77122.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ10611.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF77913.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA42503.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA92137.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB08964.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI92495.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE75635.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI37541.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ63663.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF71695.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF31134.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC95411.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE87150.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA83038.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE71728.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF81632.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA32623.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ46623.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI78592.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB80721.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF37536.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE82761.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB88185.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ61801.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF84695.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI83246.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ18642.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF66805.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF56550.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE74712.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA98379.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ54244.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW81286.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG42678.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE24320.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE58043.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE82898.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF75609.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF34568.1| Protein ygiW precursor [Shigella sonnei]
emb|SJA85119.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF79451.1| Protein ygiW precursor [Shigella sonnei]
emb|SJK28787.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX19555.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD12239.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW74185.1| Protein ygiW precursor [Shigella sonnei]
emb|SJB87754.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX05909.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE90434.1| Protein ygiW precursor [Shigella sonnei]
emb|SIX22525.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD28312.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF83060.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE68878.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF50022.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG01284.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY86143.1| Protein ygiW precursor [Shigella sonnei]
emb|SJI14440.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF81440.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD60622.1| Protein ygiW precursor [Shigella sonnei]
emb|SIZ19610.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD22492.1| Protein ygiW precursor [Shigella sonnei]
emb|SJG10562.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD43174.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF36918.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE41479.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD36833.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD31020.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE18373.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF93905.1| Protein ygiW precursor [Shigella sonnei]
emb|SIW73204.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF36644.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ85926.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ58227.1| Protein ygiW precursor [Shigella sonnei]
emb|SIY94425.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF60978.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ84705.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD26775.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD34973.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD07395.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE06240.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC79532.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC73350.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC62582.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD03355.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE25215.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF70067.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC87819.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD15804.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD96138.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE89424.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE52934.1| Protein ygiW precursor [Shigella sonnei]
emb|SJF38576.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD37697.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE21160.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC96109.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE17087.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD63875.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD90032.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE13197.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE01063.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC97096.1| Protein ygiW precursor [Shigella sonnei]
emb|SJJ81791.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD41565.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC81345.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD08863.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC94210.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD92349.1| Protein ygiW precursor [Shigella sonnei]
emb|SJC95258.1| Protein ygiW precursor [Shigella sonnei]
emb|SJD74940.1| Protein ygiW precursor [Shigella sonnei]
emb|SJE03455.1| Protein ygiW precursor [Shigella sonnei]
gb|ONF83760.1| TIGR00156 family protein [Escherichia coli]
gb|ONG13394.1| TIGR00156 family protein [Escherichia coli]
gb|ONG22562.1| TIGR00156 family protein [Escherichia coli]
gb|ONG31248.1| TIGR00156 family protein [Escherichia coli]
gb|ONG34537.1| TIGR00156 family protein [Escherichia coli]
emb|SJK89942.1| conserved hypothetical protein [Escherichia coli]
gb|ONK41028.1| TIGR00156 family protein [Escherichia coli]
gb|ONK42895.1| TIGR00156 family protein [Escherichia coli]
gb|ONK53396.1| TIGR00156 family protein [Escherichia coli]
emb|SJL94939.1| Protein ygiW precursor [Shigella sonnei]
emb|SJL94465.1| Protein ygiW precursor [Shigella sonnei]
emb|SJL93533.1| Protein ygiW precursor [Shigella sonnei]
emb|SJL94116.1| Protein ygiW precursor [Shigella sonnei]
emb|SJL93954.1| Protein ygiW precursor [Shigella sonnei]
emb|SJL93843.1| Protein ygiW precursor [Shigella sonnei]
gb|ONN29410.1| hypothetical protein AYC64_18685 [Escherichia coli]
emb|SJM21632.1| Protein ygiW precursor [Shigella sonnei]
gb|OOC67620.1| TIGR00156 family protein [Escherichia coli]
gb|OOC82879.1| TIGR00156 family protein [Escherichia coli]
gb|OOD44316.1| TIGR00156 family protein [Escherichia coli]
gb|AQP92928.1| TIGR00156 family protein [Escherichia coli]
gb|OOG31235.1| TIGR00156 family protein [Escherichia coli]
gb|OOH59127.1| TIGR00156 family protein [Escherichia coli]
gb|OOH62139.1| TIGR00156 family protein [Escherichia coli]
gb|OOH74057.1| TIGR00156 family protein [Escherichia coli]
gb|OOH86184.1| TIGR00156 family protein [Escherichia coli]
gb|OOI15137.1| TIGR00156 family protein [Escherichia coli]
gb|OOI21775.1| TIGR00156 family protein [Escherichia coli]
gb|OOI21974.1| TIGR00156 family protein [Escherichia coli]
gb|OOI37523.1| TIGR00156 family protein [Escherichia coli]
gb|OOI39570.1| TIGR00156 family protein [Escherichia coli]
gb|OOI44894.1| TIGR00156 family protein [Escherichia coli]
gb|OOI51455.1| TIGR00156 family protein [Escherichia coli]
gb|OOI53139.1| TIGR00156 family protein [Escherichia coli]
gb|OOI58718.1| TIGR00156 family protein [Escherichia coli]
gb|OOI63726.1| TIGR00156 family protein [Escherichia coli]
gb|OOI70985.1| TIGR00156 family protein [Escherichia coli]
gb|OOI73491.1| TIGR00156 family protein [Escherichia coli]
gb|OOI78471.1| TIGR00156 family protein [Escherichia coli]
gb|OOI81149.1| TIGR00156 family protein [Escherichia coli]
gb|OOI93683.1| TIGR00156 family protein [Escherichia coli]
gb|OOI99290.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ01565.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ07108.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ09929.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ18318.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ21397.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ28628.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ35970.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ37915.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ41850.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ51962.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ52492.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ61649.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ62739.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ69357.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ78775.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ79355.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ86750.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ89728.1| TIGR00156 family protein [Escherichia coli]
gb|OOJ96631.1| TIGR00156 family protein [Escherichia coli]
gb|OOK02271.1| TIGR00156 family protein [Escherichia coli]
gb|OOK05888.1| TIGR00156 family protein [Escherichia coli]
gb|OOK11785.1| TIGR00156 family protein [Escherichia coli]
gb|OOK14493.1| TIGR00156 family protein [Escherichia coli]
gb|OOK21622.1| TIGR00156 family protein [Escherichia coli]
gb|OOK27225.1| TIGR00156 family protein [Escherichia coli]
gb|OOK34095.1| TIGR00156 family protein [Escherichia coli]
gb|OOK35724.1| TIGR00156 family protein [Escherichia coli]
gb|OOK56208.1| TIGR00156 family protein [Escherichia coli]
gb|OOM87131.1| TIGR00156 family protein [Escherichia coli]
gb|OON51452.1| TIGR00156 family protein [Escherichia coli]
gb|OON73659.1| TIGR00156 family protein [Escherichia coli]
gb|AQU00790.1| TIGR00156 family protein [Escherichia coli]
gb|AQU94114.1| TIGR00156 family protein [Escherichia coli]
gb|OOO76651.1| TIGR00156 family protein [Shigella boydii]
gb|OOO84574.1| TIGR00156 family protein [Shigella boydii]
gb|OOO86034.1| TIGR00156 family protein [Shigella sonnei]
gb|OOO98196.1| TIGR00156 family protein [Shigella dysenteriae]
gb|OOP14832.1| TIGR00156 family protein [Shigella flexneri]
gb|OOP30915.1| TIGR00156 family protein [Shigella flexneri]
gb|OOP36794.1| TIGR00156 family protein [Shigella sonnei]
gb|AQV18985.1| TIGR00156 family protein [Escherichia coli]
gb|AQV24997.1| TIGR00156 family protein [Escherichia coli]
gb|AQV29144.1| TIGR00156 family protein [Escherichia coli]
gb|AQV34419.1| TIGR00156 family protein [Escherichia coli]
gb|AQV40895.1| TIGR00156 family protein [Escherichia coli]
gb|AQV47314.1| TIGR00156 family protein [Escherichia coli]
gb|AQV54272.1| TIGR00156 family protein [Escherichia coli]
gb|AQV56329.1| TIGR00156 family protein [Escherichia coli]
gb|AQV63295.1| TIGR00156 family protein [Escherichia coli]
gb|AQV69593.1| TIGR00156 family protein [Escherichia coli]
gb|AQV73475.1| TIGR00156 family protein [Escherichia coli]
gb|AQV77409.1| TIGR00156 family protein [Escherichia coli]
gb|AQV84575.1| TIGR00156 family protein [Escherichia coli]
gb|AQV91958.1| TIGR00156 family protein [Escherichia coli]
gb|AQW00651.1| TIGR00156 family protein [Escherichia coli]
gb|AQW07800.1| TIGR00156 family protein [Escherichia coli]
gb|AQW12509.1| TIGR00156 family protein [Escherichia coli]
gb|AQW15849.1| TIGR00156 family protein [Escherichia coli]
gb|OOV70041.1| TIGR00156 family protein [Escherichia coli]
gb|OOW20213.1| TIGR00156 family protein [Escherichia coli]
gb|OOW20410.1| TIGR00156 family protein [Escherichia coli]
gb|OOW29722.1| TIGR00156 family protein [Escherichia coli]
gb|AQW74708.1| TIGR00156 family protein [Escherichia coli M8]
gb|AQX98309.1| TIGR00156 family protein [Escherichia coli NU14]
gb|OPH64077.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OPH69560.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OPH72758.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OPI27820.1| TIGR00156 family protein [Escherichia coli]
gb|OPI32547.1| TIGR00156 family protein [Escherichia coli]
gb|OPI38136.1| TIGR00156 family protein [Escherichia coli]
gb|OPI44254.1| TIGR00156 family protein [Escherichia coli]
gb|OPI47654.1| TIGR00156 family protein [Escherichia coli]
gb|OPI57420.1| TIGR00156 family protein [Escherichia coli]
gb|OPI63069.1| TIGR00156 family protein [Escherichia coli]
gb|OPI68656.1| TIGR00156 family protein [Escherichia coli]
gb|OPI69373.1| TIGR00156 family protein [Escherichia coli]
gb|OPI78303.1| TIGR00156 family protein [Escherichia coli]
gb|OPI80625.1| TIGR00156 family protein [Escherichia coli]
gb|OPI90200.1| TIGR00156 family protein [Escherichia coli]
gb|OPI94199.1| TIGR00156 family protein [Escherichia coli]
gb|OPI95665.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ05974.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ07080.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ12443.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ14423.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ19108.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ25542.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ30358.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ35243.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ39061.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ45890.1| TIGR00156 family protein [Escherichia coli]
gb|OPJ51875.1| TIGR00156 family protein [Escherichia coli]
gb|AQZ29115.1| TIGR00156 family protein [Escherichia coli]
gb|AQZ84778.1| TIGR00156 family protein [Escherichia coli]
gb|ARA00925.1| TIGR00156 family protein [Escherichia coli]
gb|ARA09417.1| TIGR00156 family protein [Escherichia coli]
gb|ARA18637.1| TIGR00156 family protein [Escherichia coli]
gb|ARA30796.1| TIGR00156 family protein [Escherichia coli]
gb|ARA37780.1| TIGR00156 family protein [Escherichia coli]
gb|ARA62449.1| TIGR00156 family protein [Escherichia coli]
gb|OQK69957.1| TIGR00156 family protein [Shigella sonnei]
gb|ARD52804.1| TIGR00156 family protein [Escherichia coli]
gb|ARD78348.1| hypothetical protein AYL54_11805 [Escherichia coli]
gb|ARD82218.1| hypothetical protein AYR48_11800 [Escherichia coli]
gb|ARE46265.1| TIGR00156 family protein [Escherichia coli C]
dbj|BAX12487.1| hypothetical protein MRY16002_c31530 [Escherichia coli]
dbj|BAX17594.1| hypothetical protein MRY15117_c31840 [Escherichia coli]
dbj|BAX22467.1| hypothetical protein MRY15131_c31250 [Escherichia coli]
gb|ORC95888.1| TIGR00156 family protein [Escherichia coli]
gb|ORC96792.1| TIGR00156 family protein [Escherichia coli]
gb|ORD05222.1| TIGR00156 family protein [Escherichia coli]
gb|ORD20836.1| TIGR00156 family protein [Escherichia coli]
gb|ORD26729.1| TIGR00156 family protein [Escherichia coli]
gb|ORD36044.1| TIGR00156 family protein [Escherichia coli]
gb|ORD38149.1| TIGR00156 family protein [Escherichia coli]
gb|ORD51657.1| TIGR00156 family protein [Escherichia coli]
gb|ORD59838.1| TIGR00156 family protein [Escherichia coli]
gb|ORD68507.1| TIGR00156 family protein [Escherichia coli]
gb|ORD72292.1| TIGR00156 family protein [Escherichia coli]
gb|ORD88045.1| TIGR00156 family protein [Escherichia coli]
gb|ORD92389.1| TIGR00156 family protein [Escherichia coli]
gb|ORE74296.1| TIGR00156 family protein [Escherichia coli]
gb|ORE74986.1| TIGR00156 family protein [Escherichia coli]
gb|ARH98646.1| hydrogen peroxide and cadmium resistance periplasmic protein
[Escherichia coli]
gb|ORJ74934.1| TIGR00156 family protein [Escherichia coli]
gb|ORR79804.1| TIGR00156 family protein [Escherichia coli]
gb|ORR80115.1| TIGR00156 family protein [Escherichia coli]
gb|ORR88566.1| TIGR00156 family protein [Escherichia coli]
gb|ORR91702.1| TIGR00156 family protein [Escherichia coli]
gb|ORR93178.1| TIGR00156 family protein [Escherichia coli]
gb|ORS03639.1| TIGR00156 family protein [Escherichia coli]
gb|ORS05085.1| TIGR00156 family protein [Escherichia coli]
gb|ORS08193.1| TIGR00156 family protein [Escherichia coli]
gb|ORS16438.1| TIGR00156 family protein [Escherichia coli]
gb|ORS19715.1| TIGR00156 family protein [Escherichia coli]
gb|ORS21157.1| TIGR00156 family protein [Escherichia coli]
gb|ORS30599.1| TIGR00156 family protein [Escherichia coli]
gb|ORS33355.1| TIGR00156 family protein [Escherichia coli]
gb|ORS34228.1| TIGR00156 family protein [Escherichia coli]
gb|ORS45681.1| TIGR00156 family protein [Escherichia coli]
gb|ORS46022.1| TIGR00156 family protein [Escherichia coli]
gb|ORS53260.1| TIGR00156 family protein [Escherichia coli]
gb|ORS60380.1| TIGR00156 family protein [Escherichia coli]
gb|ORS62894.1| TIGR00156 family protein [Escherichia coli]
gb|ORS68180.1| TIGR00156 family protein [Escherichia coli]
gb|ORS73930.1| TIGR00156 family protein [Escherichia coli]
gb|ORS74606.1| TIGR00156 family protein [Escherichia coli]
gb|ORS82608.1| TIGR00156 family protein [Escherichia coli]
gb|ORS89305.1| TIGR00156 family protein [Escherichia coli]
gb|ORS89500.1| TIGR00156 family protein [Escherichia coli]
gb|ORS99768.1| TIGR00156 family protein [Escherichia coli]
gb|ORT00926.1| TIGR00156 family protein [Escherichia coli]
gb|ORT04958.1| TIGR00156 family protein [Escherichia coli]
gb|ORT14007.1| TIGR00156 family protein [Escherichia coli]
gb|ORT17834.1| TIGR00156 family protein [Escherichia coli]
gb|ORT18241.1| TIGR00156 family protein [Escherichia coli]
gb|ORT28221.1| TIGR00156 family protein [Escherichia coli]
gb|ORT32436.1| TIGR00156 family protein [Escherichia coli]
gb|ORT38113.1| TIGR00156 family protein [Escherichia coli]
gb|ORT43136.1| TIGR00156 family protein [Escherichia coli]
emb|SMB23283.1| Protein ygiW precursor [Escherichia coli]
emb|SMB23282.1| Protein ygiW precursor [Escherichia coli]
gb|OSB86125.1| TIGR00156 family protein [Escherichia coli]
gb|OSB93865.1| TIGR00156 family protein [Escherichia coli]
gb|OSC11271.1| TIGR00156 family protein [Escherichia coli]
gb|OSC14122.1| TIGR00156 family protein [Escherichia coli]
gb|OSC19447.1| TIGR00156 family protein [Escherichia coli]
emb|SMH32482.1| TIGR00156 family protein [Escherichia coli]
gb|OSK03022.1| hypothetical protein L082_13784 [Escherichia coli SHECO001]
gb|OSK09571.1| hypothetical protein EAOG_04183 [Escherichia coli R527]
gb|OSK13373.1| protein YgiW [Escherichia coli FVEC1465]
gb|OSK20933.1| protein YgiW [Escherichia coli M056]
gb|OSK23393.1| protein YgiW [Escherichia coli TA144]
gb|OSK25983.1| protein YgiW [Escherichia coli B574]
gb|OSK35976.1| protein YgiW [Escherichia coli E267]
gb|OSK37442.1| protein YgiW [Escherichia coli B671]
gb|OSK49349.1| protein YgiW [Escherichia coli H588]
gb|OSK54052.1| protein YgiW [Escherichia coli H413]
gb|OSK60666.1| protein YgiW [Escherichia coli E560]
gb|OSK64399.1| protein YgiW [Escherichia coli B921]
gb|OSK65373.1| protein YgiW [Escherichia coli E1114]
gb|OSK72622.1| protein YgiW [Escherichia coli H223]
gb|OSK75412.1| protein YgiW [Escherichia coli H001]
gb|OSK85212.1| protein YgiW [Escherichia coli B367]
gb|OSK92771.1| protein YgiW [Escherichia coli TA447]
gb|OSK96863.1| protein YgiW [Escherichia coli E1002]
gb|OSL03972.1| protein YgiW [Escherichia coli H386]
gb|OSL04763.1| protein YgiW [Escherichia coli H296]
gb|OSL11143.1| protein YgiW [Escherichia coli H305]
gb|OSL17794.1| protein YgiW [Escherichia coli B175]
gb|OSL22518.1| protein YgiW [Escherichia coli H617]
gb|OSL26752.1| protein YgiW [Escherichia coli TA255]
gb|OSL35750.1| protein YgiW [Escherichia coli TA464]
gb|OSL42781.1| protein YgiW [Escherichia coli H461]
gb|OSL53765.1| protein YgiW [Escherichia coli H454]
gb|OSL54132.1| protein YgiW [Escherichia coli H383]
gb|OSL60310.1| protein YgiW [Escherichia coli H420]
gb|OSL69252.1| protein YgiW [Escherichia coli TA054]
gb|OSL69692.1| protein YgiW [Escherichia coli TA008]
gb|OSL82906.1| protein YgiW [Escherichia coli TA249]
gb|OSL89226.1| protein YgiW [Escherichia coli E704]
gb|OSL90247.1| protein YgiW [Escherichia coli T426]
gb|OSL99908.1| protein YgiW [Escherichia coli R424]
gb|OSM86155.1| hypothetical protein L317_12143 [Escherichia coli SHECO003]
gb|OSM92235.1| hypothetical protein L316_08038 [Escherichia coli SHECO002]
gb|OSP31643.1| TIGR00156 family protein [Escherichia coli]
gb|ARM41563.1| hypothetical protein AWH44_13575 [Escherichia coli]
gb|OSQ37543.1| TIGR00156 family protein [Escherichia coli]
gb|ARM78324.1| TIGR00156 family protein [Escherichia coli]
gb|ARQ24750.1| TIGR00156 family protein [Escherichia coli]
gb|OTA10418.1| TIGR00156 family protein [Escherichia coli]
gb|OTB22254.1| TIGR00156 family protein [Escherichia coli]
gb|OTB27008.1| TIGR00156 family protein [Escherichia coli]
gb|OTB32488.1| TIGR00156 family protein [Escherichia coli]
gb|OTB34524.1| TIGR00156 family protein [Escherichia coli]
gb|OTB43354.1| TIGR00156 family protein [Escherichia coli]
gb|OTB50635.1| TIGR00156 family protein [Escherichia coli]
gb|OTB59482.1| TIGR00156 family protein [Escherichia coli]
gb|OTB62182.1| TIGR00156 family protein [Escherichia coli]
gb|OTB65584.1| TIGR00156 family protein [Escherichia coli]
gb|OTB67943.1| TIGR00156 family protein [Escherichia coli]
gb|OTB75329.1| TIGR00156 family protein [Escherichia coli]
gb|OTB83910.1| TIGR00156 family protein [Escherichia coli]
gb|OTB86383.1| TIGR00156 family protein [Escherichia coli]
gb|OTB93298.1| TIGR00156 family protein [Escherichia coli]
gb|OTB95056.1| TIGR00156 family protein [Escherichia coli]
gb|OTB99959.1| TIGR00156 family protein [Escherichia coli]
gb|OTC04149.1| TIGR00156 family protein [Escherichia coli]
gb|OTC12812.1| TIGR00156 family protein [Escherichia coli]
gb|OTC14833.1| TIGR00156 family protein [Escherichia coli]
gb|OTC23782.1| TIGR00156 family protein [Escherichia coli]
gb|OTC25692.1| TIGR00156 family protein [Escherichia coli]
gb|OTC30307.1| TIGR00156 family protein [Escherichia coli]
gb|OTC39311.1| TIGR00156 family protein [Escherichia coli]
gb|OTC49243.1| TIGR00156 family protein [Escherichia coli]
gb|OTC56312.1| TIGR00156 family protein [Escherichia coli]
gb|OTC59896.1| TIGR00156 family protein [Escherichia coli]
gb|OTC65400.1| TIGR00156 family protein [Escherichia coli]
gb|OTC70469.1| TIGR00156 family protein [Escherichia coli]
gb|OTC78097.1| TIGR00156 family protein [Escherichia coli]
gb|OTC81711.1| TIGR00156 family protein [Escherichia coli]
gb|OTC91320.1| TIGR00156 family protein [Escherichia coli]
gb|OTC92240.1| TIGR00156 family protein [Escherichia coli]
gb|OTC98365.1| TIGR00156 family protein [Escherichia coli]
gb|OTD00358.1| TIGR00156 family protein [Escherichia coli]
gb|OTD08425.1| TIGR00156 family protein [Escherichia coli]
gb|OTD14072.1| TIGR00156 family protein [Escherichia coli]
gb|OTD21237.1| TIGR00156 family protein [Escherichia coli]
gb|OTD21872.1| TIGR00156 family protein [Escherichia coli]
gb|OTD26832.1| TIGR00156 family protein [Escherichia coli]
gb|OTD39710.1| TIGR00156 family protein [Escherichia coli]
gb|OTD42370.1| TIGR00156 family protein [Escherichia coli]
gb|OTD43816.1| TIGR00156 family protein [Escherichia coli]
gb|OTD51767.1| TIGR00156 family protein [Escherichia coli]
gb|OTD53647.1| TIGR00156 family protein [Escherichia coli]
gb|OTD59188.1| TIGR00156 family protein [Escherichia coli]
gb|OTD63194.1| TIGR00156 family protein [Escherichia coli]
gb|OTD71704.1| TIGR00156 family protein [Escherichia coli]
gb|OTD77595.1| TIGR00156 family protein [Escherichia coli]
gb|OTD79436.1| TIGR00156 family protein [Escherichia coli]
gb|OTD84742.1| TIGR00156 family protein [Escherichia coli]
gb|OTD92614.1| TIGR00156 family protein [Escherichia coli]
gb|OTD97404.1| TIGR00156 family protein [Escherichia coli]
gb|OTD99783.1| TIGR00156 family protein [Escherichia coli]
gb|OTE07186.1| TIGR00156 family protein [Escherichia coli]
gb|OTE10405.1| TIGR00156 family protein [Escherichia coli]
gb|OTE15398.1| TIGR00156 family protein [Escherichia coli]
gb|OTE25231.1| TIGR00156 family protein [Escherichia coli]
gb|OTE28356.1| TIGR00156 family protein [Escherichia coli]
gb|OTE35520.1| TIGR00156 family protein [Escherichia coli]
gb|OTE40097.1| TIGR00156 family protein [Escherichia coli]
gb|OTE43656.1| TIGR00156 family protein [Escherichia coli]
gb|OTE47925.1| TIGR00156 family protein [Escherichia coli]
gb|OTE53843.1| TIGR00156 family protein [Escherichia coli]
gb|OTE61203.1| TIGR00156 family protein [Escherichia coli]
gb|OTE68970.1| TIGR00156 family protein [Escherichia coli]
gb|OTE70769.1| TIGR00156 family protein [Escherichia coli]
gb|OTE75640.1| TIGR00156 family protein [Escherichia coli]
gb|OTE79403.1| TIGR00156 family protein [Escherichia coli]
gb|OTE86480.1| TIGR00156 family protein [Escherichia coli]
gb|OTE91237.1| TIGR00156 family protein [Escherichia coli]
gb|ARR33631.1| TIGR00156 family protein [Escherichia coli]
gb|ARR40589.1| TIGR00156 family protein [Shigella sonnei]
gb|ARR62471.1| TIGR00156 family protein [Escherichia coli]
gb|ARR65500.1| TIGR00156 family protein [Escherichia coli]
gb|OTU97048.1| TIGR00156 family protein [Escherichia coli]
gb|OTV02752.1| TIGR00156 family protein [Escherichia coli]
gb|OTV08568.1| TIGR00156 family protein [Escherichia coli]
gb|OTV16426.1| TIGR00156 family protein [Escherichia coli]
gb|OTV17178.1| TIGR00156 family protein [Escherichia coli]
gb|OTV18020.1| TIGR00156 family protein [Escherichia coli]
gb|OTV33469.1| TIGR00156 family protein [Escherichia coli]
gb|OTV35387.1| TIGR00156 family protein [Escherichia coli]
gb|OUD18771.1| TIGR00156 family protein [Escherichia coli M4]
gb|ARS05158.1| TIGR00156 family protein [Shigella sonnei]
gb|OUF52213.1| protein YgiW [Escherichia coli]
gb|OUF64124.1| protein YgiW [Escherichia coli]
gb|OUF67414.1| protein YgiW [Escherichia coli]
gb|OUF70458.1| protein YgiW [Escherichia coli]
gb|OUF78484.1| protein YgiW [Escherichia coli]
gb|OUF81004.1| protein YgiW [Escherichia coli]
gb|OUF85408.1| protein YgiW [Escherichia coli]
gb|OUF93604.1| protein YgiW [Escherichia coli]
gb|OUF95146.1| protein YgiW [Escherichia coli]
gb|OUF98061.1| protein YgiW [Escherichia coli]
gb|OUG04976.1| protein YgiW [Escherichia coli]
gb|OUG11506.1| protein YgiW [Escherichia coli]
gb|OUG13815.1| protein YgiW [Escherichia coli]
gb|OUG20097.1| protein YgiW [Escherichia coli]
gb|OUG23225.1| protein YgiW [Escherichia coli]
gb|OUG31799.1| protein YgiW [Escherichia coli]
gb|OUG33296.1| protein YgiW [Escherichia coli]
gb|OUJ58517.1| TIGR00156 family protein [Escherichia coli]
gb|OUJ63827.1| TIGR00156 family protein [Escherichia coli]
gb|OUJ92131.1| TIGR00156 family protein [Escherichia coli]
gb|OUK49713.1| TIGR00156 family protein [Escherichia coli]
gb|OUK51107.1| TIGR00156 family protein [Escherichia coli]
gb|OUK72307.1| TIGR00156 family protein [Escherichia coli]
gb|OUK83750.1| TIGR00156 family protein [Escherichia coli]
gb|OUK97153.1| TIGR00156 family protein [Escherichia coli]
gb|OUL15926.1| TIGR00156 family protein [Escherichia coli]
gb|ART18385.1| hypothetical protein EC95JB1_02401 [Escherichia coli]
gb|ART26165.1| hypothetical protein EC95NR1_02398 [Escherichia coli]
gb|ART42610.1| stress-induced protein [Escherichia coli]
gb|OUP42875.1| TIGR00156 family protein [Escherichia coli]
gb|OUR43544.1| protein YgiW [Escherichia coli]
gb|OUR45606.1| protein YgiW [Escherichia coli]
gb|OUR48797.1| protein YgiW [Escherichia coli]
gb|ARV29067.1| TIGR00156 family protein [Escherichia coli]
gb|ARV33936.1| TIGR00156 family protein [Escherichia coli]
gb|ARV48332.1| TIGR00156 family protein [Escherichia coli]
gb|ARV54823.1| TIGR00156 family protein [Escherichia coli]
gb|OUZ68228.1| TIGR00156 family protein [Shigella sonnei]
gb|OUZ81045.1| TIGR00156 family protein [Shigella flexneri]
gb|OUZ85874.1| TIGR00156 family protein [Shigella flexneri]
gb|OUZ95090.1| TIGR00156 family protein [Shigella sonnei]
gb|OUZ98443.1| TIGR00156 family protein [Shigella sonnei]
gb|OVA40465.1| hypothetical protein UP76_23370 [Escherichia coli]
gb|OVA44552.1| hypothetical protein UP79_07080 [Escherichia coli]
gb|OVA52955.1| hypothetical protein UP77_01540 [Escherichia coli]
gb|OVA56790.1| hypothetical protein UP83_16205 [Escherichia coli]
gb|OVA64424.1| hypothetical protein UP92_17735 [Escherichia coli]
gb|OVA67028.1| hypothetical protein UP86_00120 [Escherichia coli]
gb|OVA71403.1| hypothetical protein UP94_18090 [Escherichia coli]
gb|OVA74112.1| hypothetical protein UP98_24435 [Escherichia coli]
gb|OVA82207.1| hypothetical protein UQ00_12625 [Escherichia coli]
gb|OVA91207.1| hypothetical protein UQ01_04300 [Escherichia coli]
gb|OVA92181.1| hypothetical protein UQ02_21940 [Escherichia coli]
gb|OVA96216.1| hypothetical protein UQ04_17970 [Escherichia coli]
gb|OVB08794.1| hypothetical protein UQ05_00590 [Escherichia coli]
gb|OVB14769.1| hypothetical protein UQ07_06525 [Escherichia coli]
gb|OVB17562.1| hypothetical protein UQ06_03010 [Escherichia coli]
gb|OVB22861.1| hypothetical protein UQ11_08885 [Escherichia coli]
gb|OVB28483.1| hypothetical protein UQ12_19395 [Escherichia coli]
gb|OVB30068.1| hypothetical protein UQ16_04920 [Escherichia coli]
gb|OVB36448.1| hypothetical protein UQ20_18035 [Escherichia coli]
gb|OVB40070.1| hypothetical protein UQ26_22525 [Escherichia coli]
gb|OVB50880.1| hypothetical protein UQ27_00210 [Escherichia coli]
gb|OVB55776.1| hypothetical protein UQ38_04580 [Escherichia coli]
gb|OVB62982.1| hypothetical protein UQ42_02845 [Escherichia coli]
gb|OVB64114.1| hypothetical protein UQ43_13775 [Escherichia coli]
gb|OVB72627.1| hypothetical protein UP72_01570 [Escherichia coli]
gb|OVB74422.1| hypothetical protein UP74_18925 [Escherichia coli]
gb|OVB81882.1| hypothetical protein UP75_08080 [Escherichia coli]
gb|OVB85646.1| hypothetical protein UP73_16090 [Escherichia coli]
gb|OVB92215.1| hypothetical protein UP78_12015 [Escherichia coli]
gb|OVB97922.1| hypothetical protein UP80_09345 [Escherichia coli]
gb|OVC04164.1| hypothetical protein UP81_04755 [Escherichia coli]
gb|OVC11427.1| hypothetical protein UP82_01290 [Escherichia coli]
gb|OVC14149.1| hypothetical protein UP84_09810 [Escherichia coli]
gb|OVC20056.1| hypothetical protein UP85_07995 [Escherichia coli]
gb|OVC24816.1| hypothetical protein UP87_11315 [Escherichia coli]
gb|OVC31348.1| hypothetical protein UP88_02530 [Escherichia coli]
gb|OVC35078.1| hypothetical protein UP89_13295 [Escherichia coli]
gb|OVC41615.1| hypothetical protein UP91_20930 [Escherichia coli]
gb|OVC42741.1| hypothetical protein UP90_06785 [Escherichia coli]
gb|OVC51392.1| hypothetical protein UP93_09415 [Escherichia coli]
gb|OVC59228.1| hypothetical protein UP96_16805 [Escherichia coli]
gb|OVC61304.1| hypothetical protein UP95_00610 [Escherichia coli]
gb|OVC69979.1| hypothetical protein UP97_00180 [Escherichia coli]
gb|OVC74454.1| hypothetical protein UP99_10150 [Escherichia coli]
gb|OVC77855.1| hypothetical protein UQ03_13320 [Escherichia coli]
gb|OVC83457.1| hypothetical protein UQ08_12325 [Escherichia coli]
gb|OVC95250.1| hypothetical protein UQ10_05975 [Escherichia coli]
gb|OVC96192.1| hypothetical protein UQ09_01430 [Escherichia coli]
gb|OVD01677.1| hypothetical protein UQ13_08150 [Escherichia coli]
gb|OVD06968.1| hypothetical protein UQ14_19960 [Escherichia coli]
gb|OVD07544.1| hypothetical protein UQ15_10485 [Escherichia coli]
gb|OVD14550.1| hypothetical protein UQ17_22645 [Escherichia coli]
gb|OVD24427.1| hypothetical protein UQ19_18000 [Escherichia coli]
gb|OVD26322.1| hypothetical protein UQ18_00840 [Escherichia coli]
gb|OVD33899.1| hypothetical protein UQ21_13085 [Escherichia coli]
gb|OVD40500.1| hypothetical protein UQ22_06600 [Escherichia coli]
gb|OVD42904.1| hypothetical protein UQ23_12755 [Escherichia coli]
gb|OVD51443.1| hypothetical protein UQ25_15840 [Escherichia coli]
gb|OVD54601.1| hypothetical protein UQ24_01160 [Escherichia coli]
gb|OVD60688.1| hypothetical protein UQ28_05165 [Escherichia coli]
gb|OVD67810.1| hypothetical protein UQ29_05420 [Escherichia coli]
gb|OVD68988.1| hypothetical protein UQ30_14885 [Escherichia coli]
gb|OVD74020.1| hypothetical protein UQ31_18685 [Escherichia coli]
gb|OVD80296.1| hypothetical protein UQ32_18530 [Escherichia coli]
gb|OVD81512.1| hypothetical protein UQ33_19540 [Escherichia coli]
gb|OVD91011.1| hypothetical protein UQ34_15425 [Escherichia coli]
gb|OVE06762.1| hypothetical protein UQ35_05200 [Escherichia coli]
gb|OVE07559.1| hypothetical protein UQ36_04095 [Escherichia coli]
gb|OVE21733.1| hypothetical protein UQ39_10360 [Escherichia coli]
gb|OVE29209.1| hypothetical protein UQ44_10165 [Escherichia coli]
gb|OVE33663.1| hypothetical protein UQ45_02300 [Escherichia coli]
gb|ARW89370.1| TIGR00156 family protein [Escherichia coli]
gb|ARW91241.1| TIGR00156 family protein [Escherichia coli]
gb|ARX12771.1| TIGR00156 family protein [Escherichia coli]
gb|ARX23107.1| TIGR00156 family protein [Escherichia coli]
gb|ARX29005.1| TIGR00156 family protein [Escherichia coli]
gb|ARX55057.1| TIGR00156 family protein [Escherichia coli]
gb|OVF98840.1| TIGR00156 family protein [Escherichia coli]
gb|OVG49139.1| TIGR00156 family protein [Escherichia coli]
gb|OVJ49557.1| TIGR00156 family protein [Escherichia coli]
gb|OVY45458.1| TIGR00156 family protein [Escherichia coli]
gb|OWB93095.1| TIGR00156 family protein [Escherichia coli]
gb|OWC01608.1| TIGR00156 family protein [Escherichia coli]
gb|OWC06955.1| TIGR00156 family protein [Escherichia coli]
gb|OWC07950.1| TIGR00156 family protein [Escherichia coli]
gb|OWC09912.1| TIGR00156 family protein [Escherichia coli]
gb|OWC15305.1| TIGR00156 family protein [Escherichia coli]
gb|OWC22859.1| TIGR00156 family protein [Escherichia coli]
gb|OWC26406.1| TIGR00156 family protein [Escherichia coli]
gb|OWC31468.1| TIGR00156 family protein [Escherichia coli]
gb|OWC37375.1| TIGR00156 family protein [Escherichia coli]
gb|OWC44944.1| TIGR00156 family protein [Escherichia coli]
gb|OWC49475.1| TIGR00156 family protein [Escherichia coli]
gb|OWC52439.1| TIGR00156 family protein [Escherichia coli]
gb|OWC60474.1| TIGR00156 family protein [Escherichia coli]
gb|OWC61306.1| TIGR00156 family protein [Escherichia coli]
gb|OWC66820.1| TIGR00156 family protein [Escherichia coli]
gb|OWC71063.1| TIGR00156 family protein [Escherichia coli]
gb|OWC74123.1| TIGR00156 family protein [Escherichia coli]
gb|OWC77369.1| TIGR00156 family protein [Escherichia coli]
gb|OWC83872.1| TIGR00156 family protein [Escherichia coli]
gb|OWC85574.1| TIGR00156 family protein [Escherichia coli]
gb|OWC90127.1| TIGR00156 family protein [Escherichia coli]
gb|OWC99578.1| TIGR00156 family protein [Escherichia coli]
gb|OWD03070.1| TIGR00156 family protein [Escherichia coli]
gb|OWD12833.1| TIGR00156 family protein [Escherichia coli]
gb|OWD15548.1| TIGR00156 family protein [Escherichia coli]
gb|OWD22557.1| TIGR00156 family protein [Escherichia coli]
gb|OWD25143.1| TIGR00156 family protein [Escherichia coli]
gb|OWD29263.1| TIGR00156 family protein [Escherichia coli]
gb|OWD36463.1| TIGR00156 family protein [Escherichia coli]
gb|OWD40702.1| TIGR00156 family protein [Escherichia coli]
gb|OWD46498.1| TIGR00156 family protein [Escherichia coli]
gb|OWD55904.1| TIGR00156 family protein [Escherichia coli]
gb|OWD57537.1| TIGR00156 family protein [Escherichia coli]
gb|OWD62543.1| TIGR00156 family protein [Escherichia coli]
gb|OWD71075.1| TIGR00156 family protein [Escherichia coli]
gb|OWD72240.1| TIGR00156 family protein [Escherichia coli]
gb|OWD77519.1| TIGR00156 family protein [Escherichia coli]
gb|OWD84017.1| TIGR00156 family protein [Escherichia coli]
gb|OWD84600.1| TIGR00156 family protein [Escherichia coli]
gb|OWD91977.1| TIGR00156 family protein [Escherichia coli]
gb|OWD95503.1| TIGR00156 family protein [Escherichia coli]
gb|OWE01531.1| TIGR00156 family protein [Escherichia coli]
gb|OWE03006.1| TIGR00156 family protein [Escherichia coli]
gb|OWE16216.1| TIGR00156 family protein [Escherichia coli]
gb|OWE18131.1| TIGR00156 family protein [Escherichia coli]
gb|OWE22154.1| TIGR00156 family protein [Escherichia coli]
gb|OWE29141.1| TIGR00156 family protein [Escherichia coli]
gb|OWE31297.1| TIGR00156 family protein [Escherichia coli]
gb|OWE35419.1| TIGR00156 family protein [Escherichia coli]
gb|OWE43332.1| TIGR00156 family protein [Escherichia coli]
gb|OWE49826.1| TIGR00156 family protein [Escherichia coli]
gb|OWE70839.1| TIGR00156 family protein [Escherichia coli]
gb|OWE71587.1| TIGR00156 family protein [Escherichia coli]
gb|OWE81457.1| TIGR00156 family protein [Escherichia coli]
gb|OWE89978.1| TIGR00156 family protein [Escherichia coli]
gb|OWE94414.1| TIGR00156 family protein [Escherichia coli]
gb|OWE95238.1| TIGR00156 family protein [Escherichia coli]
gb|OWE96817.1| TIGR00156 family protein [Escherichia coli]
gb|OWF05749.1| TIGR00156 family protein [Escherichia coli]
gb|OWF13595.1| TIGR00156 family protein [Escherichia coli]
gb|OWF14446.1| TIGR00156 family protein [Escherichia coli]
gb|OWF19626.1| TIGR00156 family protein [Escherichia coli]
gb|ARZ84631.1| TIGR00156 family protein [Escherichia coli]
gb|ARZ87342.1| TIGR00156 family protein [Escherichia coli]
gb|ASA41276.1| TIGR00156 family protein [Escherichia coli]
gb|OWG45955.1| TIGR00156 family protein [Escherichia coli]
gb|OWG50290.1| TIGR00156 family protein [Escherichia coli]
gb|OWG55480.1| TIGR00156 family protein [Escherichia coli]
gb|OWG62373.1| TIGR00156 family protein [Escherichia coli]
gb|OWG66777.1| TIGR00156 family protein [Escherichia coli]
gb|OWG67715.1| TIGR00156 family protein [Escherichia coli]
gb|OWG77667.1| TIGR00156 family protein [Escherichia coli]
gb|OWG82177.1| TIGR00156 family protein [Escherichia coli]
gb|OWG83040.1| TIGR00156 family protein [Escherichia coli]
gb|OWG92361.1| TIGR00156 family protein [Escherichia coli]
gb|OWG94370.1| TIGR00156 family protein [Escherichia coli]
gb|OWG99400.1| TIGR00156 family protein [Escherichia coli]
gb|OWH04734.1| TIGR00156 family protein [Escherichia coli]
gb|OWH06834.1| TIGR00156 family protein [Escherichia coli]
gb|OWH14652.1| TIGR00156 family protein [Escherichia coli]
gb|OWH17850.1| TIGR00156 family protein [Escherichia coli]
gb|OWH22040.1| TIGR00156 family protein [Escherichia coli]
gb|OWH27426.1| TIGR00156 family protein [Escherichia coli]
gb|ASB78916.1| TIGR00156 family protein [Escherichia coli]
gb|ASC16212.1| TIGR00156 family protein [Escherichia coli]
gb|OWP94205.1| TIGR00156 family protein [Escherichia coli]
gb|OWR11948.1| TIGR00156 family protein [Shigella boydii]
gb|OWR37541.1| TIGR00156 family protein [Escherichia coli]
gb|OWS79357.1| TIGR00156 family protein [Escherichia coli]
gb|ASE48695.1| TIGR00156 family protein [Escherichia coli O157]
gb|ASF03881.1| TIGR00156 family protein [Escherichia coli O104:H4]
gb|ASG48220.1| TIGR00156 family protein [Escherichia coli]
gb|OWW49823.1| TIGR00156 family protein [Escherichia coli]
gb|OWW55483.1| TIGR00156 family protein [Escherichia coli]
gb|OWX80848.1| TIGR00156 family protein [Escherichia coli]
gb|OWX81814.1| TIGR00156 family protein [Escherichia coli]
gb|OWX90216.1| TIGR00156 family protein [Escherichia coli]
gb|OWY57335.1| TIGR00156 family protein [Escherichia coli]
gb|ASI49053.1| Protein ygiW precursor [Escherichia coli]
gb|ASJ29215.1| hypothetical protein ACJ74_07735 [Escherichia coli]
gb|ASJ35410.1| hypothetical protein ACJ76_16855 [Escherichia coli]
gb|ASJ44975.1| TIGR00156 family protein [Escherichia coli]
gb|ASL30307.1| TIGR00156 family protein [Escherichia coli]
gb|ASL57521.1| Protein ygiW precursor [Escherichia coli]
gb|OXJ45914.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ52648.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ55367.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ62628.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ64813.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ71034.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ75824.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ81827.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ82832.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ91875.1| TIGR00156 family protein [Escherichia coli]
gb|OXJ96688.1| TIGR00156 family protein [Escherichia coli]
gb|OXK00712.1| TIGR00156 family protein [Escherichia coli]
gb|OXK09561.1| TIGR00156 family protein [Escherichia coli]
gb|OXK12343.1| TIGR00156 family protein [Escherichia coli]
gb|OXK15216.1| TIGR00156 family protein [Escherichia coli]
gb|OXK22002.1| TIGR00156 family protein [Escherichia coli]
gb|OXK30747.1| TIGR00156 family protein [Escherichia coli]
gb|OXK32637.1| TIGR00156 family protein [Escherichia coli]
gb|OXK32920.1| TIGR00156 family protein [Escherichia coli]
gb|OXK44412.1| TIGR00156 family protein [Escherichia coli]
gb|OXK48523.1| TIGR00156 family protein [Escherichia coli]
gb|OXK60269.1| TIGR00156 family protein [Escherichia coli]
gb|OXK64149.1| TIGR00156 family protein [Escherichia coli]
gb|OXK68054.1| TIGR00156 family protein [Escherichia coli]
gb|OXK73850.1| TIGR00156 family protein [Escherichia coli]
gb|OXK77271.1| TIGR00156 family protein [Escherichia coli]
gb|OXK82806.1| TIGR00156 family protein [Escherichia coli]
gb|OXK90628.1| TIGR00156 family protein [Escherichia coli]
gb|OXK92184.1| TIGR00156 family protein [Escherichia coli]
gb|OXK99193.1| TIGR00156 family protein [Escherichia coli]
gb|ASN32476.1| TIGR00156 family protein [Shigella sonnei]
gb|ASN35167.1| TIGR00156 family protein [Shigella sonnei]
gb|ASN41642.1| TIGR00156 family protein [Shigella sonnei]
gb|OXL50664.1| TIGR00156 family protein [Escherichia coli]
gb|OXL57177.1| hypothetical protein OA52_17240 [Escherichia coli]
gb|OXL60319.1| hypothetical protein RO13_12840 [Escherichia coli]
gb|OXL60644.1| hypothetical protein OA49_06885 [Escherichia coli]
gb|OXL75533.1| hypothetical protein OA47_04770 [Escherichia coli]
gb|OXL75732.1| hypothetical protein OA53_07185 [Escherichia coli]
gb|OXL81190.1| hypothetical protein OA51_02280 [Escherichia coli]
gb|ASO02095.1| TIGR00156 family protein [Escherichia coli]
gb|ASO77574.1| hypothetical protein AKN40_0748 [Escherichia coli]
gb|ASO84929.1| hypothetical protein AKN41_3331 [Escherichia coli]
gb|ASO89703.1| hypothetical protein AKO63_3260 [Escherichia coli]
gb|ASO94478.1| hypothetical protein AKO64_3351 [Escherichia coli]
gb|OXU84989.1| TIGR00156 family protein [Escherichia coli]
gb|OXU87133.1| TIGR00156 family protein [Escherichia coli]
gb|ASQ68647.1| BOF domain containing protein [Escherichia coli NCCP15648]
gb|OXV19969.1| TIGR00156 family protein [Escherichia coli]
gb|OXV20186.1| TIGR00156 family protein [Escherichia coli]
gb|OXV30024.1| TIGR00156 family protein [Escherichia coli]
gb|OXV44118.1| TIGR00156 family protein [Escherichia coli]
gb|OXW68003.1| TIGR00156 family protein [Shigella sonnei]
gb|OXW81937.1| TIGR00156 family protein [Shigella sonnei]
gb|OXW91361.1| TIGR00156 family protein [Shigella boydii]
gb|OXX01587.1| TIGR00156 family protein [Shigella sonnei]
gb|OXX06029.1| TIGR00156 family protein [Shigella sonnei]
gb|OXX10048.1| TIGR00156 family protein [Shigella sonnei]
gb|OXX18206.1| TIGR00156 family protein [Shigella sonnei]
gb|OXZ49761.1| protein YgiW [Escherichia coli]
gb|OXZ53777.1| protein YgiW [Escherichia coli]
gb|OXZ55128.1| protein YgiW [Escherichia coli]
gb|OXZ64848.1| protein YgiW [Escherichia coli]
gb|OXZ74826.1| protein YgiW [Escherichia coli]
gb|OXZ77609.1| protein YgiW [Escherichia coli]
gb|OXZ84916.1| protein YgiW [Escherichia coli]
gb|OXZ86274.1| protein YgiW [Escherichia coli]
gb|OXZ91214.1| protein YgiW [Escherichia coli]
gb|OXZ97265.1| protein YgiW [Escherichia coli]
gb|OYA00827.1| protein YgiW [Escherichia coli]
gb|OYA02877.1| protein YgiW [Escherichia coli]
gb|OYA13031.1| protein YgiW [Escherichia coli]
gb|OYA16280.1| protein YgiW [Escherichia coli]
gb|OYA16755.1| protein YgiW [Escherichia coli]
gb|OYA25706.1| protein YgiW [Escherichia coli]
gb|OYA33490.1| protein YgiW [Escherichia coli]
gb|OYA33848.1| protein YgiW [Escherichia coli]
gb|OYA39412.1| protein YgiW [Escherichia coli]
gb|OYA42529.1| protein YgiW [Escherichia coli]
gb|OYA45573.1| protein YgiW [Escherichia coli]
gb|OYA53054.1| protein YgiW [Escherichia coli]
gb|OYA56178.1| protein YgiW [Escherichia coli]
gb|OYA59214.1| protein YgiW [Escherichia coli]
gb|OYA66930.1| protein YgiW [Escherichia coli]
gb|OYA68388.1| protein YgiW [Escherichia coli]
gb|OYA77341.1| protein YgiW [Escherichia coli]
gb|OYA81602.1| protein YgiW [Escherichia coli]
gb|OYA86062.1| protein YgiW [Escherichia coli]
gb|OYA91158.1| protein YgiW [Escherichia coli]
gb|OYB00876.1| protein YgiW [Escherichia coli]
gb|OYB02879.1| protein YgiW [Escherichia coli]
gb|OYB06551.1| protein YgiW [Escherichia coli]
gb|OYB07765.1| protein YgiW [Escherichia coli]
gb|OYB15506.1| protein YgiW [Escherichia coli]
gb|OYB20120.1| protein YgiW [Escherichia coli]
gb|OYB20624.1| protein YgiW [Escherichia coli]
gb|OYB30251.1| protein YgiW [Escherichia coli]
gb|OYB31551.1| protein YgiW [Escherichia coli]
gb|OYB34850.1| protein YgiW [Escherichia coli]
gb|OYB39248.1| protein YgiW [Escherichia coli]
gb|OYB49469.1| protein YgiW [Escherichia coli]
gb|OYB52386.1| protein YgiW [Escherichia coli]
gb|OYB57776.1| protein YgiW [Escherichia coli]
gb|OYB65476.1| protein YgiW [Escherichia coli]
gb|OYB71601.1| protein YgiW [Escherichia coli]
gb|OYB77701.1| protein YgiW [Escherichia coli]
gb|OYB85718.1| protein YgiW [Escherichia coli]
gb|OYB93459.1| protein YgiW [Escherichia coli]
gb|OYC05757.1| protein YgiW [Escherichia coli]
gb|OYC08968.1| protein YgiW [Escherichia coli]
gb|OYC15926.1| protein YgiW [Escherichia coli]
gb|OYC16615.1| protein YgiW [Escherichia coli]
gb|OYC27174.1| protein YgiW [Escherichia coli]
gb|OYC32626.1| protein YgiW [Escherichia coli]
gb|OYC37843.1| protein YgiW [Escherichia coli]
gb|OYC47080.1| protein YgiW [Escherichia coli]
gb|OYC49756.1| protein YgiW [Escherichia coli]
gb|OYC51526.1| protein YgiW [Escherichia coli]
gb|OYC57678.1| protein YgiW [Escherichia coli]
gb|OYC59605.1| protein YgiW [Escherichia coli]
gb|OYC65832.1| protein YgiW [Escherichia coli]
gb|OYC66569.1| protein YgiW [Escherichia coli]
gb|OYC72529.1| protein YgiW [Escherichia coli]
gb|OYC75899.1| protein YgiW [Escherichia coli]
gb|OYC84744.1| protein YgiW [Escherichia coli]
gb|OYD31333.1| TIGR00156 family protein [Escherichia coli]
gb|OYE15572.1| TIGR00156 family protein [Shigella sonnei]
gb|OYE21796.1| TIGR00156 family protein [Shigella sonnei]
gb|OYE47121.1| TIGR00156 family protein [Shigella sonnei]
gb|OYE53036.1| TIGR00156 family protein [Shigella sonnei]
gb|OYE60617.1| TIGR00156 family protein [Shigella sonnei]
gb|OYE79781.1| TIGR00156 family protein [Shigella sonnei]
gb|OYF36404.1| TIGR00156 family protein [Shigella sonnei]
gb|OYF69356.1| TIGR00156 family protein [Shigella sonnei]
gb|OYF71500.1| TIGR00156 family protein [Shigella sonnei]
gb|OYF81669.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG14543.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG69496.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG76393.1| TIGR00156 family protein [Shigella boydii]
gb|OYG76597.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG77539.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG83220.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG90363.1| TIGR00156 family protein [Shigella sonnei]
gb|OYG97129.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI00947.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI08897.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI16604.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI17068.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI35116.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI40802.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI46872.1| TIGR00156 family protein [Shigella boydii]
gb|OYI48035.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI55750.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI60108.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI64989.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI74531.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI80108.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI85305.1| TIGR00156 family protein [Shigella sonnei]
gb|OYI86226.1| TIGR00156 family protein [Shigella boydii]
gb|OYJ03823.1| TIGR00156 family protein [Shigella boydii]
gb|OYJ21799.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ21949.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ31870.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ44252.1| TIGR00156 family protein [Shigella boydii]
gb|OYJ44695.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ44798.1| TIGR00156 family protein [Shigella boydii]
gb|OYJ56521.1| TIGR00156 family protein [Escherichia coli]
gb|OYJ60039.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ69113.1| TIGR00156 family protein [Escherichia coli]
gb|OYJ77877.1| TIGR00156 family protein [Shigella sonnei]
gb|OYJ77931.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK17008.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK25245.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK32997.1| TIGR00156 family protein [Escherichia coli]
gb|OYK36163.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK42358.1| TIGR00156 family protein [Escherichia coli]
gb|OYK43524.1| TIGR00156 family protein [Escherichia coli]
gb|OYK56911.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK60434.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK62679.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK63679.1| TIGR00156 family protein [Shigella sonnei]
gb|OYK73662.1| TIGR00156 family protein [Shigella boydii]
gb|OYK74471.1| TIGR00156 family protein [Escherichia coli]
gb|OYL18818.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL22405.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL27830.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL40025.1| TIGR00156 family protein [Escherichia coli]
gb|OYL45001.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL46932.1| TIGR00156 family protein [Shigella boydii]
gb|OYL58633.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL62836.1| TIGR00156 family protein [Shigella sonnei]
gb|OYL90847.1| TIGR00156 family protein [Shigella sonnei]
gb|OYN28354.1| TIGR00156 family protein [Shigella boydii]
gb|OYN43411.1| TIGR00156 family protein [Escherichia coli]
gb|OYN46891.1| TIGR00156 family protein [Escherichia coli]
gb|OYN68540.1| TIGR00156 family protein [Escherichia coli]
gb|AST64536.1| TIGR00156 family protein [Escherichia coli]
gb|OYQ57600.1| TIGR00156 family protein [Shigella sonnei]
emb|SNW10901.1| protein YgiW [Escherichia coli]
gb|OZC28945.1| TIGR00156 family protein [Escherichia coli]
gb|OZG34413.1| TIGR00156 family protein [Escherichia coli O157:H7]
gb|OZM88429.1| TIGR00156 family protein [Escherichia coli]
gb|OZM89948.1| TIGR00156 family protein [Escherichia coli]
gb|OZM97456.1| TIGR00156 family protein [Escherichia coli]
gb|OZN01998.1| TIGR00156 family protein [Escherichia coli]
gb|OZO54195.1| TIGR00156 family protein [Escherichia coli]
gb|OZO58890.1| TIGR00156 family protein [Escherichia coli]
gb|OZO63621.1| TIGR00156 family protein [Escherichia coli]
gb|OZO68947.1| TIGR00156 family protein [Escherichia coli]
gb|OZO73584.1| TIGR00156 family protein [Escherichia coli]
gb|OZO78715.1| TIGR00156 family protein [Escherichia coli]
gb|OZO83894.1| TIGR00156 family protein [Escherichia coli]
gb|OZO88679.1| TIGR00156 family protein [Escherichia coli]
gb|OZO92331.1| TIGR00156 family protein [Escherichia coli]
gb|OZO98220.1| TIGR00156 family protein [Escherichia coli]
gb|OZP02922.1| TIGR00156 family protein [Escherichia coli]
gb|OZP06354.1| TIGR00156 family protein [Escherichia coli]
gb|OZP12958.1| TIGR00156 family protein [Escherichia coli]
gb|OZP18085.1| TIGR00156 family protein [Escherichia coli]
gb|OZP23111.1| TIGR00156 family protein [Escherichia coli]
gb|OZP28441.1| TIGR00156 family protein [Escherichia coli]
gb|OZP32918.1| TIGR00156 family protein [Escherichia coli]
gb|OZR92125.1| TIGR00156 family protein [Escherichia coli]
gb|OZR97449.1| TIGR00156 family protein [Escherichia coli]
gb|OZS03730.1| TIGR00156 family protein [Escherichia coli]
gb|OZS07173.1| TIGR00156 family protein [Escherichia coli]
gb|OZS12435.1| TIGR00156 family protein [Escherichia coli]
gb|OZX65410.1| TIGR00156 family protein [Escherichia coli]
gb|OZX67287.1| TIGR00156 family protein [Escherichia coli]
gb|OZX73361.1| TIGR00156 family protein [Escherichia coli]
gb|OZX77144.1| TIGR00156 family protein [Escherichia coli]
gb|OZX84015.1| TIGR00156 family protein [Escherichia coli]
gb|OZX89850.1| TIGR00156 family protein [Escherichia coli]
gb|OZX91943.1| TIGR00156 family protein [Escherichia coli]
gb|OZX99067.1| TIGR00156 family protein [Escherichia coli]
gb|OZY03756.1| TIGR00156 family protein [Escherichia coli]
gb|OZY10675.1| TIGR00156 family protein [Escherichia coli]
gb|OZY13042.1| TIGR00156 family protein [Escherichia coli]
gb|OZY18341.1| TIGR00156 family protein [Escherichia coli]
gb|OZY20187.1| TIGR00156 family protein [Escherichia coli]
gb|PAB68353.1| TIGR00156 family protein [Escherichia coli]
gb|PAB78584.1| TIGR00156 family protein [Escherichia coli]
gb|PAB80196.1| TIGR00156 family protein [Escherichia coli]
gb|PAB90382.1| TIGR00156 family protein [Escherichia coli]
gb|PAB96014.1| TIGR00156 family protein [Escherichia coli]
gb|PAC00215.1| TIGR00156 family protein [Escherichia coli]
gb|PAC01461.1| TIGR00156 family protein [Escherichia coli]
gb|PAL37879.1| TIGR00156 family protein [Escherichia coli]
gb|PAL38137.1| TIGR00156 family protein [Escherichia coli]
gb|PAL42294.1| TIGR00156 family protein [Escherichia coli]
gb|PAL51180.1| TIGR00156 family protein [Escherichia coli]
gb|PAL54365.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ20525.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ24078.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ24484.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ31962.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ32986.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ43835.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ47277.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ49485.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ54607.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ59076.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ74404.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ77896.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ84351.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ86890.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ92522.1| TIGR00156 family protein [Escherichia coli]
gb|PAQ93460.1| TIGR00156 family protein [Escherichia coli]
gb|PAR03357.1| TIGR00156 family protein [Escherichia coli]
gb|PAS48737.1| TIGR00156 family protein [Escherichia coli]
gb|PAS51044.1| TIGR00156 family protein [Escherichia coli]
gb|PAS61163.1| TIGR00156 family protein [Escherichia coli]
gb|PAS67957.1| TIGR00156 family protein [Escherichia coli]
gb|PAS73177.1| TIGR00156 family protein [Escherichia coli]
gb|PAS78887.1| TIGR00156 family protein [Escherichia coli]
gb|PAS85795.1| TIGR00156 family protein [Escherichia coli]
emb|CTP94227.1| Protein ygiW precursor [Escherichia coli]
gb|ASW61289.1| stress-induced protein [Escherichia coli]
gb|ASX04421.1| TIGR00156 family protein [Escherichia coli]
gb|PAT77597.1| TIGR00156 family protein [Escherichia coli]
gb|PAT82635.1| TIGR00156 family protein [Escherichia coli]
gb|PAT89047.1| TIGR00156 family protein [Escherichia coli]
gb|PAT97194.1| TIGR00156 family protein [Escherichia coli]
gb|PAU00216.1| TIGR00156 family protein [Escherichia coli]
gb|PAU01930.1| TIGR00156 family protein [Escherichia coli]
gb|PAU17753.1| TIGR00156 family protein [Escherichia coli]
gb|PAU18515.1| TIGR00156 family protein [Escherichia coli]
gb|PAU21762.1| TIGR00156 family protein [Escherichia coli]
gb|PAU28491.1| TIGR00156 family protein [Escherichia coli]
gb|PAX44869.1| TIGR00156 family protein [Escherichia coli]
gb|ASZ43009.1| TIGR00156 family protein [Escherichia coli]
gb|ASZ47497.1| TIGR00156 family protein [Escherichia coli]
gb|PAY67529.1| TIGR00156 family protein [Shigella flexneri]
gb|PAY67726.1| TIGR00156 family protein [Shigella flexneri]
gb|PAY75335.1| TIGR00156 family protein [Shigella boydii]
gb|PAY84091.1| TIGR00156 family protein [Shigella flexneri]
gb|PAY86064.1| TIGR00156 family protein [Shigella boydii]
gb|PAY93392.1| TIGR00156 family protein [Shigella flexneri]
gb|PAY95976.1| TIGR00156 family protein [Shigella boydii]
gb|PAZ27135.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ31675.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ34142.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ41500.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ44505.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ50653.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ57229.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ58985.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ61971.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ69414.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ76982.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ78873.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ86480.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ91521.1| TIGR00156 family protein [Escherichia coli]
gb|PAZ97092.1| TIGR00156 family protein [Escherichia coli]
gb|ATB09952.1| TIGR00156 family protein [Escherichia coli]
gb|PBK07920.1| TIGR00156 family protein [Escherichia coli]
gb|PBK14330.1| TIGR00156 family protein [Escherichia coli]
gb|PBK18335.1| TIGR00156 family protein [Escherichia coli]
gb|PBK25321.1| TIGR00156 family protein [Escherichia coli]
gb|PBK31351.1| TIGR00156 family protein [Escherichia coli]
gb|PBK37342.1| TIGR00156 family protein [Escherichia coli]
gb|PBK39144.1| TIGR00156 family protein [Escherichia coli]
gb|PBK44888.1| TIGR00156 family protein [Escherichia coli]
gb|ATB71710.1| TIGR00156 family protein [Escherichia coli]
gb|ATB76881.1| TIGR00156 family protein [Escherichia coli]
gb|ATB81630.1| TIGR00156 family protein [Escherichia coli]
gb|ATB86595.1| TIGR00156 family protein [Escherichia coli]
gb|ATB91549.1| TIGR00156 family protein [Escherichia coli]
gb|ATB96645.1| TIGR00156 family protein [Escherichia coli]
gb|ATC01352.1| TIGR00156 family protein [Escherichia coli]
gb|ATC09168.1| TIGR00156 family protein [Escherichia coli]
gb|ATC11047.1| TIGR00156 family protein [Escherichia coli]
gb|ATC15944.1| TIGR00156 family protein [Escherichia coli]
gb|PBN52645.1| TIGR00156 family protein [Escherichia coli]
gb|PBN56531.1| TIGR00156 family protein [Escherichia coli]
gb|PBN59529.1| TIGR00156 family protein [Escherichia coli]
gb|PBN74305.1| TIGR00156 family protein [Escherichia coli]
gb|PBN75530.1| TIGR00156 family protein [Escherichia coli]
gb|PBN86896.1| TIGR00156 family protein [Escherichia coli]
gb|PBN88811.1| TIGR00156 family protein [Escherichia coli]
gb|PBN89369.1| TIGR00156 family protein [Escherichia coli]
gb|PBO11278.1| TIGR00156 family protein [Shigella sonnei]
gb|PBO46241.1| TIGR00156 family protein [Escherichia coli]
gb|PBO51704.1| TIGR00156 family protein [Escherichia coli]
gb|PBO51974.1| TIGR00156 family protein [Escherichia coli]
gb|PBO59454.1| TIGR00156 family protein [Escherichia coli]
gb|PBO65508.1| TIGR00156 family protein [Escherichia coli]
gb|PBO71779.1| TIGR00156 family protein [Escherichia coli]
gb|PBO78101.1| TIGR00156 family protein [Escherichia coli]
gb|PBO80825.1| TIGR00156 family protein [Escherichia coli]
gb|PBO88211.1| TIGR00156 family protein [Shigella sonnei]
gb|PBO90298.1| TIGR00156 family protein [Shigella boydii]
gb|PBO90590.1| TIGR00156 family protein [Escherichia coli]
gb|PBO97906.1| TIGR00156 family protein [Shigella sonnei]
gb|PBP08822.1| TIGR00156 family protein [Shigella sonnei]
gb|PBQ37413.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ42585.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ45558.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ54212.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ57662.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ62788.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ66177.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ73583.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ79726.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ84659.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ89785.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ91662.1| TIGR00156 family protein [Escherichia coli]
gb|PBQ96832.1| TIGR00156 family protein [Escherichia coli]
gb|PBR03933.1| TIGR00156 family protein [Escherichia coli]
gb|PBR12310.1| TIGR00156 family protein [Escherichia coli]
gb|PBR17299.1| TIGR00156 family protein [Escherichia coli]
gb|PBR20294.1| TIGR00156 family protein [Escherichia coli]
gb|PBR25457.1| TIGR00156 family protein [Escherichia coli]
gb|PBR30941.1| TIGR00156 family protein [Escherichia coli]
gb|PBR36650.1| TIGR00156 family protein [Escherichia coli]
gb|PBR40446.1| TIGR00156 family protein [Escherichia coli]
gb|PBR46327.1| TIGR00156 family protein [Escherichia coli]
gb|PBR50704.1| TIGR00156 family protein [Escherichia coli]
gb|PBR59044.1| TIGR00156 family protein [Escherichia coli]
gb|PBR62067.1| TIGR00156 family protein [Escherichia coli]
gb|PBR67815.1| TIGR00156 family protein [Escherichia coli]
gb|PBR71121.1| TIGR00156 family protein [Escherichia coli]
gb|PBR78266.1| TIGR00156 family protein [Escherichia coli]
gb|PBR83326.1| TIGR00156 family protein [Escherichia coli]
gb|PBR89134.1| TIGR00156 family protein [Escherichia coli]
gb|PBR94846.1| TIGR00156 family protein [Escherichia coli]
gb|PBS02083.1| TIGR00156 family protein [Escherichia coli]
gb|PBS04042.1| TIGR00156 family protein [Escherichia coli]
gb|PBS10009.1| TIGR00156 family protein [Escherichia coli]
gb|PBS27233.1| TIGR00156 family protein [Escherichia coli]
gb|PBS32154.1| TIGR00156 family protein [Escherichia coli]
gb|PBS40095.1| TIGR00156 family protein [Escherichia coli]
gb|PBS45250.1| TIGR00156 family protein [Escherichia coli]
gb|PBS50075.1| TIGR00156 family protein [Escherichia coli]
gb|PBS89807.1| TIGR00156 family protein [Escherichia coli]
gb|PBS95112.1| TIGR00156 family protein [Escherichia coli]
gb|PBS99913.1| TIGR00156 family protein [Escherichia coli]
gb|PBT04558.1| TIGR00156 family protein [Escherichia coli]
gb|PBT11950.1| TIGR00156 family protein [Escherichia coli]
gb|PBT16101.1| TIGR00156 family protein [Escherichia coli]
gb|PBT21786.1| TIGR00156 family protein [Escherichia coli]
gb|PBT26193.1| TIGR00156 family protein [Escherichia coli]
gb|PBT29048.1| TIGR00156 family protein [Escherichia coli]
gb|PBT32944.1| TIGR00156 family protein [Escherichia coli]
gb|PBT39901.1| TIGR00156 family protein [Escherichia coli]
gb|PBT41484.1| TIGR00156 family protein [Escherichia coli]
gb|PBT49210.1| TIGR00156 family protein [Escherichia coli]
gb|PBT51712.1| TIGR00156 family protein [Escherichia coli]
gb|PBT56290.1| TIGR00156 family protein [Escherichia coli]
gb|PBT61686.1| TIGR00156 family protein [Escherichia coli]
gb|PBT66980.1| TIGR00156 family protein [Escherichia coli]
gb|PBT74455.1| TIGR00156 family protein [Escherichia coli]
gb|PBT77318.1| TIGR00156 family protein [Escherichia coli]
gb|PBT82169.1| TIGR00156 family protein [Escherichia coli]
gb|PBT87374.1| TIGR00156 family protein [Escherichia coli]
gb|PBT90044.1| TIGR00156 family protein [Escherichia coli]
gb|PBT94747.1| TIGR00156 family protein [Escherichia coli]
gb|PBT99191.1| TIGR00156 family protein [Escherichia coli]
gb|PBU03710.1| TIGR00156 family protein [Escherichia coli]
gb|PBU12947.1| TIGR00156 family protein [Escherichia coli]
gb|PBU13418.1| TIGR00156 family protein [Escherichia coli]
gb|PBU16830.1| TIGR00156 family protein [Escherichia coli]
gb|PBU23212.1| TIGR00156 family protein [Escherichia coli]
gb|PBU27844.1| TIGR00156 family protein [Escherichia coli]
gb|PBU32505.1| TIGR00156 family protein [Escherichia coli]
gb|PBU38051.1| TIGR00156 family protein [Escherichia coli]
gb|PBU44787.1| TIGR00156 family protein [Escherichia coli]
gb|PBU48204.1| TIGR00156 family protein [Escherichia coli]
gb|PBU54970.1| TIGR00156 family protein [Escherichia coli]
gb|PBU57326.1| TIGR00156 family protein [Escherichia coli]
gb|PBU62523.1| TIGR00156 family protein [Escherichia coli]
gb|PBU70060.1| TIGR00156 family protein [Escherichia coli]
gb|PBU74979.1| TIGR00156 family protein [Escherichia coli]
gb|PBU78922.1| TIGR00156 family protein [Escherichia coli]
gb|PBU85890.1| TIGR00156 family protein [Escherichia coli]
gb|PBU90412.1| TIGR00156 family protein [Escherichia coli]
gb|PBU92625.1| TIGR00156 family protein [Escherichia coli]
gb|PCD49880.1| TIGR00156 family protein [Escherichia coli]
gb|PCD54575.1| TIGR00156 family protein [Escherichia coli]
gb|PCD74700.1| TIGR00156 family protein [Escherichia coli]
gb|PCG23287.1| TIGR00156 family protein [Escherichia coli]
gb|PCG28867.1| TIGR00156 family protein [Escherichia coli]
gb|PCG33474.1| TIGR00156 family protein [Escherichia coli]
gb|PCG38889.1| TIGR00156 family protein [Escherichia coli]
gb|PCG43722.1| TIGR00156 family protein [Escherichia coli]
gb|PCG49164.1| TIGR00156 family protein [Escherichia coli]
gb|PCG54663.1| TIGR00156 family protein [Escherichia coli]
gb|ATG08997.1| TIGR00156 family protein [Escherichia coli]
gb|ATG11844.1| TIGR00156 family protein [Escherichia coli]
gb|ATG63581.1| TIGR00156 family protein [Escherichia coli O104:H21 str.
CFSAN002236]
gb|PCM06363.1| TIGR00156 family protein [Escherichia coli]
gb|PCM14636.1| TIGR00156 family protein [Escherichia coli]
gb|PCM18430.1| TIGR00156 family protein [Escherichia coli]
gb|PCM23182.1| TIGR00156 family protein [Escherichia coli]
gb|PCM28514.1| TIGR00156 family protein [Escherichia coli]
gb|PCM35347.1| TIGR00156 family protein [Escherichia coli]
gb|PCM37592.1| TIGR00156 family protein [Escherichia coli]
gb|PCO22942.1| TIGR00156 family protein [Escherichia coli]
gb|PCO34376.1| TIGR00156 family protein [Escherichia coli]
gb|PCO57911.1| TIGR00156 family protein [Escherichia coli]
gb|PCO60130.1| TIGR00156 family protein [Escherichia coli]
gb|PCO78290.1| TIGR00156 family protein [Escherichia coli]
gb|PCO87766.1| TIGR00156 family protein [Escherichia coli]
gb|PCO97089.1| TIGR00156 family protein [Escherichia coli]
gb|PCP03252.1| TIGR00156 family protein [Escherichia coli]
gb|PCQ54324.1| TIGR00156 family protein [Escherichia coli]
gb|PCQ84285.1| TIGR00156 family protein [Escherichia coli]
gb|PCQ91088.1| TIGR00156 family protein [Escherichia coli]
gb|PCQ95313.1| TIGR00156 family protein [Escherichia coli]
gb|PCR56081.1| TIGR00156 family protein [Escherichia coli]
gb|PCR61190.1| TIGR00156 family protein [Escherichia coli]
gb|PCR65593.1| TIGR00156 family protein [Escherichia coli]
gb|PCR69093.1| TIGR00156 family protein [Escherichia coli]
gb|PCR74015.1| TIGR00156 family protein [Escherichia coli]
gb|PCS32445.1| TIGR00156 family protein [Escherichia coli]
gb|PCS41197.1| TIGR00156 family protein [Escherichia coli]
gb|PCS46395.1| TIGR00156 family protein [Escherichia coli]
gb|PCS50889.1| TIGR00156 family protein [Escherichia coli]
gb|PCS56434.1| TIGR00156 family protein [Escherichia coli]
gb|PCS63465.1| TIGR00156 family protein [Escherichia coli]
gb|PCS66770.1| TIGR00156 family protein [Escherichia coli]
gb|PCS73082.1| TIGR00156 family protein [Escherichia coli]
gb|PCS79217.1| TIGR00156 family protein [Escherichia coli]
gb|PCS80727.1| TIGR00156 family protein [Escherichia coli]
gb|PCS87053.1| TIGR00156 family protein [Escherichia coli]
gb|PCS91893.1| TIGR00156 family protein [Escherichia coli]
gb|PCS96705.1| TIGR00156 family protein [Escherichia coli]
gb|PCT03438.1| TIGR00156 family protein [Escherichia coli]
gb|PCT14095.1| TIGR00156 family protein [Escherichia coli]
gb|PCT18604.1| TIGR00156 family protein [Escherichia coli]
gb|PCT23930.1| TIGR00156 family protein [Escherichia coli]
gb|PCT27718.1| TIGR00156 family protein [Escherichia coli]
gb|PCT33116.1| TIGR00156 family protein [Escherichia coli]
gb|PCT39478.1| TIGR00156 family protein [Escherichia coli]
gb|ATH87106.1| TIGR00156 family protein [Shigella sonnei]
gb|ATI06331.1| TIGR00156 family protein [Escherichia coli M12]
gb|PDM30240.1| TIGR00156 family protein [Escherichia coli]
gb|PDM41988.1| TIGR00156 family protein [Escherichia coli]
gb|PDM86842.1| TIGR00156 family protein [Escherichia coli]
gb|PDM91771.1| TIGR00156 family protein [Escherichia coli]
gb|PDM97073.1| TIGR00156 family protein [Escherichia coli]
gb|PDN02626.1| TIGR00156 family protein [Escherichia coli]
gb|PDN91643.1| TIGR00156 family protein [Escherichia coli]
gb|PDN94837.1| TIGR00156 family protein [Escherichia coli]
gb|PDN98937.1| TIGR00156 family protein [Escherichia coli]
gb|PDO06088.1| TIGR00156 family protein [Escherichia coli]
gb|PDO12696.1| TIGR00156 family protein [Escherichia coli]
gb|PDO21361.1| TIGR00156 family protein [Escherichia coli]
gb|PDO21652.1| TIGR00156 family protein [Escherichia coli]
gb|PDO29024.1| TIGR00156 family protein [Escherichia coli]
gb|PDO30732.1| TIGR00156 family protein [Escherichia coli]
gb|PDO36971.1| TIGR00156 family protein [Escherichia coli]
gb|PDO42906.1| TIGR00156 family protein [Escherichia coli]
gb|PDO50564.1| TIGR00156 family protein [Escherichia coli]
gb|PDO53647.1| TIGR00156 family protein [Escherichia coli]
gb|PDO60715.1| TIGR00156 family protein [Escherichia coli]
gb|PDO63927.1| TIGR00156 family protein [Escherichia coli]
gb|PDO66894.1| TIGR00156 family protein [Escherichia coli]
gb|PDS08213.1| TIGR00156 family protein [Escherichia coli]
gb|PDS12041.1| TIGR00156 family protein [Escherichia coli]
gb|PDS21223.1| TIGR00156 family protein [Escherichia coli]
gb|PDT96418.1| TIGR00156 family protein [Escherichia coli]
gb|PDU02633.1| TIGR00156 family protein [Escherichia coli]
gb|PDU06890.1| TIGR00156 family protein [Escherichia coli]
gb|PDU12857.1| TIGR00156 family protein [Escherichia coli]
gb|PDU17620.1| TIGR00156 family protein [Escherichia coli]
gb|PDU23528.1| TIGR00156 family protein [Escherichia coli]
gb|PDU28698.1| TIGR00156 family protein [Escherichia coli]
gb|PDU33972.1| TIGR00156 family protein [Escherichia coli]
gb|PDU39751.1| TIGR00156 family protein [Escherichia coli]
gb|PDU44398.1| TIGR00156 family protein [Escherichia coli]
gb|PDU50235.1| TIGR00156 family protein [Escherichia coli]
gb|PDU56314.1| TIGR00156 family protein [Escherichia coli]
gb|PDU62875.1| TIGR00156 family protein [Escherichia coli]
gb|PDU68530.1| TIGR00156 family protein [Escherichia coli]
gb|PDU74124.1| TIGR00156 family protein [Escherichia coli]
gb|PDU79686.1| TIGR00156 family protein [Escherichia coli]
gb|PDU85408.1| TIGR00156 family protein [Escherichia coli]
gb|PDU91363.1| TIGR00156 family protein [Escherichia coli]
gb|PDU95752.1| TIGR00156 family protein [Escherichia coli]
gb|PDV01377.1| TIGR00156 family protein [Escherichia coli]
gb|PDV07202.1| TIGR00156 family protein [Escherichia coli]
gb|PDV11963.1| TIGR00156 family protein [Escherichia coli]
gb|PDV17224.1| TIGR00156 family protein [Escherichia coli]
gb|PDV24148.1| TIGR00156 family protein [Escherichia coli]
gb|PDV29526.1| TIGR00156 family protein [Escherichia coli]
gb|PDV33570.1| TIGR00156 family protein [Escherichia coli]
gb|PDV40183.1| TIGR00156 family protein [Escherichia coli]
gb|PDV46021.1| TIGR00156 family protein [Escherichia coli]
gb|PDV51126.1| TIGR00156 family protein [Escherichia coli]
gb|PDV60293.1| TIGR00156 family protein [Escherichia coli]
gb|PDV61662.1| TIGR00156 family protein [Escherichia coli]
gb|PDV66728.1| TIGR00156 family protein [Escherichia coli]
gb|PDV70688.1| TIGR00156 family protein [Escherichia coli]
gb|PDV75007.1| TIGR00156 family protein [Escherichia coli]
gb|PDV81448.1| TIGR00156 family protein [Escherichia coli]
gb|PDV94282.1| TIGR00156 family protein [Escherichia coli]
gb|PEG24797.1| TIGR00156 family protein [Escherichia coli]
gb|PEH63092.1| TIGR00156 family protein [Escherichia coli]
gb|PEH93597.1| TIGR00156 family protein [Escherichia coli]
gb|PEI00902.1| TIGR00156 family protein [Escherichia coli]
gb|PEI18439.1| TIGR00156 family protein [Escherichia coli]
gb|PGF66565.1| TIGR00156 family protein [Escherichia coli]
gb|PGF70174.1| TIGR00156 family protein [Escherichia coli]
gb|PGF71090.1| TIGR00156 family protein [Escherichia coli]
gb|PGF80921.1| TIGR00156 family protein [Escherichia coli]
gb|PGF90390.1| TIGR00156 family protein [Escherichia coli]
gb|PGF93367.1| TIGR00156 family protein [Escherichia coli]
gb|PGG04066.1| TIGR00156 family protein [Escherichia coli]
gb|PGG08574.1| TIGR00156 family protein [Escherichia coli]
gb|PGG11079.1| TIGR00156 family protein [Escherichia coli]
gb|PGG25444.1| TIGR00156 family protein [Escherichia coli]
gb|PGG29791.1| TIGR00156 family protein [Escherichia coli]
gb|PGG34077.1| TIGR00156 family protein [Escherichia coli]
gb|PGG38166.1| TIGR00156 family protein [Escherichia coli]
gb|PGG42003.1| TIGR00156 family protein [Escherichia coli]
gb|PGG45434.1| TIGR00156 family protein [Escherichia coli]
gb|PGG50239.1| TIGR00156 family protein [Escherichia coli]
gb|PGG56369.1| TIGR00156 family protein [Escherichia coli]
gb|PGG56819.1| TIGR00156 family protein [Escherichia coli]
gb|PGG67589.1| TIGR00156 family protein [Escherichia coli]
gb|PGG71461.1| TIGR00156 family protein [Escherichia coli]
gb|PHG87687.1| TIGR00156 family protein [Escherichia coli]
gb|PHG92790.1| TIGR00156 family protein [Escherichia coli]
gb|PHH31717.1| TIGR00156 family protein [Escherichia coli]
gb|ATM09876.1| TIGR00156 family protein [Escherichia coli]
gb|ATM27142.1| TIGR00156 family protein [Escherichia coli]
gb|ATM83490.1| TIGR00156 family protein [Escherichia coli]
gb|PHK61408.1| TIGR00156 family protein [Escherichia coli]
gb|PHK70238.1| TIGR00156 family protein [Escherichia coli]
gb|PHL23484.1| TIGR00156 family protein [Escherichia coli]
gb|PHL29744.1| TIGR00156 family protein [Escherichia coli]
gb|PHL37571.1| TIGR00156 family protein [Escherichia coli]
gb|PHL42396.1| TIGR00156 family protein [Escherichia coli]
gb|PHL44189.1| TIGR00156 family protein [Escherichia coli]
gb|PHL51483.1| TIGR00156 family protein [Escherichia coli]
gb|PHL53909.1| TIGR00156 family protein [Escherichia coli]
gb|PHL58906.1| TIGR00156 family protein [Escherichia coli]
gb|PHL64499.1| TIGR00156 family protein [Escherichia coli]
gb|PHL95428.1| TIGR00156 family protein [Escherichia coli]
gb|PHM02183.1| TIGR00156 family protein [Escherichia coli]
gb|PHN14171.1| TIGR00156 family protein [Escherichia coli]
gb|ATO78244.1| TIGR00156 family protein [Escherichia coli O91 str. RM7190]
gb|PHU63471.1| TIGR00156 family protein [Shigella sonnei]
gb|PHU68093.1| TIGR00156 family protein [Shigella sonnei]
gb|PHU71183.1| TIGR00156 family protein [Shigella boydii]
gb|PHU76683.1| TIGR00156 family protein [Shigella sonnei]
gb|PHU80938.1| TIGR00156 family protein [Shigella sonnei]
gb|PHU84278.1| TIGR00156 family protein [Shigella boydii]
gb|PHU89492.1| TIGR00156 family protein [Shigella sonnei]
gb|PHU93168.1| TIGR00156 family protein [Shigella boydii]
gb|PHU97692.1| TIGR00156 family protein [Shigella boydii]
gb|ATP24975.1| TIGR00156 family protein [Escherichia coli]
gb|PHW94607.1| TIGR00156 family protein [Escherichia coli]
gb|PHX02300.1| TIGR00156 family protein [Escherichia coli]
gb|PIA80161.1| TIGR00156 family protein [Escherichia coli]
gb|PIM09036.1| TIGR00156 family protein [Escherichia coli]
gb|PIM12325.1| TIGR00156 family protein [Escherichia coli]
gb|PIM17266.1| TIGR00156 family protein [Escherichia coli]
gb|PIM25446.1| TIGR00156 family protein [Escherichia coli]
gb|PIM33601.1| TIGR00156 family protein [Escherichia coli]
gb|PIM39257.1| TIGR00156 family protein [Escherichia coli]
gb|PIM41087.1| TIGR00156 family protein [Escherichia coli]
gb|PIM56322.1| TIGR00156 family protein [Escherichia coli]
gb|PIM64228.1| TIGR00156 family protein [Escherichia coli]
gb|ATU33675.1| TIGR00156 family protein [Escherichia coli]
gb|ATV10322.1| TIGR00156 family protein [Escherichia coli]
gb|ATV49469.1| TIGR00156 family protein [Escherichia coli]
gb|ATV73884.1| TIGR00156 family protein [Escherichia coli]
gb|PIS72407.1| hypothetical protein L241_28395 [Escherichia coli O55:H7 str. USDA
5905]
gb|ATW96358.1| TIGR00156 family protein [Escherichia coli]
gb|ATX10807.1| TIGR00156 family protein [Escherichia coli]
gb|ATX17616.1| TIGR00156 family protein [Escherichia coli]
gb|ATX40424.1| TIGR00156 family protein [Escherichia coli]
gb|ATX47865.1| TIGR00156 family protein [Escherichia coli]
gb|ATX53346.1| TIGR00156 family protein [Escherichia coli]
gb|ATX56665.1| TIGR00156 family protein [Escherichia coli]
gb|PJF56780.1| TIGR00156 family protein [Escherichia coli]
gb|PJF61109.1| TIGR00156 family protein [Escherichia coli]
gb|PJF66687.1| TIGR00156 family protein [Escherichia coli]
gb|PJF70542.1| TIGR00156 family protein [Escherichia coli]
gb|PJF75923.1| TIGR00156 family protein [Escherichia coli]
gb|PJF81698.1| TIGR00156 family protein [Escherichia coli]
gb|PJF83202.1| TIGR00156 family protein [Escherichia coli]
gb|PJF89366.1| TIGR00156 family protein [Escherichia coli]
gb|PJF95476.1| TIGR00156 family protein [Escherichia coli]
gb|PJG00035.1| TIGR00156 family protein [Escherichia coli]
gb|PJG03494.1| TIGR00156 family protein [Escherichia coli]
gb|PJG06323.1| TIGR00156 family protein [Escherichia coli]
gb|PJG13711.1| TIGR00156 family protein [Escherichia coli]
gb|PJG17800.1| TIGR00156 family protein [Escherichia coli]
gb|PJG23773.1| TIGR00156 family protein [Escherichia coli]
gb|PJG26968.1| TIGR00156 family protein [Escherichia coli]
gb|PJG30935.1| TIGR00156 family protein [Escherichia coli]
gb|PJG74256.1| TIGR00156 family protein [Escherichia coli]
gb|ATY19800.1| TIGR00156 family protein [Escherichia coli]
gb|ATY22487.1| TIGR00156 family protein [Escherichia coli]
gb|PJH97200.1| TIGR00156 family protein [Escherichia coli]
gb|PJI60307.1| TIGR00156 family protein [Escherichia coli]
gb|PJI64185.1| TIGR00156 family protein [Escherichia coli]
gb|PJN77119.1| TIGR00156 family protein [Escherichia coli]
gb|ATX34271.1| TIGR00156 family protein [Escherichia coli]
gb|ATZ39636.1| TIGR00156 family protein [Escherichia coli]
gb|PJR32415.1| hypothetical protein H260_20065 [Escherichia coli O157:H7 str.
TW14313]
gb|PJR38266.1| hypothetical protein H474_18735 [Escherichia coli O55:H7 str.
TB182A]
gb|PJR43819.1| hypothetical protein H644_20760 [Escherichia coli O157:H7 str.
EC1825]
gb|PJW25922.1| TIGR00156 family protein [Escherichia coli]
gb|PJW29725.1| TIGR00156 family protein [Escherichia coli]
gb|PJW36190.1| TIGR00156 family protein [Escherichia coli]
gb|PJW40966.1| TIGR00156 family protein [Escherichia coli]
gb|PJW54638.1| TIGR00156 family protein [Escherichia coli]
gb|PJW66151.1| TIGR00156 family protein [Escherichia coli]
gb|PJW70288.1| TIGR00156 family protein [Escherichia coli]
gb|PJW76984.1| TIGR00156 family protein [Escherichia coli]
gb|PJW80435.1| TIGR00156 family protein [Escherichia coli]
gb|PJW86191.1| TIGR00156 family protein [Escherichia coli]
gb|PJW91042.1| TIGR00156 family protein [Escherichia coli]
gb|PJW99180.1| TIGR00156 family protein [Escherichia coli]
gb|PJX02469.1| TIGR00156 family protein [Escherichia coli]
gb|ATZ33434.1| hypothetical protein CV83915_03134 [Escherichia coli]
gb|PJX80520.1| TIGR00156 family protein [Escherichia coli]
gb|PJX86835.1| TIGR00156 family protein [Escherichia coli]
gb|PJX93312.1| TIGR00156 family protein [Escherichia coli]
gb|PJX96989.1| TIGR00156 family protein [Escherichia coli]
gb|PJY01183.1| TIGR00156 family protein [Escherichia coli]
gb|PJY09799.1| TIGR00156 family protein [Escherichia coli]
gb|PJY13218.1| TIGR00156 family protein [Escherichia coli]
gb|PJY17315.1| TIGR00156 family protein [Escherichia coli]
gb|PJY22578.1| TIGR00156 family protein [Escherichia coli]
gb|PJY29945.1| TIGR00156 family protein [Escherichia coli]
gb|PJY36458.1| TIGR00156 family protein [Escherichia coli]
gb|PJY40105.1| TIGR00156 family protein [Escherichia coli]
gb|PJY43586.1| TIGR00156 family protein [Escherichia coli]
gb|PJY50564.1| TIGR00156 family protein [Escherichia coli]
gb|PJY53830.1| TIGR00156 family protein [Escherichia coli]
gb|PJY62043.1| TIGR00156 family protein [Escherichia coli]
gb|PJY90525.1| TIGR00156 family protein [Shigella sonnei]
emb|SMZ43723.1| Protein ygiW precursor [Escherichia coli]
gb|AUA43647.1| TIGR00156 family protein [Escherichia coli]
gb|PKD52855.1| TIGR00156 family protein [Escherichia coli]
gb|PKD56967.1| TIGR00156 family protein [Escherichia coli]
gb|PKD65939.1| TIGR00156 family protein [Escherichia coli]
gb|PKD70472.1| TIGR00156 family protein [Escherichia coli]
gb|PKD76904.1| TIGR00156 family protein [Escherichia coli]
gb|PKD79958.1| TIGR00156 family protein [Escherichia coli]
gb|PKD87661.1| TIGR00156 family protein [Escherichia coli]
gb|PKD96408.1| TIGR00156 family protein [Escherichia coli]
gb|PKE03010.1| TIGR00156 family protein [Escherichia coli]
gb|PKE14262.1| TIGR00156 family protein [Escherichia coli]
gb|PKE79090.1| TIGR00156 family protein [Escherichia coli]
gb|PKE85362.1| TIGR00156 family protein [Escherichia coli]
gb|PKE90693.1| TIGR00156 family protein [Escherichia coli]
gb|PKE96782.1| TIGR00156 family protein [Escherichia coli]
gb|PKF01355.1| TIGR00156 family protein [Escherichia coli]
gb|PKF05637.1| TIGR00156 family protein [Escherichia coli]
gb|PKF13121.1| TIGR00156 family protein [Escherichia coli]
gb|PKG08132.1| TIGR00156 family protein [Escherichia coli]
gb|PKI86256.1| TIGR00156 family protein [Escherichia coli]
gb|PKI98249.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ03995.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ08853.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ13650.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ17036.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ20314.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ30516.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ32229.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ38914.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ44725.1| TIGR00156 family protein [Escherichia coli]
gb|PKJ49421.1| TIGR00156 family protein [Escherichia coli]
gb|AUF78721.1| TIGR00156 family protein [Escherichia coli O121:H19]
gb|AUG17739.1| TIGR00156 family protein [Escherichia coli str. K-12 substr.
MG1655]
gb|PKQ94807.1| TIGR00156 family protein [Escherichia coli]
gb|PKR63632.1| TIGR00156 family protein [Escherichia coli]
gb|PKR66258.1| TIGR00156 family protein [Escherichia coli]
gb|PKR72901.1| TIGR00156 family protein [Escherichia coli]
gb|AUG66182.1| TIGR00156 family protein [Escherichia coli]
gb|AUG94943.1| stress-induced protein [Escherichia coli]
gb|PKZ31534.1| TIGR00156 family protein [Escherichia coli]
gb|PKZ49450.1| TIGR00156 family protein [Escherichia coli]
gb|PKZ79328.1| TIGR00156 family protein [Escherichia coli]
gb|PLA85829.1| TIGR00156 family protein [Escherichia coli]
gb|PLA99330.1| TIGR00156 family protein [Escherichia coli]
gb|PLB60106.1| TIGR00156 family protein [Escherichia coli]
gb|PLB61192.1| TIGR00156 family protein [Escherichia coli]
gb|PLB71607.1| TIGR00156 family protein [Escherichia coli]
gb|PLB79194.1| TIGR00156 family protein [Escherichia coli]
gb|AUJ89674.1| TIGR00156 family protein [Escherichia coli]
gb|AUJ97450.1| TIGR00156 family protein [Escherichia coli]
gb|AUJ99646.1| TIGR00156 family protein [Escherichia coli]
gb|AUK05115.1| TIGR00156 family protein [Escherichia coli]
gb|AUK10010.1| TIGR00156 family protein [Escherichia coli]
gb|AUK15266.1| TIGR00156 family protein [Escherichia coli]
gb|AUK20393.1| TIGR00156 family protein [Escherichia coli]
gb|PLJ82479.1| TIGR00156 family protein [Escherichia coli]
gb|PLJ84791.1| TIGR00156 family protein [Escherichia coli]
gb|PLJ86481.1| TIGR00156 family protein [Escherichia coli]
gb|PLJ96146.1| TIGR00156 family protein [Escherichia coli]
gb|PLK08243.1| TIGR00156 family protein [Escherichia coli]
gb|PLK13585.1| TIGR00156 family protein [Escherichia coli]
gb|PLR10717.1| TIGR00156 family protein [Escherichia coli]
gb|AUF92447.1| TIGR00156 family protein [Escherichia coli]
gb|AUL62118.1| TIGR00156 family protein [Escherichia coli]
gb|AUL68651.1| TIGR00156 family protein [Escherichia coli]
gb|AUM06622.1| TIGR00156 family protein [Escherichia coli]
gb|AUN46210.1| TIGR00156 family protein [Escherichia coli]
gb|PMB60016.1| TIGR00156 family protein [Escherichia coli]
gb|PMD76254.1| TIGR00156 family protein [Escherichia coli]
gb|PMD86899.1| TIGR00156 family protein [Escherichia coli]
gb|PMD89401.1| TIGR00156 family protein [Escherichia coli]
gb|PME02779.1| TIGR00156 family protein [Escherichia coli]
emb|SOQ97681.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ87700.1| conserved hypothetical protein [Escherichia coli]
emb|SOR01844.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ81490.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ61435.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ70008.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ77860.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ83598.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ75251.1| conserved hypothetical protein [Escherichia coli]
emb|SOR08654.1| conserved hypothetical protein [Escherichia coli]
gb|AUO33909.1| protein YgiW [Escherichia coli]
gb|AUO39737.1| TIGR00156 family protein [Escherichia coli]
gb|AUO55908.1| TIGR00156 family protein [Escherichia coli]
gb|PNC00129.1| TIGR00156 family protein [Escherichia coli]
gb|PNC03266.1| TIGR00156 family protein [Escherichia coli]
gb|PNC13170.1| TIGR00156 family protein [Escherichia coli]
gb|PND45047.1| TIGR00156 family protein [Escherichia coli]
gb|AUQ38855.1| TIGR00156 family protein [Escherichia coli]
gb|PND69986.1| TIGR00156 family protein [Escherichia coli]
gb|PND76072.1| TIGR00156 family protein [Escherichia coli]
gb|PND79310.1| TIGR00156 family protein [Escherichia coli]
gb|PND87850.1| TIGR00156 family protein [Escherichia coli]
gb|PNE00213.1| TIGR00156 family protein [Escherichia coli]
gb|AUR80626.1| Protein ygiW precursor (plasmid) [Escherichia coli]
gb|PNL70335.1| TIGR00156 family protein [Escherichia coli O157]
gb|PNM71886.1| TIGR00156 family protein [Shigella sonnei]
gb|PNN26458.1| TIGR00156 family protein [Escherichia coli]
gb|PNO47804.1| TIGR00156 family protein [Shigella sonnei]
gb|PNO96949.1| TIGR00156 family protein [Escherichia coli]
gb|PNP02435.1| TIGR00156 family protein [Shigella flexneri]
gb|AUP45326.1| hypothetical protein CV83906_2740 [Escherichia coli]
gb|AUS36880.1| TIGR00156 family protein [Escherichia coli]
gb|PNR03851.1| TIGR00156 family protein [Escherichia coli]
gb|PNR09180.1| TIGR00156 family protein [Escherichia coli]
gb|PNR16196.1| TIGR00156 family protein [Escherichia coli]
gb|PNR17618.1| TIGR00156 family protein [Escherichia coli]
gb|PNR24220.1| TIGR00156 family protein [Escherichia coli]
gb|PNS28285.1| TIGR00156 family protein [Escherichia coli]
gb|AUT07683.1| TIGR00156 family protein [Escherichia coli]
gb|AUN91845.1| TIGR00156 family protein [Escherichia coli]
gb|PNY41471.1| TIGR00156 family protein [Escherichia coli]
gb|PNY47728.1| TIGR00156 family protein [Escherichia coli]
gb|PNY52092.1| TIGR00156 family protein [Escherichia coli]
gb|PNY69047.1| TIGR00156 family protein [Escherichia coli]
gb|AUV22534.1| TIGR00156 family protein [Escherichia coli]
gb|AUV32561.1| TIGR00156 family protein [Escherichia coli]
gb|POF67387.1| TIGR00156 family protein [Escherichia coli]
gb|POF70952.1| TIGR00156 family protein [Escherichia coli]
gb|POF79362.1| TIGR00156 family protein [Escherichia coli]
gb|POF81896.1| TIGR00156 family protein [Escherichia coli]
gb|POH47358.1| TIGR00156 family protein [Escherichia coli]
gb|POH77047.1| TIGR00156 family protein [Escherichia coli]
gb|POH93409.1| TIGR00156 family protein [Escherichia coli]
gb|POH97062.1| TIGR00156 family protein [Escherichia coli]
gb|POH98421.1| TIGR00156 family protein [Escherichia coli]
gb|POI07517.1| TIGR00156 family protein [Escherichia coli]
gb|POI11497.1| TIGR00156 family protein [Escherichia coli]
gb|POL46371.1| TIGR00156 family protein [Escherichia coli]
gb|POL51049.1| TIGR00156 family protein [Escherichia coli]
gb|POL56793.1| TIGR00156 family protein [Escherichia coli]
gb|POL57647.1| TIGR00156 family protein [Escherichia coli]
gb|POL67418.1| TIGR00156 family protein [Escherichia coli]
gb|POL72943.1| TIGR00156 family protein [Escherichia coli]
gb|POL75569.1| TIGR00156 family protein [Escherichia coli]
gb|POL83422.1| TIGR00156 family protein [Escherichia coli]
gb|POL83517.1| TIGR00156 family protein [Escherichia coli]
gb|POL94293.1| TIGR00156 family protein [Escherichia coli]
gb|POL96251.1| TIGR00156 family protein [Escherichia coli]
gb|POL98069.1| TIGR00156 family protein [Escherichia coli]
gb|AUX00954.1| Protein ygiW precursor [Escherichia coli]
gb|POO38330.1| TIGR00156 family protein [Escherichia coli]
gb|POO40644.1| TIGR00156 family protein [Escherichia coli]
gb|POO44974.1| TIGR00156 family protein [Escherichia coli]
gb|AUY04079.1| TIGR00156 family protein [Escherichia coli]
gb|AUY44163.1| TIGR00156 family protein [Escherichia coli]
gb|AUY27930.1| Protein YgiW [Escherichia coli]
gb|POS14920.1| TIGR00156 family protein [Escherichia coli]
gb|POS23872.1| TIGR00156 family protein [Escherichia coli]
gb|POS25737.1| TIGR00156 family protein [Escherichia coli]
gb|POS31500.1| TIGR00156 family protein [Escherichia coli]
gb|POS34464.1| TIGR00156 family protein [Escherichia coli]
gb|POS37129.1| TIGR00156 family protein [Escherichia coli]
gb|POS47071.1| TIGR00156 family protein [Escherichia coli]
gb|POS48049.1| TIGR00156 family protein [Escherichia coli]
gb|POS56197.1| TIGR00156 family protein [Escherichia coli]
gb|POS59956.1| TIGR00156 family protein [Escherichia coli]
gb|POT07117.1| TIGR00156 family protein [Escherichia coli]
gb|POT09196.1| TIGR00156 family protein [Escherichia coli]
gb|POT09525.1| TIGR00156 family protein [Escherichia coli]
gb|POT18957.1| TIGR00156 family protein [Escherichia coli]
gb|POT22107.1| TIGR00156 family protein [Escherichia coli]
gb|POT23320.1| TIGR00156 family protein [Escherichia coli]
gb|POU27871.1| TIGR00156 family protein [Escherichia coli]
gb|POV25725.1| TIGR00156 family protein [Escherichia coli]
gb|AUZ90527.1| TIGR00156 family protein [Escherichia coli]
gb|POZ06765.1| TIGR00156 family protein [Escherichia coli]
gb|AVB44202.1| TIGR00156 family protein [Escherichia coli]
gb|PPA52504.1| TIGR00156 family protein [Escherichia coli]
gb|AVD30267.1| TIGR00156 family protein [Escherichia coli]
gb|PPE09681.1| TIGR00156 family protein [Escherichia coli]
gb|PPE17297.1| TIGR00156 family protein [Escherichia coli]
gb|PPE19867.1| TIGR00156 family protein [Escherichia coli]
gb|PPE27154.1| TIGR00156 family protein [Escherichia coli]
gb|PPE32308.1| TIGR00156 family protein [Escherichia coli]
gb|PPE36869.1| TIGR00156 family protein [Escherichia coli]
gb|PPE41025.1| TIGR00156 family protein [Escherichia coli]
gb|PPE45875.1| TIGR00156 family protein [Escherichia coli]
gb|PPE51286.1| TIGR00156 family protein [Escherichia coli]
gb|PPE93452.1| TIGR00156 family protein [Escherichia coli]
gb|AVE95312.1| TIGR00156 family protein [Escherichia coli]
gb|AVG00674.1| TIGR00156 family protein [Escherichia coli]
gb|PPI91043.1| TIGR00156 family protein [Escherichia coli]
gb|PPO26349.1| TIGR00156 family protein [Escherichia coli]
gb|PPP02358.1| TIGR00156 family protein [Escherichia coli]
gb|AVH84790.1| TIGR00156 family protein [Shigella sonnei]
gb|PPV47974.1| TIGR00156 family protein [Escherichia coli]
gb|PPV48631.1| TIGR00156 family protein [Escherichia coli]
gb|PPV58362.1| TIGR00156 family protein [Escherichia coli]
gb|PPV65494.1| TIGR00156 family protein [Escherichia coli]
gb|PPV72355.1| TIGR00156 family protein [Escherichia coli]
gb|PPV75093.1| TIGR00156 family protein [Escherichia coli]
gb|PPV85732.1| TIGR00156 family protein [Escherichia coli]
gb|PPV91456.1| TIGR00156 family protein [Escherichia coli]
gb|PPV93876.1| TIGR00156 family protein [Escherichia coli]
gb|PPW02773.1| TIGR00156 family protein [Escherichia coli]
gb|PPW07471.1| TIGR00156 family protein [Escherichia coli]
gb|PPW12702.1| TIGR00156 family protein [Escherichia coli]
gb|PPW14439.1| TIGR00156 family protein [Escherichia coli]
gb|PPW20112.1| TIGR00156 family protein [Escherichia coli]
gb|PPW26743.1| TIGR00156 family protein [Escherichia coli]
gb|PPW30956.1| TIGR00156 family protein [Escherichia coli]
gb|PPW35762.1| TIGR00156 family protein [Escherichia coli]
gb|PPW45922.1| TIGR00156 family protein [Escherichia coli]
gb|PPW47487.1| TIGR00156 family protein [Escherichia coli]
gb|PPW49484.1| TIGR00156 family protein [Escherichia coli]
gb|PPW53962.1| TIGR00156 family protein [Escherichia coli]
gb|PPW61163.1| TIGR00156 family protein [Escherichia coli]
gb|PPW66358.1| TIGR00156 family protein [Escherichia coli]
gb|PPW69099.1| TIGR00156 family protein [Escherichia coli]
gb|PPW70547.1| TIGR00156 family protein [Escherichia coli]
gb|PPW81838.1| TIGR00156 family protein [Escherichia coli]
gb|PPW83823.1| TIGR00156 family protein [Escherichia coli]
gb|PPW97366.1| TIGR00156 family protein [Escherichia coli]
gb|PPX04193.1| TIGR00156 family protein [Escherichia coli]
gb|PPX11389.1| TIGR00156 family protein [Escherichia coli]
gb|PPX20014.1| TIGR00156 family protein [Escherichia coli]
gb|PPX20564.1| TIGR00156 family protein [Escherichia coli]
gb|PPX29307.1| TIGR00156 family protein [Escherichia coli]
gb|PPX33334.1| TIGR00156 family protein [Escherichia coli]
gb|PPX46746.1| TIGR00156 family protein [Escherichia coli]
gb|PPX50241.1| TIGR00156 family protein [Escherichia coli]
gb|PPX54461.1| TIGR00156 family protein [Escherichia coli]
gb|PPX58541.1| TIGR00156 family protein [Escherichia coli]
gb|PPX59126.1| TIGR00156 family protein [Escherichia coli]
gb|PPY60549.1| TIGR00156 family protein [Escherichia coli]
gb|PPY66007.1| TIGR00156 family protein [Escherichia coli]
gb|PPY67948.1| TIGR00156 family protein [Escherichia coli]
gb|PPY72815.1| TIGR00156 family protein [Escherichia coli]
gb|PPY84100.1| TIGR00156 family protein [Escherichia coli]
gb|PPY87012.1| TIGR00156 family protein [Escherichia coli]
gb|PPY90145.1| TIGR00156 family protein [Escherichia coli]
gb|PPY98119.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ04282.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ08989.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ12784.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ15783.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ21878.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ29205.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ31582.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ36597.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ43172.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ57448.1| TIGR00156 family protein [Escherichia coli]
gb|PPZ99345.1| TIGR00156 family protein [Escherichia coli]
gb|PQA05312.1| TIGR00156 family protein [Escherichia coli]
gb|PQA10393.1| TIGR00156 family protein [Escherichia coli]
gb|PQA12789.1| TIGR00156 family protein [Escherichia coli]
gb|PQA21303.1| TIGR00156 family protein [Escherichia coli]
gb|PQA22257.1| TIGR00156 family protein [Escherichia coli]
gb|PQA26767.1| TIGR00156 family protein [Escherichia coli]
gb|PQA33068.1| TIGR00156 family protein [Escherichia coli]
gb|PQA38699.1| TIGR00156 family protein [Escherichia coli]
gb|PQA39092.1| TIGR00156 family protein [Escherichia coli]
gb|PQA48622.1| TIGR00156 family protein [Escherichia coli]
gb|PQA55412.1| TIGR00156 family protein [Escherichia coli]
gb|PQA65041.1| TIGR00156 family protein [Escherichia coli]
gb|PQA69597.1| TIGR00156 family protein [Escherichia coli]
gb|PQH08278.1| TIGR00156 family protein [Escherichia coli]
gb|PQK22799.1| TIGR00156 family protein [Escherichia coli]
gb|PQK29009.1| TIGR00156 family protein [Escherichia coli]
gb|PQK30196.1| TIGR00156 family protein [Escherichia coli]
gb|PQK33281.1| TIGR00156 family protein [Escherichia coli]
gb|PQK39489.1| TIGR00156 family protein [Escherichia coli]
gb|PQK60130.1| TIGR00156 family protein [Escherichia coli]
gb|PQK67374.1| TIGR00156 family protein [Escherichia coli]
gb|PQK67801.1| TIGR00156 family protein [Escherichia coli]
gb|AVI53193.1| TIGR00156 family protein [Escherichia coli str. K-12 substr.
MG1655]
gb|AVJ14713.1| TIGR00156 family protein [Escherichia coli]
gb|PQN22346.1| TIGR00156 family protein [Shigella dysenteriae]
gb|PQN39871.1| TIGR00156 family protein [Shigella boydii]
gb|PQN49224.1| TIGR00156 family protein [Shigella boydii]
gb|PQN55150.1| TIGR00156 family protein [Shigella dysenteriae]
gb|PQN57981.1| TIGR00156 family protein [Shigella dysenteriae]
gb|PQN65250.1| TIGR00156 family protein [Shigella flexneri]
gb|PQO68243.1| TIGR00156 family protein [Escherichia coli]
gb|PQO70477.1| TIGR00156 family protein [Escherichia coli]
gb|PQO74524.1| TIGR00156 family protein [Escherichia coli]
gb|PQO82045.1| TIGR00156 family protein [Escherichia coli]
gb|PQO86842.1| TIGR00156 family protein [Escherichia coli]
gb|PQO97632.1| TIGR00156 family protein [Escherichia coli]
gb|PQP08962.1| TIGR00156 family protein [Escherichia coli]
gb|PQP32344.1| TIGR00156 family protein [Escherichia coli]
gb|AVJ77920.1| protein YgiW [Escherichia coli]
gb|PQV22737.1| TIGR00156 family protein [Escherichia coli]
gb|PQV27918.1| TIGR00156 family protein [Escherichia coli]
gb|PQV29022.1| TIGR00156 family protein [Escherichia coli]
gb|PQV36282.1| TIGR00156 family protein [Escherichia coli]
gb|PQV40411.1| TIGR00156 family protein [Escherichia coli]
gb|PRB39009.1| TIGR00156 family protein [Escherichia coli]
gb|PRC27376.1| TIGR00156 family protein [Escherichia coli]
gb|AVL31010.1| TIGR00156 family protein [Escherichia coli O104:H4]
gb|AVM05117.1| TIGR00156 family protein [Escherichia coli]
gb|PRP04325.1| TIGR00156 family protein [Escherichia coli]
gb|PRP05887.1| TIGR00156 family protein [Escherichia coli]
gb|PRP10463.1| TIGR00156 family protein [Escherichia coli]
gb|PRP14960.1| TIGR00156 family protein [Escherichia coli]
gb|PRP17497.1| TIGR00156 family protein [Escherichia coli]
gb|PRP23298.1| TIGR00156 family protein [Escherichia coli]
gb|PRP24291.1| TIGR00156 family protein [Escherichia coli]
gb|PRP24913.1| TIGR00156 family protein [Escherichia coli]
gb|PRP38886.1| TIGR00156 family protein [Escherichia coli]
gb|PRP42370.1| TIGR00156 family protein [Escherichia coli]
gb|PRP45773.1| TIGR00156 family protein [Escherichia coli]
gb|AVM99831.1| TIGR00156 family protein [Escherichia coli]
gb|AVN11477.1| protein YgiW [Escherichia coli]
gb|AVL07993.1| TIGR00156 family protein [Escherichia coli]
gb|AVN38216.1| TIGR00156 family protein [Escherichia coli]
gb|PRW37261.1| protein YgiW [Escherichia coli]
gb|PRW48381.1| protein YgiW [Escherichia coli]
gb|PSB94427.1| TIGR00156 family protein [Escherichia coli]
gb|PSF27435.1| TIGR00156 family protein [Escherichia coli]
gb|PSF28778.1| TIGR00156 family protein [Escherichia coli]
gb|PSF41214.1| TIGR00156 family protein [Escherichia coli]
gb|PSF45846.1| TIGR00156 family protein [Escherichia coli]
gb|PSF50003.1| TIGR00156 family protein [Escherichia coli]
gb|PSF57759.1| TIGR00156 family protein [Escherichia coli]
gb|PSF59480.1| TIGR00156 family protein [Escherichia coli]
gb|PSF64877.1| TIGR00156 family protein [Escherichia coli]
gb|PSF73154.1| TIGR00156 family protein [Escherichia coli]
gb|PSF74419.1| TIGR00156 family protein [Escherichia coli]
gb|PSF79667.1| TIGR00156 family protein [Escherichia coli]
gb|PSF92660.1| TIGR00156 family protein [Escherichia coli]
gb|PSF94176.1| TIGR00156 family protein [Escherichia coli]
gb|PSG01635.1| TIGR00156 family protein [Escherichia coli]
gb|PSG05865.1| TIGR00156 family protein [Escherichia coli]
gb|PSG10696.1| TIGR00156 family protein [Escherichia coli]
gb|PSG15401.1| TIGR00156 family protein [Escherichia coli]
gb|PSG20886.1| TIGR00156 family protein [Escherichia coli]
gb|PSG24590.1| TIGR00156 family protein [Escherichia coli]
gb|PSG30126.1| TIGR00156 family protein [Escherichia coli]
gb|PSG34585.1| TIGR00156 family protein [Escherichia coli]
gb|PSG38937.1| TIGR00156 family protein [Escherichia coli]
gb|PSG44725.1| TIGR00156 family protein [Escherichia coli]
gb|PSG48465.1| TIGR00156 family protein [Escherichia coli]
gb|PSG54863.1| TIGR00156 family protein [Escherichia coli]
gb|PSG58019.1| TIGR00156 family protein [Escherichia coli]
gb|PSG70397.1| TIGR00156 family protein [Escherichia coli]
gb|PSG75689.1| TIGR00156 family protein [Escherichia coli]
gb|PSG81522.1| TIGR00156 family protein [Escherichia coli]
gb|AVP31210.1| TIGR00156 family protein [Escherichia coli]
gb|PSK09142.1| TIGR00156 family protein [Escherichia coli]
gb|PSK23945.1| TIGR00156 family protein [Escherichia coli]
gb|PSL58934.1| TIGR00156 family protein [Escherichia coli]
gb|PSL67260.1| TIGR00156 family protein [Escherichia coli]
gb|PSL71742.1| TIGR00156 family protein [Escherichia coli]
gb|PSL74978.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (663), Expect = 3e-87
Identities = 129/129 (100%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_096988190.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (662), Expect = 4e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
+TLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 ITLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_089583795.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (662), Expect = 4e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTT+ESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTIESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_069903762.1| TIGR00156 family protein [Escherichia coli]
gb|OEL75224.1| TIGR00156 family protein [Escherichia coli]
gb|OEO22209.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (662), Expect = 4e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTIN+DIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINIDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_021577970.1| TIGR00156 family protein [Escherichia coli]
gb|EQZ98111.1| protein ygiW [Escherichia coli UMEA 3718-1]
gb|OJR48606.1| TIGR00156 family protein [Escherichia coli]
gb|OJR49268.1| TIGR00156 family protein [Escherichia coli]
gb|OJS69475.1| TIGR00156 family protein [Escherichia coli]
gb|AQZ75771.1| protein YgiW [Escherichia coli]
gb|PAX49337.1| TIGR00156 family protein [Escherichia coli]
gb|PAX57463.1| TIGR00156 family protein [Escherichia coli]
gb|PBS22353.1| TIGR00156 family protein [Escherichia coli]
gb|PBS52445.1| TIGR00156 family protein [Escherichia coli]
gb|PBS56946.1| TIGR00156 family protein [Escherichia coli]
gb|PBS62281.1| TIGR00156 family protein [Escherichia coli]
gb|PBS68759.1| TIGR00156 family protein [Escherichia coli]
gb|PBS69955.1| TIGR00156 family protein [Escherichia coli]
gb|PBS74320.1| TIGR00156 family protein [Escherichia coli]
gb|PBS80636.1| TIGR00156 family protein [Escherichia coli]
gb|PBS85463.1| TIGR00156 family protein [Escherichia coli]
gb|PLB66728.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (662), Expect = 4e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGS+TTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSITTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_001330010.1| TIGR00156 family protein [Escherichia coli]
gb|EFK20953.1| TIGR00156 family protein [Escherichia coli MS 21-1]
gb|EOU88095.1| protein ygiW [Escherichia coli KTE36]
gb|KXL26676.1| hypothetical protein AXH14_02840 [Escherichia coli]
Length = 130
Score = 259 bits (662), Expect = 4e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGE+DKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEIDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_104725572.1| TIGR00156 family protein [Escherichia coli]
gb|PPX26771.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 259 bits (661), Expect = 5e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGT+NVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTLNVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_052920118.1| TIGR00156 family protein [Escherichia coli]
gb|KNY78519.1| hypothetical protein AGA26_02835 [Escherichia coli]
Length = 130
Score = 259 bits (661), Expect = 5e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGN+VERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNLVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_097755184.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVI+VMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVISVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_097336758.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGG+QGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGYQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_096969485.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQ+QAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQNQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_096853128.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCS+PVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSSPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_039060162.1| TIGR00156 family protein [Escherichia coli]
gb|OUZ65142.1| TIGR00156 family protein [Shigella flexneri]
gb|ASA59000.1| TIGR00156 family protein [Escherichia coli]
gb|ASA64258.1| TIGR00156 family protein [Escherichia coli]
gb|OWS87037.1| TIGR00156 family protein [Escherichia coli]
gb|PSF87012.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVE+AKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVENAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_073461824.1| TIGR00156 family protein [Escherichia coli]
gb|APJ71025.1| hypothetical protein RG27_05015 [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDT+EIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTLEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_057698165.1| TIGR00156 family protein [Escherichia coli]
gb|KQJ43005.1| hypothetical protein AM270_10985 [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAE+GGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEEGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_024224930.1| TIGR00156 family protein [Escherichia coli]
emb|CTW72343.1| protein YgiW [Escherichia coli]
emb|CTX39330.1| protein YgiW [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNG+TVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGMTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129
>ref|WP_047645898.1| TIGR00156 family protein [Escherichia coli]
Length = 130
Score = 258 bits (660), Expect = 7e-87
Identities = 128/129 (99%), Positives = 129/129 (100%)
Frame = +3
Query: 24 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW 203
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNG+VTTVESAKSLRDDTW
Sbjct: 1 MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGNVTTVESAKSLRDDTW 60
Query: 204 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 383
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
Sbjct: 61 VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI 120
Query: 384 DVKQIRKVN 410
DVKQIRKVN
Sbjct: 121 DVKQIRKVN 129