BLASTX nr result
ID: Acanthopanax21_contig00000544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00000544 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF45988.1| conserved hypothetical protein [Ricinus communis] 65 3e-09 >gb|EEF45988.1| conserved hypothetical protein [Ricinus communis] Length = 351 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 16 HREACSSGCSVLYMLAADKDDFPIRLPARLYSCGT 120 HREA GCSVLYML ADKD+FPIRLPARLYSCGT Sbjct: 160 HREAYFWGCSVLYMLTADKDNFPIRLPARLYSCGT 194