BLASTX nr result
ID: Acanthopanax21_contig00000507
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00000507 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlise... 72 4e-14 gb|OMP00772.1| hypothetical protein CCACVL1_03299 [Corchorus cap... 59 3e-09 >gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlisea aurea] Length = 80 Score = 72.4 bits (176), Expect = 4e-14 Identities = 43/73 (58%), Positives = 49/73 (67%) Frame = -3 Query: 243 KKEREGFEPSIVLCSKPCRFSRPELSTTQPSLQKTIFILFLRIEHGYMSRYNTTICL*KD 64 KKEREGFEPSIVLCSK RFSRPELST QPSL+K I IL +RI G+ +TT+ D Sbjct: 2 KKEREGFEPSIVLCSKLYRFSRPELSTPQPSLRKPISILLVRIADGH-KEMDTTL----D 56 Query: 63 LGCESTGRSIRIY 25 RSI +Y Sbjct: 57 RSPRLISRSIYLY 69 >gb|OMP00772.1| hypothetical protein CCACVL1_03299 [Corchorus capsularis] gb|OMP10353.1| hypothetical protein CCACVL1_00985 [Corchorus capsularis] gb|OMP10516.1| hypothetical protein CCACVL1_00906 [Corchorus capsularis] gb|OMP10577.1| hypothetical protein CCACVL1_00865 [Corchorus capsularis] gb|OMP10790.1| hypothetical protein CCACVL1_00790 [Corchorus capsularis] gb|OMP11023.1| hypothetical protein CCACVL1_00721 [Corchorus capsularis] gb|OMP12857.1| ORF75b [Corchorus olitorius] Length = 32 Score = 58.9 bits (141), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 153 MAEWLIAPVLKTGMVLNKELSRVRIPLSPF 242 MAEWLIAPVLKTG+V NKELSRVRIPLSPF Sbjct: 1 MAEWLIAPVLKTGIVRNKELSRVRIPLSPF 30