BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Acanthopanax21_contig00000410
         (1008 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|ABJ02606.1| conserved hypothetical protein [Escherichia coli ...   222   7e-70
gb|EGI44568.1| putative inner membrane protein [Escherichia coli...   221   2e-69
gb|EGI39478.1| putative inner membrane protein [Escherichia coli...   221   2e-69
gb|EGI14793.1| putative inner membrane protein [Escherichia coli...   221   2e-69
gb|OSL46872.1| putative inner membrane protein [Escherichia coli...   214   1e-66
gb|EPE44247.1| putative inner membrane protein [Salmonella enter...   109   2e-62
ref|WP_000096091.1| MULTISPECIES: hypothetical protein [Proteoba...   199   7e-61
ref|WP_096945363.1| hypothetical protein [Escherichia coli]           198   1e-60
ref|WP_060615258.1| hypothetical protein [Escherichia coli] >gi|...   198   1e-60
ref|WP_097310636.1| hypothetical protein [Escherichia coli]           197   2e-60
ref|WP_095079549.1| hypothetical protein [Escherichia coli] >gi|...   197   2e-60
ref|WP_097301946.1| hypothetical protein [Escherichia coli]           197   3e-60
ref|WP_086642282.1| hypothetical protein [Escherichia coli] >gi|...   197   3e-60
ref|WP_032233698.1| membrane protein [Escherichia coli] >gi|6338...   197   3e-60
ref|WP_032237323.1| membrane protein [Escherichia coli] >gi|6110...   197   3e-60
ref|WP_001554524.1| hypothetical protein [Escherichia coli] >gi|...   197   3e-60
ref|WP_089636792.1| hypothetical protein [Escherichia coli]           197   4e-60
ref|WP_074562392.1| hypothetical protein [Escherichia coli] >gi|...   197   4e-60
ref|WP_000096086.1| MULTISPECIES: hypothetical protein [Enteroba...   197   4e-60
ref|WP_000096087.1| hypothetical protein [Escherichia coli] >gi|...   197   4e-60

>gb|ABJ02606.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|EGI20161.1| putative inner membrane protein [Escherichia coli M718]
 gb|AER86084.1| hypothetical protein i02_3549 [Escherichia coli str. 'clone D i2']
 gb|AER91003.1| hypothetical protein i14_3549 [Escherichia coli str. 'clone D i14']
 emb|CDP66194.1| Putative uncharacterized protein yqjK [Escherichia coli D6-113.11]
 emb|CDU33603.1| Putative uncharacterized protein yqjK [Escherichia coli D6-113.11]
 gb|OSK09657.1| hypothetical protein EAOG_04269 [Escherichia coli R527]
 gb|OSK21015.1| putative inner membrane protein [Escherichia coli M056]
 gb|OSK54139.1| putative inner membrane protein [Escherichia coli H413]
 gb|OSK92847.1| putative inner membrane protein [Escherichia coli TA447]
 gb|OSL42866.1| putative inner membrane protein [Escherichia coli H461]
 emb|SLM08240.1| hypothetical protein BQ9544_3393 [Escherichia coli O127:H6]
 emb|SNU19953.1| hypothetical protein BQ9550_3393 [Escherichia coli O127:H6]
          Length = 113

 Score =  222 bits (566), Expect = 7e-70
 Identities = 110/112 (98%), Positives = 110/112 (98%)
 Frame = +2

Query: 671  MS*QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNML 850
            MS QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLE TGAYDRRWNML
Sbjct: 1    MSWQTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNML 60

Query: 851  LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 112


>gb|EGI44568.1| putative inner membrane protein [Escherichia coli H591]
 gb|ALY14651.1| putative inner membrane protein [Escherichia coli]
 gb|OSL60392.1| putative inner membrane protein [Escherichia coli H420]
          Length = 113

 Score =  221 bits (563), Expect = 2e-69
 Identities = 109/112 (97%), Positives = 110/112 (98%)
 Frame = +2

Query: 671  MS*QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNML 850
            MS QTIG+CSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLE TGAYDRRWNML
Sbjct: 1    MSWQTIGNCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNML 60

Query: 851  LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 112


>gb|EGI39478.1| putative inner membrane protein [Escherichia coli TA280]
          Length = 113

 Score =  221 bits (563), Expect = 2e-69
 Identities = 109/112 (97%), Positives = 110/112 (98%)
 Frame = +2

Query: 671  MS*QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNML 850
            MS QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLE TGAYDRRWNML
Sbjct: 1    MSWQTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNML 60

Query: 851  LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFG+WSAWRLVKTTLKQQQLR
Sbjct: 61   LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGLWSAWRLVKTTLKQQQLR 112


>gb|EGI14793.1| putative inner membrane protein [Escherichia coli M605]
 emb|CUX83280.1| conserved hypothetical protein [Escherichia coli]
 gb|OSK49435.1| putative inner membrane protein [Escherichia coli H588]
 gb|OSL35847.1| putative inner membrane protein [Escherichia coli TA464]
          Length = 113

 Score =  221 bits (563), Expect = 2e-69
 Identities = 109/112 (97%), Positives = 110/112 (98%)
 Frame = +2

Query: 671  MS*QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNML 850
            MS QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSA+RREWLE TGAYDRRWNML
Sbjct: 1    MSWQTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSATRREWLEATGAYDRRWNML 60

Query: 851  LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 112


>gb|OSL46872.1| putative inner membrane protein [Escherichia coli H605]
          Length = 113

 Score =  214 bits (545), Expect = 1e-66
 Identities = 104/112 (92%), Positives = 109/112 (97%)
 Frame = +2

Query: 671  MS*QTIGSCSRRSPVSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNML 850
            M+ +TIG+CSRRSPVS KVERERRKAQLLSQIQQQRLDLSASRR+WLE TGAYDRRWN+L
Sbjct: 1    MNWRTIGNCSRRSPVSGKVERERRKAQLLSQIQQQRLDLSASRRDWLEATGAYDRRWNIL 60

Query: 851  LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   LSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 112


>gb|EPE44247.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. GXS2268]
          Length = 246

 Score =  109 bits (272), Expect(3) = 2e-62
 Identities = 56/82 (68%), Positives = 62/82 (75%)
 Frame = +3

Query: 18  MSKEHTTEHLRAELKSLSDTXXXXXXXXXXXXXXXXXXIRSKAEQALKQSRYRLGETGDA 197
           MSK++TTEHLRAELKSL+DT                  IRSKAE+ALK+SRYRLGETGD 
Sbjct: 1   MSKDNTTEHLRAELKSLTDTLEEVLSSSGEKSKEELSKIRSKAERALKESRYRLGETGDV 60

Query: 198 IAKQTRVAAARADEYVRENPWT 263
           IAKQTR AAARAD+YVRENPWT
Sbjct: 61  IAKQTRAAAARADDYVRENPWT 82



 Score = 90.9 bits (224), Expect(3) = 2e-62
 Identities = 48/62 (77%), Positives = 52/62 (83%)
 Frame = +2

Query: 266 RGHWRCNRCSARRSAVASLIMADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVEL 445
           R HWR  R    R+A ASLIMAD+  AQGPGKSVLGIGQRIV+I+VEMVETRLRLAVVEL
Sbjct: 95  RRHWRRCRSGVGRTADASLIMADSRQAQGPGKSVLGIGQRIVTIIVEMVETRLRLAVVEL 154

Query: 446 EE 451
           EE
Sbjct: 155 EE 156



 Score = 90.5 bits (223), Expect(3) = 2e-62
 Identities = 44/63 (69%), Positives = 48/63 (76%)
 Frame = +1

Query: 499 AAFGLMSLMVLIIWAVDPQYRLNAMXXXXXXXXXXXXXXXIWTLRKSRKSTLLRHTRHEL 678
           AAFGLMSLMVL+IWA+DPQYRLNAM               IWTLRK+R+STLLRHTRHEL
Sbjct: 175 AAFGLMSLMVLVIWAIDPQYRLNAMIATTVVLLVLALIGGIWTLRKARQSTLLRHTRHEL 234

Query: 679 AND 687
           AND
Sbjct: 235 AND 237


>ref|WP_000096091.1| MULTISPECIES: hypothetical protein [Proteobacteria]
 ref|NP_417571.1| uncharacterized protein b3100 [Escherichia coli str. K-12 substr.
            MG1655]
 sp|Q47710.1|YQJK_ECOLI RecName: Full=Uncharacterized protein YqjK
 gb|AAA57904.1| ORF_o99; 8 base overlap with o157 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|AAC76135.1| uncharacterized protein b3100 [Escherichia coli str. K-12 substr.
            MG1655]
 dbj|BAE77150.1| conserved hypothetical protein [Escherichia coli str. K-12 substr.
            W3110]
 gb|ACB04184.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gb|EEH71917.1| hypothetical protein ESCG_00604 [Escherichia sp. 1_1_43]
 gb|ACR62528.1| conserved protein [Escherichia coli BW2952]
 gb|ACX38288.1| conserved hypothetical protein [Escherichia coli DH1]
 gb|EFI88400.1| hypothetical protein HMPREF9551_02587 [Escherichia coli MS 196-1]
 gb|EFJ64635.1| hypothetical protein HMPREF9547_04206 [Escherichia coli MS 175-1]
 gb|EFK13632.1| hypothetical protein HMPREF9541_04028 [Escherichia coli MS 116-1]
 gb|EFK91656.1| hypothetical protein HMPREF9543_01438 [Escherichia coli MS 146-1]
 emb|CBJ02870.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 dbj|BAJ44851.1| hypothetical protein ECDH1ME8569_2995 [Escherichia coli DH1]
 gb|EFU97787.1| uncharacterized protein yqjK [Escherichia coli 3431]
 gb|EGB32499.1| hypothetical protein ERCG_02663 [Escherichia coli E1520]
 gb|EGI09494.1| putative inner membrane protein [Escherichia coli H736]
 gb|AEE58392.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gb|AEJ58500.1| uncharacterized protein yqjK [Escherichia coli UMNF18]
 gb|EGV46851.1| hypothetical protein IAM_14892 [Escherichia coli XH001]
 gb|EGW92718.1| hypothetical protein ECSTECEH250_3787 [Escherichia coli STEC_EH250]
 gb|EGX04792.1| hypothetical protein ECG581_3522 [Escherichia coli G58-1]
 gb|EGX15748.1| hypothetical protein ECSTECS1191_4138 [Escherichia coli STEC_S1191]
 dbj|BAL39751.1| conserved protein [Escherichia coli str. K-12 substr. MDS42]
 gb|EHV53613.1| hypothetical protein ECDEC6B_4158 [Escherichia coli DEC6B]
 gb|EHV54855.1| cell division MukB-like protein [Escherichia coli DEC6A]
 gb|EHV57655.1| cell division MukB-like protein [Escherichia coli DEC6C]
 gb|EHV68179.1| cell division MukB-like protein [Escherichia coli DEC6D]
 gb|EHV70830.1| hypothetical protein ECDEC6E_3716 [Escherichia coli DEC6E]
 gb|EHV93308.1| hypothetical protein ECDEC7B_3385 [Escherichia coli DEC7B]
 gb|EIE38176.1| hypothetical protein OQE_06770 [Escherichia coli J53]
 gb|EIF18637.1| hypothetical protein UWO_09022 [Escherichia coli O32:H37 str. P4]
 gb|EIF85126.1| hypothetical protein ESMG_02797 [Escherichia coli M919]
 gb|EIG47090.1| hypothetical protein ESSG_02023 [Escherichia coli H730]
 gb|EIG69212.1| hypothetical protein ESBG_02775 [Escherichia sp. 4_1_40B]
 gb|EII44201.1| hypothetical protein EC23916_0953 [Escherichia coli 2.3916]
 gb|EII68158.1| hypothetical protein EC24168_3406 [Escherichia coli 2.4168]
 gb|EII77973.1| hypothetical protein EC32303_3538 [Escherichia coli 3.2303]
 gb|EIJ04693.1| hypothetical protein ECB41_3484 [Escherichia coli B41]
 gb|EIL67579.1| hypothetical protein EC75_09080 [Escherichia coli 75]
 gb|EKI16973.1| cell division MukB-like protein [Escherichia coli TW15901]
 gb|EKI25505.1| cell division MukB-like protein [Escherichia coli TW00353]
 gb|EKJ83790.1| hypothetical protein ECAD30_10530 [Escherichia coli AD30]
 gb|EKK41626.1| cell division MukB-like protein [Escherichia coli 8.0566]
 gb|EKK42609.1| yqjK-like family protein [Escherichia coli 8.0569]
 gb|ELB97579.1| hypothetical protein WCA_04099 [Escherichia coli KTE2]
 gb|ELC58160.1| hypothetical protein WGI_04147 [Escherichia coli KTE44]
 gb|ELD76117.1| hypothetical protein A195_03086 [Escherichia coli KTE235]
 gb|ELE17166.1| hypothetical protein A1SK_01072 [Escherichia coli KTE56]
 gb|ELE57735.1| hypothetical protein A1UO_03358 [Escherichia coli KTE76]
 gb|ELE61818.1| hypothetical protein A1UQ_03593 [Escherichia coli KTE77]
 gb|ELE69945.1| hypothetical protein A1UY_03682 [Escherichia coli KTE81]
 gb|ELE96469.1| hypothetical protein A1WY_03745 [Escherichia coli KTE111]
 gb|ELE97834.1| hypothetical protein A1Y3_04278 [Escherichia coli KTE116]
 gb|ELF17485.1| hypothetical protein A31A_03786 [Escherichia coli KTE156]
 gb|ELF32052.1| hypothetical protein A31G_00429 [Escherichia coli KTE161]
 gb|ELF36066.1| hypothetical protein A31Q_03731 [Escherichia coli KTE171]
 gb|ELF71559.1| hypothetical protein WGE_03849 [Escherichia coli KTE42]
 gb|ELH45910.1| hypothetical protein A155_03763 [Escherichia coli KTE197]
 gb|ELI36172.1| hypothetical protein WII_03477 [Escherichia coli KTE120]
 gb|ELI40612.1| hypothetical protein WIK_03546 [Escherichia coli KTE122]
 gb|ELJ08201.1| hypothetical protein WKC_03103 [Escherichia coli KTE157]
 emb|CCP95254.1| Inner membrane protein YqjK [Escherichia coli O10:K5(L):H4 str. ATCC
            23506]
 gb|EMD06392.1| hypothetical protein C201_14570 [Escherichia coli S17]
 gb|EMR93343.1| hypothetical protein C4893_30140 [Escherichia coli ONT:H33 str.
            C48/93]
 gb|EMS06482.1| hypothetical protein C4390_30620 [Escherichia coli O127:H27 str.
            C43/90]
 gb|EMV38145.1| yqjK-like family protein [Escherichia coli BCE019_MS-13]
 gb|EMV53898.1| yqjK-like family protein [Escherichia coli 2872000]
 gb|EMV54451.1| yqjK-like family protein [Escherichia coli 2871950]
 gb|EMW33141.1| yqjK-like family protein [Escherichia coli 2785200]
 gb|EMW54807.1| yqjK-like family protein [Escherichia coli 2762100]
 gb|EMW75444.1| yqjK-like family protein [Escherichia coli 2731150]
 gb|EMW85540.1| yqjK-like family protein [Escherichia coli 180050]
 gb|EMW94207.1| yqjK-like family protein [Escherichia coli 174750]
 gb|EMX23001.1| yqjK-like family protein [Escherichia coli MP021566.1]
 gb|EMX29663.1| yqjK-like family protein [Escherichia coli MP021561.2]
 gb|EMZ65449.1| yqjK-like family protein [Escherichia coli 2846750]
 gb|EMZ77902.1| yqjK-like family protein [Escherichia coli 2722950]
 gb|EMZ91342.1| yqjK-like family protein [Escherichia coli P0305260.1]
 gb|ENA03143.1| yqjK-like family protein [Escherichia coli P0299438.2]
 gb|ENA19493.1| yqjK-like family protein [Escherichia coli 201600.1]
 gb|ENA28917.1| yqjK-like family protein [Escherichia coli BCE007_MS-11]
 gb|ENA50451.1| yqjK-like family protein [Escherichia coli 2726950]
 gb|ENA76028.1| yqjK-like family protein [Escherichia coli 2730450]
 gb|ENA77429.1| yqjK-like family protein [Escherichia coli 2741950]
 gb|ENB19933.1| yqjK-like family protein [Escherichia coli BCE011_MS-01]
 gb|ENB25947.1| yqjK-like family protein [Escherichia coli BCE030_MS-09]
 gb|ENB31949.1| yqjK-like family protein [Escherichia coli BCE032_MS-12]
 gb|ENB86763.1| yqjK-like family protein [Escherichia coli P0299438.10]
 gb|ENC01761.1| yqjK-like family protein [Escherichia coli P0299438.4]
 gb|ENC29792.1| yqjK-like family protein [Escherichia coli P0299438.9]
 gb|END55201.1| yqjK-like family protein [Escherichia coli BCE006_MS-23]
 gb|END89972.1| yqjK-like family protein [Escherichia coli P0301904.3]
 gb|ENE05897.1| yqjK-like family protein [Escherichia coli P0305260.2]
 gb|ENF73770.1| yqjK-like family protein [Escherichia coli P0305260.10]
 gb|ENF81287.1| yqjK-like family protein [Escherichia coli P0305260.11]
 gb|ENF83696.1| yqjK-like family protein [Escherichia coli P0305260.12]
 gb|ENF88451.1| yqjK-like family protein [Escherichia coli P0305260.13]
 gb|ENF95441.1| yqjK-like family protein [Escherichia coli P0305260.15]
 gb|ENG00894.1| yqjK-like family protein [Escherichia coli P0305260.3]
 gb|ENG02394.1| yqjK-like family protein [Escherichia coli P0305260.4]
 gb|ENG10422.1| yqjK-like family protein [Escherichia coli P0305260.5]
 gb|ENG14663.1| yqjK-like family protein [Escherichia coli P0305260.6]
 gb|ENG15044.1| yqjK-like family protein [Escherichia coli P0305260.7]
 gb|ENG24272.1| yqjK-like family protein [Escherichia coli P0305260.8]
 gb|ENG32284.1| yqjK-like family protein [Escherichia coli P0305260.9]
 gb|EOU43908.1| hypothetical protein WC3_03848 [Escherichia coli KTE35]
 gb|EOU57475.1| hypothetical protein WCS_03595 [Escherichia coli KTE14]
 gb|EOU89204.1| hypothetical protein WEY_03854 [Escherichia coli KTE34]
 gb|EOV16283.1| hypothetical protein A157_04061 [Escherichia coli KTE198]
 gb|EOV17386.1| hypothetical protein A15A_04840 [Escherichia coli KTE200]
 gb|EOV32474.1| hypothetical protein A17C_03095 [Escherichia coli KTE219]
 gb|EOV48452.1| hypothetical protein A1SU_03448 [Escherichia coli KTE61]
 gb|EOV72958.1| hypothetical protein A1UE_03972 [Escherichia coli KTE71]
 gb|EOW11414.1| hypothetical protein A1WQ_04137 [Escherichia coli KTE103]
 gb|EOW42822.1| hypothetical protein A1YG_04032 [Escherichia coli KTE130]
 gb|EOW45170.1| hypothetical protein A1YI_04056 [Escherichia coli KTE132]
 gb|EOW57400.1| hypothetical protein A319_03456 [Escherichia coli KTE155]
 gb|EOW89274.1| hypothetical protein WAS_04111 [Escherichia coli KTE1]
 gb|EQN24222.1| hypothetical protein G686_03352 [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN44103.1| hypothetical protein G689_00168 [Escherichia coli HVH 10 (4-6832164)]
 gb|EQR31654.1| hypothetical protein G784_03490 [Escherichia coli HVH 122
            (4-6851606)]
 gb|EQR80940.1| hypothetical protein G792_00787 [Escherichia coli HVH 134
            (4-6073441)]
 gb|EQS85558.1| hypothetical protein G823_03452 [Escherichia coli HVH 167
            (4-6073565)]
 gb|EQS92311.1| hypothetical protein G822_00169 [Escherichia coli HVH 164
            (4-5953081)]
 gb|EQU72925.1| hypothetical protein G861_00855 [Escherichia coli HVH 209
            (4-3062651)]
 gb|EQX49691.1| hypothetical protein G929_03335 [Escherichia coli UMEA 3174-1]
 gb|EQX67091.1| hypothetical protein G933_03239 [Escherichia coli UMEA 3180-1]
 gb|EQX82300.1| hypothetical protein G937_03244 [Escherichia coli UMEA 3199-1]
 gb|EQY15961.1| hypothetical protein G943_03556 [Escherichia coli UMEA 3212-1]
 gb|EQY89036.1| hypothetical protein G964_00649 [Escherichia coli UMEA 3317-1]
 gb|EQY96558.1| hypothetical protein G967_03320 [Escherichia coli UMEA 3329-1]
 gb|EQY99402.1| hypothetical protein G965_03223 [Escherichia coli UMEA 3318-1]
 gb|EQZ33960.1| hypothetical protein G978_03475 [Escherichia coli UMEA 3592-1]
 gb|EQZ37553.1| hypothetical protein G979_03486 [Escherichia coli UMEA 3609-1]
 gb|ERA16275.1| hypothetical protein G998_03066 [Escherichia coli UMEA 3889-1]
 gb|ERA98968.1| hypothetical protein G878_03061 [Escherichia coli KOEGE 3 (4a)]
 gb|ERB21534.1| hypothetical protein G918_00661 [Escherichia coli UMEA 3150-1]
 gb|ERB25420.1| hypothetical protein G958_03514 [Escherichia coli UMEA 3271-1]
 gb|AGX35080.1| yqjK [synthetic Escherichia coli C321.deltaA]
 gb|ESA87908.1| hypothetical protein HMPREF1599_02960 [Escherichia coli 907713]
 gb|ESD49059.1| hypothetical protein HMPREF1605_04100 [Escherichia coli 908521]
 gb|ESD50284.1| hypothetical protein HMPREF1606_04524 [Escherichia coli 908522]
 gb|ESL20733.1| hypothetical protein L476_03200 [Escherichia coli BIDMC 39]
 gb|ESL34006.1| hypothetical protein L474_03181 [Escherichia coli BIDMC 37]
 gb|ESP43406.1| hypothetical protein G917_03302 [Escherichia coli UMEA 3148-1]
 emb|CDJ73755.1| hypothetical protein BN896_2810 [Escherichia coli str. K-12 substr.
            MC4100]
 gb|ESS98649.1| Inner membrane protein YqjK [Escherichia coli CE549]
 gb|EST63152.1| hypothetical protein ECCZ_09520 [Escherichia coli ECC-Z]
 gb|EST78295.1| hypothetical protein ECA727_14482 [Escherichia coli ECA-727]
 emb|CDK80735.1| Inner membrane protein YqjK [Escherichia coli IS25]
 gb|ETS28389.1| membrane protein [Escherichia coli O6:H16:CFA/II str. B2C]
 gb|EYD81711.1| yqjK-like family protein [Escherichia coli 1-176-05_S1_C1]
 gb|EYD82515.1| yqjK-like family protein [Escherichia coli 1-176-05_S3_C1]
 gb|EYD95770.1| yqjK-like family protein [Escherichia coli 1-110-08_S4_C3]
 gb|EYD97241.1| yqjK-like family protein [Escherichia coli 1-110-08_S4_C2]
 gb|EYE20747.1| yqjK-like family protein [Escherichia coli 1-110-08_S1_C3]
 gb|EYE33848.1| yqjK-like family protein [Escherichia coli 1-110-08_S1_C1]
 gb|EYV95406.1| membrane protein [Escherichia coli O6:H16 str. 99-3165]
 gb|EZA40076.1| membrane protein [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA71679.1| membrane protein [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA77569.1| membrane protein [Escherichia coli O25:NM str. E2539C1]
 gb|EZA78617.1| membrane protein [Escherichia coli O6:H16 str. F5656C1]
 gb|EZJ20870.1| yqjK-like family protein [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ67845.1| yqjK-like family protein [Escherichia coli 1-176-05_S4_C1]
 gb|EZK06413.1| yqjK-like family protein [Escherichia coli 1-176-05_S1_C3]
 gb|EZK16905.1| yqjK-like family protein [Escherichia coli 1-176-05_S1_C2]
 gb|KDA78253.1| yqjK-like family protein [Escherichia coli 2-011-08_S3_C2]
 gb|KDA83434.1| yqjK-like family protein [Escherichia coli 2-011-08_S3_C3]
 gb|KDA88551.1| yqjK-like family protein [Escherichia coli 1-176-05_S4_C2]
 emb|CDP73820.1| Putative uncharacterized protein yqjK [Escherichia coli]
 gb|KDG13365.1| hypothetical protein AE47_01938 [Escherichia coli BIDMC 72]
 gb|KDG16019.1| hypothetical protein AE48_01839 [Escherichia coli BIDMC 73]
 gb|KDP17783.1| membrane protein [Escherichia coli]
 gb|KDS97239.1| yqjK-like family protein [Escherichia coli 2-011-08_S3_C1]
 gb|KDS98298.1| yqjK-like family protein [Escherichia coli 2-011-08_S1_C3]
 gb|KDT17623.1| yqjK-like family protein [Escherichia coli 2-052-05_S3_C1]
 gb|KDT39016.1| yqjK-like family protein [Escherichia coli 3-105-05_S3_C1]
 gb|KDT49898.1| yqjK-like family protein [Escherichia coli 3-105-05_S3_C2]
 gb|KDT56336.1| yqjK-like family protein [Escherichia coli 3-105-05_S4_C3]
 gb|KDT68469.1| yqjK-like family protein [Escherichia coli 3-267-03_S3_C1]
 gb|KDT72057.1| yqjK-like family protein [Escherichia coli 3-373-03_S3_C1]
 gb|KDT75944.1| yqjK-like family protein [Escherichia coli 3-373-03_S3_C3]
 gb|KDT82350.1| yqjK-like family protein [Escherichia coli 3-373-03_S1_C2]
 gb|KDT84396.1| yqjK-like family protein [Escherichia coli 3-475-03_S4_C1]
 gb|KDT93334.1| yqjK-like family protein [Escherichia coli 3-105-05_S4_C1]
 gb|KDU13292.1| yqjK-like family protein [Escherichia coli 3-373-03_S3_C2]
 gb|KDU32612.1| yqjK-like family protein [Escherichia coli 3-373-03_S4_C2]
 gb|KDU33479.1| yqjK-like family protein [Escherichia coli 3-073-06_S4_C1]
 gb|KDU43117.1| yqjK-like family protein [Escherichia coli 3-373-03_S1_C3]
 gb|KDU48110.1| yqjK-like family protein [Escherichia coli 3-373-03_S1_C1]
 gb|KDU53981.1| yqjK-like family protein [Escherichia coli 3-373-03_S4_C1]
 gb|KDU63472.1| yqjK-like family protein [Escherichia coli 4-203-08_S1_C1]
 gb|KDU66429.1| yqjK-like family protein [Escherichia coli 4-203-08_S4_C3]
 gb|KDV81184.1| yqjK-like family protein [Escherichia coli 2-052-05_S3_C3]
 gb|KDV82978.1| yqjK-like family protein [Escherichia coli 2-052-05_S4_C3]
 gb|KDV83226.1| yqjK-like family protein [Escherichia coli 2-052-05_S4_C3]
 gb|KDW06179.1| yqjK-like family protein [Escherichia coli 2-156-04_S3_C3]
 gb|KDW53955.1| yqjK-like family protein [Escherichia coli 2-210-07_S1_C3]
 gb|KDW79306.1| yqjK-like family protein [Escherichia coli 2-005-03_S4_C1]
 gb|KDW91624.1| yqjK-like family protein [Escherichia coli 2-210-07_S1_C2]
 gb|KDX22043.1| yqjK-like family protein [Escherichia coli 2-210-07_S3_C3]
 gb|KDX46971.1| yqjK-like family protein [Escherichia coli 2-177-06_S3_C2]
 gb|KDX56553.1| yqjK-like family protein [Escherichia coli 2-210-07_S3_C1]
 gb|KDX87268.1| yqjK-like family protein [Escherichia coli 2-222-05_S3_C3]
 gb|KDX96967.1| yqjK-like family protein [Escherichia coli 2-316-03_S3_C1]
 gb|KDY24062.1| yqjK-like family protein [Escherichia coli 2-316-03_S4_C2]
 gb|KDY46952.1| yqjK-like family protein [Escherichia coli 2-427-07_S4_C1]
 gb|KDY52615.1| yqjK-like family protein [Escherichia coli 2-460-02_S3_C1]
 gb|KDY57251.1| yqjK-like family protein [Escherichia coli 2-460-02_S3_C3]
 gb|KDY60990.1| yqjK-like family protein [Escherichia coli 2-460-02_S3_C2]
 gb|KDY71760.1| yqjK-like family protein [Escherichia coli 2-460-02_S4_C2]
 gb|KDY78758.1| yqjK-like family protein [Escherichia coli 2-460-02_S4_C3]
 gb|KDY81509.1| yqjK-like family protein [Escherichia coli 2-474-04_S1_C1]
 gb|KDY88424.1| yqjK-like family protein [Escherichia coli 2-474-04_S3_C1]
 gb|KDY97974.1| yqjK-like family protein [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ04687.1| yqjK-like family protein [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ18808.1| yqjK-like family protein [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ38730.1| yqjK-like family protein [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ62373.1| yqjK-like family protein [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ66882.1| yqjK-like family protein [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ69983.1| yqjK-like family protein [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ81589.1| yqjK-like family protein [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ88441.1| yqjK-like family protein [Escherichia coli 3-105-05_S1_C2]
 gb|KEJ48250.1| yqjK-like family protein [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ66353.1| yqjK-like family protein [Escherichia coli 3-020-07_S3_C2]
 gb|KEK95175.1| yqjK-like family protein [Escherichia coli 4-203-08_S1_C2]
 gb|KEL01367.1| yqjK-like family protein [Escherichia coli 4-203-08_S1_C3]
 gb|KEL04022.1| yqjK-like family protein [Escherichia coli 4-203-08_S3_C3]
 gb|KEL13393.1| yqjK-like family protein [Escherichia coli 4-203-08_S4_C2]
 gb|KEL15566.1| yqjK-like family protein [Escherichia coli 4-203-08_S3_C2]
 gb|KEL19658.1| yqjK-like family protein [Escherichia coli 4-203-08_S3_C1]
 gb|KEL27670.1| yqjK-like family protein [Escherichia coli 5-172-05_S4_C2]
 gb|KEL28092.1| yqjK-like family protein [Escherichia coli 3-373-03_S4_C3]
 gb|KEL35059.1| yqjK-like family protein [Escherichia coli 5-366-08_S4_C2]
 gb|KEL39410.1| yqjK-like family protein [Escherichia coli 5-172-05_S4_C1]
 gb|KEL42432.1| yqjK-like family protein [Escherichia coli 5-172-05_S3_C3]
 gb|KEL56576.1| yqjK-like family protein [Escherichia coli 5-172-05_S3_C1]
 gb|KEL61947.1| yqjK-like family protein [Escherichia coli 5-172-05_S4_C3]
 gb|KEL63485.1| yqjK-like family protein [Escherichia coli 5-172-05_S1_C3]
 gb|KEM03651.1| yqjK-like family protein [Escherichia coli 6-175-07_S4_C2]
 gb|KEM04962.1| yqjK-like family protein [Escherichia coli 6-175-07_S4_C1]
 gb|KEM30751.1| yqjK-like family protein [Escherichia coli 6-319-05_S4_C2]
 gb|KEM46388.1| yqjK-like family protein [Escherichia coli 6-175-07_S4_C3]
 gb|KEM59146.1| yqjK-like family protein [Escherichia coli 6-319-05_S4_C3]
 gb|KEM61181.1| yqjK-like family protein [Escherichia coli 7-233-03_S1_C2]
 gb|KEM70982.1| yqjK-like family protein [Escherichia coli 7-233-03_S3_C1]
 gb|KEM89471.1| yqjK-like family protein [Escherichia coli 6-537-08_S4_C1]
 gb|KEM99198.1| yqjK-like family protein [Escherichia coli 7-233-03_S1_C3]
 gb|KEN01280.1| yqjK-like family protein [Escherichia coli 7-233-03_S3_C3]
 gb|KEN22528.1| yqjK-like family protein [Escherichia coli 7-233-03_S3_C2]
 gb|KEN23011.1| yqjK-like family protein [Escherichia coli 8-415-05_S1_C1]
 gb|KEN40676.1| yqjK-like family protein [Escherichia coli 7-233-03_S4_C1]
 gb|KEN53458.1| yqjK-like family protein [Escherichia coli 7-233-03_S4_C3]
 gb|KEN61649.1| yqjK-like family protein [Escherichia coli 6-537-08_S4_C2]
 gb|KEN75413.1| yqjK-like family protein [Escherichia coli 2-052-05_S3_C2]
 gb|KEN88197.1| yqjK-like family protein [Escherichia coli 2-222-05_S3_C1]
 gb|KEN95516.1| yqjK-like family protein [Escherichia coli 2-222-05_S3_C2]
 gb|KEO07464.1| yqjK-like family protein [Escherichia coli 8-415-05_S1_C2]
 gb|KEO07733.1| yqjK-like family protein [Escherichia coli 2-177-06_S3_C3]
 gb|AIF38405.1| membrane protein [Escherichia coli KLY]
 emb|CDU41011.1| Putative uncharacterized protein yqjK [Escherichia coli]
 gb|KFF38360.1| membrane protein [Escherichia coli]
 gb|KFF53211.1| membrane protein [Escherichia coli]
 gb|KFH99533.1| membrane protein [Escherichia coli]
 emb|CEE08890.1| putative uncharacterized protein yqjK [Escherichia coli]
 gb|AIN33450.1| uncharacterized protein BW25113_3100 [Escherichia coli BW25113]
 gb|KGA86511.1| membrane protein [Escherichia coli]
 emb|CDY61837.1| conserved protein [Escherichia coli]
 emb|CDZ21886.1| conserved protein [Escherichia coli]
 gb|KGL69918.1| hypothetical protein L670_11668 [Escherichia coli NCTC 50110]
 gb|KGM66849.1| putative protein YqjK [Escherichia coli]
 gb|KGM71975.1| putative protein YqjK [Escherichia coli]
 gb|KGM75865.1| putative protein YqjK [Escherichia coli]
 gb|KGM83596.1| putative protein YqjK [Escherichia coli]
 gb|KGP12457.1| membrane protein [Escherichia coli]
 gb|KGP14395.1| membrane protein [Escherichia coli]
 gb|KGP20756.1| membrane protein [Escherichia coli]
 gb|KGP38969.1| membrane protein [Escherichia coli]
 gb|KGT05321.1| membrane protein [Escherichia coli]
 gb|KGT12996.1| membrane protein [Escherichia coli]
 gb|KGT21169.1| membrane protein [Escherichia coli]
 gb|KGT22013.1| membrane protein [Escherichia coli]
 gb|KGT28037.1| membrane protein [Escherichia coli]
 gb|KGT32681.1| membrane protein [Escherichia coli]
 gb|KHD39527.1| membrane protein [Escherichia coli]
 gb|KHD51356.1| membrane protein [Escherichia coli]
 gb|KHD52118.1| membrane protein [Escherichia coli]
 gb|KHD55534.1| membrane protein [Escherichia coli]
 gb|KHH51953.1| membrane protein [Escherichia coli]
 gb|KHH60697.1| membrane protein [Escherichia coli]
 gb|KHH70293.1| membrane protein [Escherichia coli]
 gb|KHH89378.1| membrane protein [Escherichia coli]
 gb|KHH94724.1| membrane protein [Escherichia coli]
 gb|KHI18610.1| membrane protein [Escherichia coli]
 gb|KHI21684.1| membrane protein [Escherichia coli]
 gb|KHI58674.1| membrane protein [Escherichia coli]
 gb|AIZ29571.1| hypothetical protein ER2796_3193 [Escherichia coli ER2796]
 gb|AIZ52896.1| hypothetical protein ER3413_3193 [Escherichia coli K-12]
 gb|AIZ89880.1| membrane protein [Escherichia coli str. K-12 substr. MG1655]
 gb|AJB53140.1| membrane protein [Escherichia coli]
 gb|KIG40864.1| membrane protein [Escherichia coli]
 gb|KIG41779.1| membrane protein [Escherichia coli]
 gb|KIG73886.1| membrane protein [Escherichia coli]
 gb|KIG78803.1| membrane protein [Escherichia coli]
 gb|KIH00582.1| membrane protein [Escherichia coli]
 gb|KIH13810.1| membrane protein [Escherichia coli]
 gb|AJF57921.1| PHB family membrane protein [Escherichia coli 1303]
 gb|KIZ60147.1| membrane protein [Escherichia coli]
 gb|KIZ67191.1| membrane protein [Escherichia coli]
 gb|KIZ80499.1| membrane protein [Escherichia coli]
 gb|KIZ82925.1| membrane protein [Escherichia coli]
 gb|KIZ88782.1| membrane protein [Escherichia coli]
 gb|KIZ95431.1| membrane protein [Escherichia coli]
 gb|KIZ98806.1| membrane protein [Escherichia coli]
 gb|KJA03460.1| membrane protein [Escherichia coli]
 gb|KJA07899.1| membrane protein [Escherichia coli]
 gb|KJD93565.1| membrane protein [Escherichia coli]
 gb|KJJ67639.1| PHB family membrane protein [Escherichia coli]
 gb|AKA92286.1| uncharacterized protein YqjK [Escherichia coli VR50]
 emb|CQR82531.1| hypothetical protein b3100 [Escherichia coli K-12]
 gb|AKD62555.1| membrane protein [Escherichia coli K-12]
 gb|AKD66928.1| membrane protein [Escherichia coli K-12]
 gb|AKD71282.1| membrane protein [Escherichia coli K-12]
 gb|AKD75649.1| membrane protein [Escherichia coli K-12]
 gb|AKD80058.1| membrane protein [Escherichia coli K-12]
 gb|AKD84427.1| membrane protein [Escherichia coli K-12]
 gb|AKD88784.1| membrane protein [Escherichia coli K-12]
 gb|AKD93215.1| membrane protein [Escherichia coli K-12]
 gb|AKF22303.1| membrane protein [Escherichia coli]
 gb|AKF56880.1| uncharacterized protein SG48_3157 [Escherichia coli]
 gb|AKF61020.1| uncharacterized protein SG49_3147 [Escherichia coli]
 gb|AKF65158.1| uncharacterized protein SG46_3147 [Escherichia coli]
 gb|AKF69298.1| uncharacterized protein SG47_3147 [Escherichia coli]
 gb|AKF73437.1| uncharacterized protein CS35_3147 [Escherichia coli]
 gb|KLD52653.1| membrane protein [Escherichia coli]
 gb|KLH36842.1| membrane protein [Escherichia coli]
 gb|AKM36654.1| hypothetical protein PCN061_3188 [Escherichia coli PCN061]
 gb|KLW97402.1| hypothetical protein SK64_03878 [Escherichia coli]
 gb|KLX02922.1| hypothetical protein SK65_02487 [Escherichia coli]
 gb|KLX34436.1| hypothetical protein SK73_03171 [Escherichia coli]
 gb|KLX53510.1| hypothetical protein SK77_03141 [Escherichia coli]
 gb|KLX66875.1| hypothetical protein SK74_02798 [Escherichia coli]
 gb|KLX82336.1| hypothetical protein SK82_02046 [Escherichia coli]
 gb|AKO58572.1| membrane protein [Escherichia coli]
 gb|AKR21924.1| membrane protein [Escherichia coli]
 gb|AKR26279.1| membrane protein [Escherichia coli]
 gb|AKR30747.1| membrane protein [Escherichia coli]
 gb|KOA24287.1| membrane protein [Escherichia coli]
 gb|KOA30633.1| membrane protein [Escherichia coli]
 emb|CTX22435.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW79648.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR17572.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR14390.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU21542.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU35102.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR16118.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU52957.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR14546.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU43771.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU41791.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU39457.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT64630.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT65020.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR47797.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT98608.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR54817.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU53893.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT00812.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW05406.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU31091.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU64713.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR93752.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS00366.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV12208.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV02223.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV42494.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR95897.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU89045.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV36939.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV94069.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX83407.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY75257.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY68426.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ36579.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ00477.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY74046.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY22199.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ11282.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY83178.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ18179.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ29975.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA29336.1| cell division MukB-like protein [Escherichia coli]
 gb|ALB33141.1| membrane protein [Escherichia coli]
 emb|CUH57364.1| putative protein [Escherichia coli KRX]
 emb|CUJ87297.1| Uncharacterised protein [Achromobacter sp. ATCC35328]
 emb|CUQ98353.1| Inner membrane protein YqjK [Escherichia coli]
 emb|CTX42084.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX57649.1| cell division MukB-like protein [Escherichia coli]
 gb|ALI39201.1| hypothetical protein QQ24_06850 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|ALI43602.1| hypothetical protein QR62_06855 [Escherichia coli]
 gb|ALI47997.1| hypothetical protein QR63_06855 [Escherichia coli]
 gb|KPO81398.1| membrane protein [Escherichia coli]
 gb|KPQ48996.1| Uncharacterized protein YqjK [Escherichia coli TW10598]
 gb|ALJ95731.1| uncharacterized protein U068_c4009 [Escherichia coli K-12]
 gb|ALJ96308.1| uncharacterized protein U069_c3979 [Escherichia coli K-12]
 gb|KQI78257.1| hypothetical protein AM258_01580 [Escherichia coli]
 gb|KQJ18764.1| hypothetical protein AM266_02205 [Escherichia coli]
 gb|KRR53978.1| hypothetical protein EC2874_20975 [Escherichia coli VL2874]
 gb|KRR54637.1| hypothetical protein EC2732_07056 [Escherichia coli VL2732]
 gb|KRV71049.1| hypothetical protein AO733_03590 [Escherichia coli]
 gb|KRW00724.1| hypothetical protein AO743_02560 [Escherichia coli]
 gb|KRW01589.1| hypothetical protein AO737_02815 [Escherichia coli]
 gb|ALQ71295.1| hypothetical protein ATL78_00875 [Escherichia coli]
 gb|KUG85153.1| hypothetical protein ARC88_13135 [Escherichia coli]
 gb|KUG85344.1| hypothetical protein ARC90_12035 [Escherichia coli]
 gb|KUG97526.1| hypothetical protein ARC93_11685 [Escherichia coli]
 gb|KUS50181.1| hypothetical protein AWE72_20075 [Escherichia coli]
 gb|KUU17720.1| hypothetical protein AWF16_10325 [Escherichia coli]
 gb|AMC96006.1| hypothetical protein AW869_07120 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|AMH31720.1| hypothetical protein DHB4_15710 [Escherichia coli K-12]
 gb|AMH36441.1| hypothetical protein C3026_16925 [Escherichia coli K-12]
 gb|KXG62697.1| hypothetical protein LT29_02531 [Escherichia coli]
 gb|KXG99589.1| hypothetical protein HMPREF3040_02039 [Escherichia coli]
 gb|KXH91495.1| hypothetical protein AXE67_22605 [Escherichia coli]
 gb|KXH95137.1| hypothetical protein AXE66_18985 [Escherichia coli]
 emb|CUW22585.1| hypothetical protein JF733_2982 [Escherichia coli]
 gb|AML00393.1| hypothetical protein AWN69_10315 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|KXP21820.1| hypothetical protein AUQ36_13675 [Escherichia coli]
 gb|KXP22367.1| hypothetical protein AUP76_06405 [Escherichia coli]
 gb|KXP34621.1| hypothetical protein AUQ35_12365 [Escherichia coli]
 gb|KXP37813.1| hypothetical protein AUP79_04535 [Escherichia coli]
 gb|KXP41622.1| hypothetical protein AUP97_06470 [Escherichia coli]
 gb|KXP47897.1| hypothetical protein AUQ30_07345 [Escherichia coli]
 gb|KXP51615.1| hypothetical protein AUQ19_13385 [Escherichia coli]
 gb|KXP54017.1| hypothetical protein AUQ34_05470 [Escherichia coli]
 gb|KXP59600.1| hypothetical protein AUP86_07930 [Escherichia coli]
 gb|KXP61449.1| hypothetical protein AUP84_22550 [Escherichia coli]
 gb|KXP69698.1| hypothetical protein AUP82_09555 [Escherichia coli]
 gb|KXP78000.1| hypothetical protein AUP83_06790 [Escherichia coli]
 gb|KXP87585.1| hypothetical protein AUP78_01680 [Escherichia coli]
 gb|KXQ02409.1| hypothetical protein AUP90_03850 [Escherichia coli]
 gb|KXQ10183.1| hypothetical protein AUP98_08105 [Escherichia coli]
 gb|KXQ15027.1| hypothetical protein AUP96_01335 [Escherichia coli]
 gb|KXQ21469.1| hypothetical protein AUP94_20905 [Escherichia coli]
 gb|KXQ22940.1| hypothetical protein AUP95_01580 [Escherichia coli]
 gb|KXQ23264.1| hypothetical protein AUP92_03610 [Escherichia coli]
 gb|KXQ38259.1| hypothetical protein AUP88_01860 [Escherichia coli]
 gb|KXQ38619.1| hypothetical protein AUQ01_17545 [Escherichia coli]
 gb|KXQ47935.1| hypothetical protein AUP89_05015 [Escherichia coli]
 gb|KXQ51744.1| hypothetical protein AUP93_02770 [Escherichia coli]
 gb|KXQ56830.1| hypothetical protein AUQ04_05520 [Escherichia coli]
 gb|KXQ62537.1| hypothetical protein AUQ09_00940 [Escherichia coli]
 gb|KXQ67036.1| hypothetical protein AUQ00_09325 [Escherichia coli]
 gb|KXQ72339.1| hypothetical protein AUQ10_09105 [Escherichia coli]
 gb|KXQ79823.1| hypothetical protein AUQ18_14425 [Escherichia coli]
 gb|KXQ83491.1| hypothetical protein AUQ02_14685 [Escherichia coli]
 gb|KXQ94522.1| hypothetical protein AUQ17_18055 [Escherichia coli]
 gb|KXQ99568.1| hypothetical protein AUQ05_12725 [Escherichia coli]
 gb|KXR12229.1| hypothetical protein AUQ14_00760 [Escherichia coli]
 gb|KXR13033.1| hypothetical protein AUQ12_08325 [Escherichia coli]
 gb|KXR19362.1| hypothetical protein AUQ16_12610 [Escherichia coli]
 gb|KXR24383.1| hypothetical protein AUQ21_07070 [Escherichia coli]
 gb|KXR25903.1| hypothetical protein AUQ20_20035 [Escherichia coli]
 gb|KXR33308.1| hypothetical protein AUQ22_12740 [Escherichia coli]
 gb|KXR44178.1| hypothetical protein AUQ27_05810 [Escherichia coli]
 gb|KXR49803.1| hypothetical protein AUQ31_01195 [Escherichia coli]
 gb|KXR63793.1| hypothetical protein AUQ28_06800 [Escherichia coli]
 gb|KXR67343.1| hypothetical protein AUQ11_00150 [Escherichia coli]
 gb|KXR71215.1| hypothetical protein AUQ23_17625 [Escherichia coli]
 gb|KXR74793.1| hypothetical protein AUQ33_02350 [Escherichia coli]
 gb|KXR81525.1| hypothetical protein AUQ25_11320 [Escherichia coli]
 gb|KXR83555.1| hypothetical protein AUQ29_13325 [Escherichia coli]
 gb|KXR93958.1| hypothetical protein AUQ13_02620 [Escherichia coli]
 gb|KXR99970.1| hypothetical protein AUP91_02875 [Escherichia coli]
 gb|KXS01538.1| hypothetical protein AUP81_05675 [Escherichia coli]
 gb|KXU67106.1| hypothetical protein AWN71_12945 [Escherichia coli]
 gb|KXU69591.1| hypothetical protein AWN70_11175 [Escherichia coli]
 gb|KXU77621.1| hypothetical protein AWN72_21365 [Escherichia coli]
 gb|KYN53097.1| hypothetical protein AZ625_22925 [Escherichia coli]
 gb|KYN53219.1| hypothetical protein AZ620_22800 [Escherichia coli]
 gb|KYO69695.1| hypothetical protein LT27_01931 [Escherichia coli]
 gb|KYT17022.1| hypothetical protein AML44_05625 [Escherichia coli]
 gb|KYU37470.1| hypothetical protein AML62_03965 [Escherichia coli]
 gb|KYU91644.1| hypothetical protein AML77_10925 [Escherichia coli]
 gb|KYV09660.1| hypothetical protein AML81_09920 [Escherichia coli]
 gb|KYV46701.1| hypothetical protein AMK79_15335 [Escherichia coli]
 gb|KYW24765.1| hypothetical protein AMK92_13795 [Escherichia coli]
 gb|AMU83686.1| membrane protein [Escherichia coli str. Sanji]
 gb|KZI26354.1| hypothetical protein AWG62_02760 [Escherichia coli]
 gb|KZI51055.1| hypothetical protein AWG68_13925 [Escherichia coli]
 gb|KZI57189.1| hypothetical protein AWG71_14195 [Escherichia coli]
 gb|KZI84724.1| hypothetical protein AWG76_20955 [Escherichia coli]
 gb|OAC03525.1| PHB family membrane protein [Escherichia coli]
 gb|OAC10771.1| PHB family membrane protein [Escherichia coli]
 gb|OAC19516.1| PHB family membrane protein [Escherichia coli]
 gb|OAC34063.1| PHB family membrane protein [Escherichia coli]
 gb|OAC42894.1| PHB family membrane protein [Escherichia coli]
 gb|OAE71714.1| hypothetical protein A7J65_20575 [Escherichia coli]
 gb|OAF35566.1| hypothetical protein AXK32_06440 [Escherichia coli]
 gb|OAF92495.1| hypothetical protein PPECC9_30220 [Escherichia coli PCN009]
 gb|ANK07856.1| hypothetical protein A9X67_03165 [Escherichia coli]
 gb|ANO28281.1| hypothetical protein BAY41_05065 [Escherichia coli]
 emb|SCA72964.1| hypothetical protein NCTC86EC_03593 [Escherichia coli]
 gb|OCK71300.1| hypothetical protein BBZ58_16565 [Escherichia coli]
 gb|OCO58120.1| hypothetical protein AN669_0211030 [Escherichia coli]
 gb|OCW52749.1| hypothetical protein BEI66_06700 [Escherichia coli]
 gb|OCW81075.1| hypothetical protein A8R19_16755 [Escherichia coli]
 gb|ODH31713.1| hypothetical protein A6803_05595 [Escherichia coli]
 gb|AOO71322.1| hypothetical protein NEB5A_15860 [Escherichia coli]
 gb|AOR21329.1| hypothetical protein BBP24_19745 [Escherichia coli]
 gb|OEI00761.1| hypothetical protein A9R47_22135 [Escherichia coli]
 gb|OEI04038.1| hypothetical protein A9R45_20445 [Escherichia coli]
 gb|OEI12877.1| hypothetical protein A9R46_05750 [Escherichia coli]
 gb|OEI18770.1| hypothetical protein A9R48_16110 [Escherichia coli]
 gb|OEI22111.1| hypothetical protein A9R49_03160 [Escherichia coli]
 gb|OEI35254.1| hypothetical protein A9R44_17290 [Escherichia coli]
 gb|OEI45613.1| hypothetical protein A9R50_04125 [Escherichia coli]
 gb|OEI50041.1| hypothetical protein A9R56_21640 [Escherichia coli]
 gb|OEI51303.1| hypothetical protein A9R51_15415 [Escherichia coli]
 gb|OEI60830.1| hypothetical protein A9R57_17765 [Escherichia coli]
 gb|OEL40894.1| hypothetical protein BHF05_15480 [Escherichia coli]
 gb|OEL46097.1| hypothetical protein BHF06_12975 [Escherichia coli]
 gb|OEL60457.1| hypothetical protein BHF08_05180 [Escherichia coli]
 gb|OEL67857.1| hypothetical protein BHF11_16010 [Escherichia coli]
 gb|OEM39881.1| hypothetical protein BHF25_12930 [Escherichia coli]
 gb|OEM66133.1| hypothetical protein BHF31_12875 [Escherichia coli]
 gb|OEM90538.1| hypothetical protein BHF36_11905 [Escherichia coli]
 gb|OEN05239.1| hypothetical protein BHF38_03765 [Escherichia coli]
 gb|OEN14873.1| hypothetical protein BHF41_10260 [Escherichia coli]
 gb|OEN45682.1| hypothetical protein BHF44_01320 [Escherichia coli]
 gb|OEN49807.1| hypothetical protein BHF48_05760 [Escherichia coli]
 gb|OEN72421.1| hypothetical protein BHF54_18410 [Escherichia coli]
 gb|OEN79513.1| hypothetical protein BHF53_09050 [Escherichia coli]
 gb|OEN88259.1| hypothetical protein BHF55_01185 [Escherichia coli]
 gb|OEN89069.1| hypothetical protein BHF56_00150 [Escherichia coli]
 gb|AOT31179.1| Inner membrane protein YqjK [Escherichia coli]
 gb|APA24839.1| hypothetical protein ATO45_05260 [Escherichia coli]
 emb|SCQ10259.1| hypothetical protein ECK802_1917 [Escherichia coli]
 gb|APC53269.1| hypothetical protein BL257_15600 [Escherichia coli str. K-12 substr.
            W3110]
 gb|OIZ70840.1| hypothetical protein BJI68_02510 [Escherichia coli]
 gb|APG35044.1| hypothetical protein BLJ80_09865 [Escherichia coli]
 gb|OJL29236.1| hypothetical protein BK257_03230 [Escherichia coli]
 gb|OJL72872.1| hypothetical protein BK268_22165 [Escherichia coli]
 gb|OJL98477.1| hypothetical protein BK271_10435 [Escherichia coli]
 gb|OJM36320.1| hypothetical protein BK278_09300 [Escherichia coli]
 gb|OJM67427.1| hypothetical protein BK284_02590 [Escherichia coli]
 gb|OJM74306.1| hypothetical protein BK287_16575 [Escherichia coli]
 gb|OJN04358.1| hypothetical protein BK293_03825 [Escherichia coli]
 gb|OJN60212.1| hypothetical protein BK303_02050 [Escherichia coli]
 gb|OJO22262.1| hypothetical protein BK316_17625 [Escherichia coli]
 gb|OJO23366.1| hypothetical protein BK315_04755 [Escherichia coli]
 gb|OJO41157.1| hypothetical protein BK319_07905 [Escherichia coli]
 gb|OJO54854.1| hypothetical protein BK322_09000 [Escherichia coli]
 gb|OJO57043.1| hypothetical protein BK323_19880 [Escherichia coli]
 gb|OJO69518.1| hypothetical protein BK324_03720 [Escherichia coli]
 gb|OJO70509.1| hypothetical protein BK325_09995 [Escherichia coli]
 gb|OJO82763.1| hypothetical protein BK330_23425 [Escherichia coli]
 gb|OJO93491.1| hypothetical protein BK328_02480 [Escherichia coli]
 gb|OJO94813.1| hypothetical protein BK329_04160 [Escherichia coli]
 gb|OJO98188.1| hypothetical protein BK331_13190 [Escherichia coli]
 gb|OJP01363.1| hypothetical protein BK332_25035 [Escherichia coli]
 gb|OJP04181.1| hypothetical protein BK333_14330 [Escherichia coli]
 gb|OJP28844.1| hypothetical protein BK337_12715 [Escherichia coli]
 gb|OJP51405.1| hypothetical protein BK342_00970 [Escherichia coli]
 gb|OJP55166.1| hypothetical protein BK341_01470 [Escherichia coli]
 gb|OJP59591.1| hypothetical protein BK344_20860 [Escherichia coli]
 gb|OJP61776.1| hypothetical protein BK343_00575 [Escherichia coli]
 gb|OJP64085.1| hypothetical protein BK345_20860 [Escherichia coli]
 gb|OJP74030.1| hypothetical protein BK346_04165 [Escherichia coli]
 gb|OJP77989.1| hypothetical protein BK348_22265 [Escherichia coli]
 gb|OJQ00272.1| hypothetical protein BK352_05310 [Escherichia coli]
 gb|OJQ02911.1| hypothetical protein BK354_21835 [Escherichia coli]
 gb|OJQ15987.1| hypothetical protein BK356_22105 [Escherichia coli]
 gb|OJQ45097.1| hypothetical protein BK363_18775 [Escherichia coli]
 gb|OJQ63138.1| hypothetical protein BK364_13445 [Escherichia coli]
 gb|OJQ89449.1| hypothetical protein BK370_11150 [Escherichia coli]
 gb|OJQ94229.1| hypothetical protein BK372_21210 [Escherichia coli]
 gb|OJQ94418.1| hypothetical protein BK371_11245 [Escherichia coli]
 gb|OJR22991.1| hypothetical protein BK376_11285 [Escherichia coli]
 gb|OJR80377.1| hypothetical protein BK389_14590 [Escherichia coli]
 gb|OJR83815.1| hypothetical protein BK390_22230 [Escherichia coli]
 gb|OJR97409.1| hypothetical protein BK392_08435 [Escherichia coli]
 gb|OJS30051.1| hypothetical protein BK397_07025 [Escherichia coli]
 gb|OJS58924.1| hypothetical protein BK404_14860 [Escherichia coli]
 gb|OJS72183.1| hypothetical protein BK406_14410 [Escherichia coli]
 gb|APJ85696.1| membrane protein [Escherichia coli]
 gb|APK17055.1| membrane protein [Escherichia coli]
 gb|APK40627.1| membrane protein [Escherichia coli]
 gb|APK52075.1| membrane protein [Escherichia coli]
 gb|APK72344.1| membrane protein [Escherichia coli]
 gb|APL61350.1| membrane protein [Escherichia coli]
 gb|OKS94491.1| hypothetical protein ACN54_23960 [Escherichia coli]
 gb|OKS99520.1| hypothetical protein ACN58_13890 [Escherichia coli]
 gb|OKT05552.1| hypothetical protein ACN55_17890 [Escherichia coli]
 gb|OKT14750.1| hypothetical protein ACN59_18995 [Escherichia coli]
 gb|OKT19873.1| hypothetical protein ACN57_23795 [Escherichia coli]
 gb|OKT27940.1| hypothetical protein ACN66_18975 [Escherichia coli]
 gb|OKT41340.1| hypothetical protein ACN60_21820 [Escherichia coli]
 gb|OKT45721.1| hypothetical protein ACN63_04855 [Escherichia coli]
 gb|OKT54010.1| hypothetical protein ACN64_13900 [Escherichia coli]
 gb|OKT89444.1| hypothetical protein ACN75_14095 [Escherichia coli]
 gb|OKU02433.1| hypothetical protein ACN80_15510 [Escherichia coli]
 gb|OKU08468.1| hypothetical protein ACN74_08525 [Escherichia coli]
 gb|OKU63254.1| hypothetical protein ACN88_16250 [Escherichia coli]
 gb|OKU74382.1| hypothetical protein AWJ24_23045 [Escherichia coli]
 gb|OKV08699.1| hypothetical protein AWP52_18820 [Escherichia coli]
 gb|OKV48764.1| hypothetical protein AWP58_12990 [Escherichia coli]
 gb|OKV60943.1| hypothetical protein AWP57_27805 [Escherichia coli]
 gb|OKV76880.1| hypothetical protein AWP64_26685 [Escherichia coli]
 gb|OKV99136.1| hypothetical protein AWP68_19230 [Escherichia coli]
 gb|OKV99489.1| hypothetical protein AWP65_13805 [Escherichia coli]
 gb|OKX14454.1| hypothetical protein AWP86_18915 [Escherichia coli]
 gb|OKX16432.1| hypothetical protein AWP93_07295 [Escherichia coli]
 gb|OKX37946.1| hypothetical protein AWP91_13410 [Escherichia coli]
 gb|OKX58257.1| hypothetical protein AWP94_16900 [Escherichia coli]
 gb|APQ20025.1| hypothetical protein BTD92_00627 [Escherichia coli]
 gb|APT01102.1| hypothetical protein BJJ90_03225 [Escherichia coli]
 gb|OLO98097.1| hypothetical protein BHG39_18840 [Escherichia coli]
 gb|OLR86937.1| hypothetical protein BUE81_13385 [Escherichia coli]
 gb|OMG95347.1| hypothetical protein A8M31_19000 [Escherichia coli]
 gb|OMH02984.1| hypothetical protein BWX35_16895 [Escherichia coli]
 gb|OMH04622.1| hypothetical protein BW691_07265 [Escherichia coli]
 gb|APW92248.1| hypothetical protein BVJ48_06075 [Escherichia coli]
 gb|ONG31327.1| hypothetical protein BW690_04245 [Escherichia coli]
 emb|SJK90016.1| conserved hypothetical protein [Escherichia coli]
 gb|ONN29178.1| hypothetical protein AYC64_19700 [Escherichia coli]
 gb|AQP93008.1| hypothetical protein BWL12_17245 [Escherichia coli]
 gb|OOI15067.1| hypothetical protein BMT57_09745 [Escherichia coli]
 gb|OOI70593.1| hypothetical protein BMT66_10815 [Escherichia coli]
 gb|OOI89727.1| hypothetical protein BMT56_14750 [Escherichia coli]
 gb|OOJ03022.1| hypothetical protein BMT74_08975 [Escherichia coli]
 gb|OOJ07793.1| hypothetical protein BMT73_18105 [Escherichia coli]
 gb|OOJ61579.1| hypothetical protein BMT70_02345 [Escherichia coli]
 gb|OOJ67701.1| hypothetical protein BMT71_10285 [Escherichia coli]
 gb|OOJ72011.1| hypothetical protein BMT68_16480 [Escherichia coli]
 gb|OOJ80577.1| hypothetical protein BMT58_12405 [Escherichia coli]
 gb|OOK13263.1| hypothetical protein BMT69_13960 [Escherichia coli]
 gb|OOK34164.1| hypothetical protein BMT67_09350 [Escherichia coli]
 gb|OOM87053.1| hypothetical protein BWR05_03205 [Escherichia coli]
 gb|OON79086.1| hypothetical protein B1R43_05430 [Escherichia coli]
 gb|AQU00870.1| hypothetical protein B0915_18825 [Escherichia coli]
 gb|AQV34501.1| hypothetical protein BE933_05580 [Escherichia coli]
 gb|AQV92036.1| hypothetical protein BE948_27100 [Escherichia coli]
 gb|OOV69371.1| hypothetical protein B1739_14475 [Escherichia coli]
 gb|AQZ29043.1| hypothetical protein USML2_07955 [Escherichia coli]
 gb|ARE46191.1| hypothetical protein B6N50_03420 [Escherichia coli C]
 gb|ORD38230.1| hypothetical protein A4T41_18205 [Escherichia coli]
 gb|ORD88122.1| hypothetical protein A4T33_05965 [Escherichia coli]
 gb|ORE80261.1| hypothetical protein B6D27_01515 [Escherichia coli]
 gb|ORE82750.1| hypothetical protein B6D24_02825 [Escherichia coli]
 gb|ORS60285.1| hypothetical protein BHS95_17255 [Escherichia coli]
 gb|ORS73663.1| hypothetical protein BHS91_17295 [Escherichia coli]
 gb|ORS82500.1| hypothetical protein BHS90_17290 [Escherichia coli]
 gb|ORS89091.1| hypothetical protein BHS88_17270 [Escherichia coli]
 gb|ORS99643.1| hypothetical protein BHS85_17395 [Escherichia coli]
 gb|ORT00677.1| hypothetical protein BHS87_17540 [Escherichia coli]
 gb|ORT04343.1| hypothetical protein BHS84_17025 [Escherichia coli]
 gb|ORT18126.1| hypothetical protein BIQ83_17155 [Escherichia coli]
 gb|ORT32245.1| hypothetical protein BIQ80_17025 [Escherichia coli]
 gb|ORT38045.1| hypothetical protein BHT55_17060 [Escherichia coli]
 emb|SMH31614.1| YqjK-like protein [Escherichia coli]
 gb|OSK23467.1| putative inner membrane protein [Escherichia coli TA144]
 gb|OSK60739.1| putative inner membrane protein [Escherichia coli E560]
 gb|OSK96939.1| putative inner membrane protein [Escherichia coli E1002]
 gb|OSL04048.1| putative inner membrane protein [Escherichia coli H386]
 gb|OSL17867.1| putative inner membrane protein [Escherichia coli B175]
 gb|OSL22597.1| putative inner membrane protein [Escherichia coli H617]
 gb|OSL53111.1| putative inner membrane protein [Escherichia coli H383]
 gb|OSL53840.1| putative inner membrane protein [Escherichia coli H454]
 gb|OSL99984.1| putative inner membrane protein [Escherichia coli R424]
 gb|OSP31280.1| hypothetical protein B9P94_11905 [Escherichia coli]
 gb|ARM41491.1| hypothetical protein AWH44_13170 [Escherichia coli]
 gb|OSQ36038.1| hypothetical protein B8A36_06810 [Escherichia coli]
 gb|OTA10345.1| hypothetical protein BCR79_04465 [Escherichia coli]
 gb|OTB62259.1| hypothetical protein AW061_02015 [Escherichia coli]
 gb|OTC56390.1| hypothetical protein AW080_02240 [Escherichia coli]
 gb|OTD97482.1| hypothetical protein AW108_04750 [Escherichia coli]
 gb|OTE35444.1| hypothetical protein AW116_00215 [Escherichia coli]
 gb|OTE81684.1| hypothetical protein AW123_04860 [Escherichia coli]
 gb|OUF93670.1| hypothetical protein AZ030_003214 [Escherichia coli]
 gb|OUJ89213.1| hypothetical protein BW735_16085 [Escherichia coli]
 gb|OUK51133.1| hypothetical protein BZL33_15365 [Escherichia coli]
 gb|OUP42799.1| hypothetical protein B5F26_06310 [Escherichia coli]
 gb|ARW89451.1| hypothetical protein AM396_22580 [Escherichia coli]
 gb|ARX12694.1| hypothetical protein AM408_02705 [Escherichia coli]
 gb|ARX28928.1| hypothetical protein AM398_06005 [Escherichia coli]
 gb|OVJ49142.1| hypothetical protein B8042_16680 [Escherichia coli]
 gb|OVY45865.1| hypothetical protein B4P02_13070 [Escherichia coli]
 gb|OWC66890.1| hypothetical protein A8F89_08330 [Escherichia coli]
 gb|OWC91337.1| hypothetical protein A8F83_05565 [Escherichia coli]
 gb|OWC92540.1| hypothetical protein A8F86_02975 [Escherichia coli]
 gb|OWC93239.1| hypothetical protein A8F84_05265 [Escherichia coli]
 gb|OWC98023.1| hypothetical protein A8F82_12050 [Escherichia coli]
 gb|OWD12722.1| hypothetical protein A8C72_14460 [Escherichia coli]
 gb|OWD22490.1| hypothetical protein A8C63_16615 [Escherichia coli]
 gb|OWD23664.1| hypothetical protein A8C78_20335 [Escherichia coli]
 gb|OWD24616.1| hypothetical protein A8C76_08190 [Escherichia coli]
 gb|OWD31863.1| hypothetical protein A8C67_16635 [Escherichia coli]
 gb|OWD44658.1| hypothetical protein A8C66_15445 [Escherichia coli]
 gb|OWD46568.1| hypothetical protein A8C64_09105 [Escherichia coli]
 gb|OWD50889.1| hypothetical protein A8C60_11010 [Escherichia coli]
 gb|OWD55832.1| hypothetical protein A8C62_05540 [Escherichia coli]
 gb|OWD57607.1| hypothetical protein A8C69_01295 [Escherichia coli]
 gb|OWD62472.1| hypothetical protein A8C70_14550 [Escherichia coli]
 gb|OWD71004.1| hypothetical protein A8C71_10375 [Escherichia coli]
 gb|OWD83946.1| hypothetical protein A8C68_04715 [Escherichia coli]
 gb|OWE18061.1| hypothetical protein A8M41_07480 [Escherichia coli]
 gb|ARZ87421.1| hypothetical protein AM397_05930 [Escherichia coli]
 gb|OWH04659.1| hypothetical protein CCE12_10975 [Escherichia coli]
 gb|OWH14577.1| hypothetical protein CCE10_10885 [Escherichia coli]
 gb|OWR16147.1| hypothetical protein CD912_12300 [Shigella boydii]
 gb|OWX90155.1| hypothetical protein BHS80_17180 [Escherichia coli]
 gb|OXK94249.1| hypothetical protein CD805_11785 [Escherichia coli]
 gb|ASO02173.1| hypothetical protein DS1UA2014_17525 [Escherichia coli]
 gb|OXZ55200.1| hypothetical protein RW71_03037 [Escherichia coli]
 gb|OXZ74902.1| hypothetical protein RW74_00830 [Escherichia coli]
 gb|OXZ77685.1| hypothetical protein RW76_00834 [Escherichia coli]
 gb|OXZ86346.1| hypothetical protein RW72_03097 [Escherichia coli]
 gb|OXZ91290.1| hypothetical protein RW77_00824 [Escherichia coli]
 gb|OYA00899.1| hypothetical protein RW75_03135 [Escherichia coli]
 gb|OYA16831.1| hypothetical protein RW78_02079 [Escherichia coli]
 gb|OYC65909.1| hypothetical protein RX31_02108 [Escherichia coli]
 gb|OYE16108.1| hypothetical protein CI676_14665 [Shigella sonnei]
 gb|OYE21721.1| hypothetical protein CI675_10390 [Shigella sonnei]
 gb|OYE64852.1| hypothetical protein CI674_00140 [Shigella sonnei]
 gb|OYG71837.1| hypothetical protein CI732_21345 [Shigella boydii]
 gb|OYG83296.1| hypothetical protein CI729_25135 [Shigella sonnei]
 gb|OYG98440.1| hypothetical protein CI727_04560 [Shigella sonnei]
 gb|OYI03244.1| hypothetical protein CI726_12065 [Shigella sonnei]
 gb|OYI06421.1| hypothetical protein CI701_01175 [Shigella sonnei]
 gb|OYI46797.1| hypothetical protein CI694_21300 [Shigella boydii]
 gb|OYI66331.1| hypothetical protein CI692_13710 [Shigella sonnei]
 gb|OYI77384.1| hypothetical protein CI686_25035 [Shigella sonnei]
 gb|OYI80819.1| hypothetical protein CI689_12820 [Shigella boydii]
 gb|OYI86726.1| hypothetical protein CI690_04450 [Shigella sonnei]
 gb|OYJ03753.1| hypothetical protein CI687_13375 [Shigella boydii]
 gb|OYJ17250.1| hypothetical protein CI738_24255 [Shigella sonnei]
 gb|OYJ47395.1| hypothetical protein CI673_09335 [Shigella sonnei]
 gb|OYJ52644.1| hypothetical protein CI669_17295 [Shigella sonnei]
 gb|OYJ65680.1| hypothetical protein CI668_25550 [Shigella sonnei]
 gb|OYK64640.1| hypothetical protein CI721_00525 [Shigella sonnei]
 gb|OYK74397.1| hypothetical protein CI717_09335 [Escherichia coli]
 gb|OYL62913.1| hypothetical protein CI765_11915 [Shigella sonnei]
 gb|OYN28432.1| hypothetical protein CI772_11345 [Shigella boydii]
 emb|SNW08955.1| cell division MukB-like protein [Escherichia coli]
 gb|OZM95739.1| hypothetical protein CF016_19155 [Escherichia coli]
 gb|OZP32843.1| hypothetical protein CG694_10960 [Escherichia coli]
 gb|OZR92261.1| hypothetical protein CIG50_14895 [Escherichia coli]
 gb|OZS02126.1| hypothetical protein CIG24_15035 [Escherichia coli]
 gb|OZS07387.1| hypothetical protein CIG45_14275 [Escherichia coli]
 gb|OZS12570.1| hypothetical protein CIG47_13375 [Escherichia coli]
 gb|PAB80274.1| hypothetical protein CDH54_24165 [Escherichia coli]
 gb|PAB85937.1| hypothetical protein CDH59_10230 [Escherichia coli]
 gb|PAB91244.1| hypothetical protein CDH56_15465 [Escherichia coli]
 gb|PAB96096.1| hypothetical protein CDH60_20350 [Escherichia coli]
 gb|PAC02680.1| hypothetical protein CDH57_08350 [Escherichia coli]
 gb|PAQ21292.1| hypothetical protein B7979_03570 [Escherichia coli]
 gb|PAQ26908.1| hypothetical protein B7958_11320 [Escherichia coli]
 gb|PAQ28625.1| hypothetical protein B7952_05990 [Escherichia coli]
 gb|PAQ35242.1| hypothetical protein B7956_09235 [Escherichia coli]
 gb|PAQ35827.1| hypothetical protein B7950_14970 [Escherichia coli]
 gb|PAQ43546.1| hypothetical protein B7973_12875 [Escherichia coli]
 gb|PAQ47850.1| hypothetical protein B7962_08385 [Escherichia coli]
 gb|PAQ50744.1| hypothetical protein B7968_16030 [Escherichia coli]
 gb|PAQ56681.1| hypothetical protein B7961_10145 [Escherichia coli]
 gb|PAQ77973.1| hypothetical protein BIU77_02565 [Escherichia coli]
 gb|PAQ88525.1| hypothetical protein BIU75_03045 [Escherichia coli]
 gb|PAQ92392.1| hypothetical protein BIU74_12720 [Escherichia coli]
 gb|PAS85576.1| hypothetical protein CDN89_17965 [Escherichia coli]
 gb|ASZ47573.1| hypothetical protein CLD29_16555 [Escherichia coli]
 gb|PAY97768.1| hypothetical protein CEG99_10065 [Shigella boydii]
 gb|ATB96571.1| hypothetical protein CNQ51_03450 [Escherichia coli]
 gb|ATC01276.1| hypothetical protein CNQ50_03610 [Escherichia coli]
 gb|ATC09245.1| hypothetical protein CNQ49_20870 [Escherichia coli]
 gb|PBO11355.1| hypothetical protein CI709_11965 [Shigella sonnei]
 gb|PBO99209.1| hypothetical protein CI711_00895 [Shigella boydii]
 gb|PBQ54288.1| hypothetical protein COD52_03845 [Escherichia coli]
 gb|PBQ73660.1| hypothetical protein COD43_08910 [Escherichia coli]
 gb|PBR15489.1| hypothetical protein COD28_18235 [Escherichia coli]
 gb|PBS99990.1| hypothetical protein A9821_17035 [Escherichia coli]
 gb|PBT04484.1| hypothetical protein A9818_17925 [Escherichia coli]
 gb|PBT11336.1| hypothetical protein A9816_07880 [Escherichia coli]
 gb|PBT16026.1| hypothetical protein A9812_08645 [Escherichia coli]
 gb|PBT21711.1| hypothetical protein A9810_07390 [Escherichia coli]
 gb|PBT26118.1| hypothetical protein A9811_06255 [Escherichia coli]
 gb|PBT32869.1| hypothetical protein A9814_21940 [Escherichia coli]
 gb|PBT41561.1| hypothetical protein BBJ10_16690 [Escherichia coli]
 gb|PBT49135.1| hypothetical protein BBJ11_12360 [Escherichia coli]
 gb|PBT54015.1| hypothetical protein BBJ12_13610 [Escherichia coli]
 gb|PBT61966.1| hypothetical protein BBJ14_17930 [Escherichia coli]
 gb|PBT66905.1| hypothetical protein BBJ15_16090 [Escherichia coli]
 gb|PBT71636.1| hypothetical protein BBJ16_15510 [Escherichia coli]
 gb|PBT77243.1| hypothetical protein BBJ17_10260 [Escherichia coli]
 gb|PBT82094.1| hypothetical protein BBJ18_09080 [Escherichia coli]
 gb|PBT87299.1| hypothetical protein BBJ19_06010 [Escherichia coli]
 gb|PBT90013.1| hypothetical protein BBJ20_16360 [Escherichia coli]
 gb|PBT97373.1| hypothetical protein BB538_03940 [Escherichia coli]
 gb|PBU32582.1| hypothetical protein BB544_16720 [Escherichia coli]
 gb|PCD74490.1| hypothetical protein CNN69_05385 [Escherichia coli]
 gb|PCO97631.1| hypothetical protein CP996_14970 [Escherichia coli]
 gb|PCS50960.1| hypothetical protein BMR41_15270 [Escherichia coli]
 gb|PCS97580.1| hypothetical protein BMR60_07135 [Escherichia coli]
 gb|PCT18530.1| hypothetical protein BMR56_06630 [Escherichia coli]
 gb|PCT33580.1| hypothetical protein BMR63_06175 [Escherichia coli]
 gb|PDN94915.1| hypothetical protein CJU66_17780 [Escherichia coli]
 gb|PDO05982.1| hypothetical protein CJU65_16770 [Escherichia coli]
 gb|PDS13510.1| hypothetical protein CMR86_17555 [Escherichia coli]
 gb|PGF70243.1| hypothetical protein BMR20_14650 [Escherichia coli]
 gb|PGG64131.1| hypothetical protein BMR15_15440 [Escherichia coli]
 gb|ATM09953.1| hypothetical protein CRN02_07815 [Escherichia coli]
 gb|PHK61332.1| hypothetical protein CQR96_15685 [Escherichia coli]
 gb|PHL42473.1| hypothetical protein BMR42_01190 [Escherichia coli]
 gb|PHL58831.1| hypothetical protein BMR58_16865 [Escherichia coli]
 gb|PHL71951.1| hypothetical protein BMR61_16720 [Escherichia coli]
 gb|PIM56248.1| hypothetical protein CTI76_21205 [Escherichia coli]
 gb|ATU33601.1| hypothetical protein CSR56_03425 [Escherichia coli]
 gb|ATW96282.1| hypothetical protein CU080_06815 [Escherichia coli]
 gb|ATX17694.1| hypothetical protein CU076_01395 [Escherichia coli]
 gb|ATX47942.1| hypothetical protein AM338_14305 [Escherichia coli]
 gb|ATX53271.1| hypothetical protein AM341_16760 [Escherichia coli]
 gb|PJN77196.1| hypothetical protein LCTEC_017555 [Escherichia coli]
 gb|PJW36113.1| hypothetical protein CWM42_12000 [Escherichia coli]
 gb|PJW76907.1| hypothetical protein CWD58_02550 [Escherichia coli]
 gb|AUG17817.1| hypothetical protein CXP41_16945 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|PKZ79253.1| hypothetical protein CYJ53_07030 [Escherichia coli]
 gb|PLA88763.1| hypothetical protein CYR80_11400 [Escherichia coli]
 gb|PLB61269.1| hypothetical protein APX95_21110 [Escherichia coli]
 gb|AUK09935.1| hypothetical protein CR536_03550 [Escherichia coli]
 gb|AUK15192.1| hypothetical protein CR535_03490 [Escherichia coli]
 gb|AUK20318.1| hypothetical protein CR534_03485 [Escherichia coli]
 gb|AUL62041.1| hypothetical protein BVL38_03380 [Escherichia coli]
 gb|AUN46133.1| hypothetical protein C0634_04850 [Escherichia coli]
 gb|PME02848.1| hypothetical protein A8A06_15635 [Escherichia coli]
 emb|SOQ97214.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ93007.1| conserved hypothetical protein [Escherichia coli]
 emb|SOR03915.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ89999.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ63773.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ66868.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ77678.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ80187.1| conserved hypothetical protein [Escherichia coli]
 emb|SOQ73306.1| conserved hypothetical protein [Escherichia coli]
 emb|SOR08433.1| conserved hypothetical protein [Escherichia coli]
 gb|AUO55832.1| hypothetical protein C1I23_03295 [Escherichia coli]
 gb|PND45124.1| hypothetical protein B7440_10280 [Escherichia coli]
 gb|PNO96875.1| hypothetical protein RK56_015085 [Escherichia coli]
 gb|PNS28539.1| hypothetical protein C1H52_02070 [Escherichia coli]
 gb|PNY42810.1| hypothetical protein C2M22_05120 [Escherichia coli]
 gb|AUV22456.1| hypothetical protein C2U45_17765 [Escherichia coli]
 gb|POH96985.1| hypothetical protein C3B66_19270 [Escherichia coli]
 gb|POI07424.1| hypothetical protein C3B70_12235 [Escherichia coli]
 gb|POZ06689.1| hypothetical protein C3419_20545 [Escherichia coli]
 gb|AVB44125.1| hypothetical protein C4E05_05575 [Escherichia coli]
 gb|AVD30344.1| hypothetical protein C4J63_01505 [Escherichia coli]
 gb|PPE08157.1| hypothetical protein C4Y11_21995 [Escherichia coli]
 gb|PPI90967.1| hypothetical protein C4J69_18975 [Escherichia coli]
 gb|PPV47897.1| hypothetical protein C5O87_08915 [Escherichia coli]
 gb|PPV59885.1| hypothetical protein C5P22_18430 [Escherichia coli]
 gb|PPV74061.1| hypothetical protein C5O85_17655 [Escherichia coli]
 gb|PPV97469.1| hypothetical protein C5P25_02055 [Escherichia coli]
 gb|PPW07551.1| hypothetical protein C5P27_01095 [Escherichia coli]
 gb|PPW20874.1| hypothetical protein C5P21_04520 [Escherichia coli]
 gb|PPW47199.1| hypothetical protein C5O97_06490 [Escherichia coli]
 gb|PPW73217.1| hypothetical protein C5O93_08420 [Escherichia coli]
 gb|PPW77115.1| hypothetical protein C5P14_23020 [Escherichia coli]
 gb|PPX11313.1| hypothetical protein C5P24_06055 [Escherichia coli]
 gb|PPX19933.1| hypothetical protein C5O81_00115 [Escherichia coli]
 gb|PPX20646.1| hypothetical protein C5O90_01860 [Escherichia coli]
 gb|PPX29386.1| hypothetical protein C5P23_05405 [Escherichia coli]
 gb|PPX32965.1| hypothetical protein C5P20_14125 [Escherichia coli]
 gb|PPX46669.1| hypothetical protein C5P06_02555 [Escherichia coli]
 gb|PPX61217.1| hypothetical protein C5P11_14710 [Escherichia coli]
 gb|PPY70078.1| hypothetical protein C5P30_11115 [Escherichia coli]
 gb|PPY86316.1| hypothetical protein C5P32_11320 [Escherichia coli]
 gb|PPY87126.1| hypothetical protein C5P48_02185 [Escherichia coli]
 gb|PPY98042.1| hypothetical protein C5P46_12095 [Escherichia coli]
 gb|PPZ04361.1| hypothetical protein C5P31_00990 [Escherichia coli]
 gb|PPZ12862.1| hypothetical protein C5P41_07515 [Escherichia coli]
 gb|PPZ29282.1| hypothetical protein C5P35_01235 [Escherichia coli]
 gb|PQK22717.1| hypothetical protein C5Y88_00915 [Escherichia coli]
 gb|PQK29087.1| hypothetical protein C5Y90_03545 [Escherichia coli]
 gb|PQK36073.1| hypothetical protein C5Y91_08970 [Escherichia coli]
 gb|PQK52174.1| hypothetical protein C5Y86_05295 [Escherichia coli]
 gb|PQK60054.1| hypothetical protein C5Y87_00930 [Escherichia coli]
 gb|PQK67298.1| hypothetical protein C5Y94_00765 [Escherichia coli]
 gb|AVI53272.1| hypothetical protein C5Y66_04465 [Escherichia coli str. K-12 substr.
            MG1655]
 gb|PQN51698.1| hypothetical protein C5K25_13675 [Shigella dysenteriae]
 gb|PQO68320.1| hypothetical protein C5N11_11005 [Escherichia coli]
 gb|PQO70963.1| hypothetical protein C5N08_15295 [Escherichia coli]
 gb|PQO73588.1| hypothetical protein C5N10_16980 [Escherichia coli]
 gb|PQO82123.1| hypothetical protein C5N09_11990 [Escherichia coli]
 gb|PQO86984.1| hypothetical protein C5N06_16275 [Escherichia coli]
 gb|PQP09085.1| hypothetical protein C5N07_16250 [Escherichia coli]
 gb|PRW52207.1| yqjK-like family protein [Escherichia coli]
 gb|PSF86821.1| hypothetical protein C6962_17455 [Escherichia coli]
 gb|PSF92452.1| hypothetical protein C6964_17360 [Escherichia coli]
 gb|PSG10414.1| hypothetical protein C6963_18180 [Escherichia coli]
 gb|PSG20788.1| hypothetical protein C6958_17110 [Escherichia coli]
 gb|PSG24377.1| hypothetical protein C6956_17365 [Escherichia coli]
 gb|PSG29737.1| hypothetical protein C6965_17305 [Escherichia coli]
 gb|PSG34294.1| hypothetical protein C6960_17080 [Escherichia coli]
 gb|PSG44456.1| hypothetical protein C6957_17000 [Escherichia coli]
 gb|PSG70229.1| hypothetical protein C6959_17125 [Escherichia coli]
 gb|PSG75568.1| hypothetical protein C6961_17385 [Escherichia coli]
 gb|AVP31285.1| hypothetical protein C5097_20815 [Escherichia coli]
          Length = 99

 Score =  199 bits (505), Expect = 7e-61
 Identities = 97/98 (98%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_096945363.1| hypothetical protein [Escherichia coli]
          Length = 99

 Score =  198 bits (504), Expect = 1e-60
 Identities = 96/98 (97%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFG+WSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGIWSAWRLVKTTLKQQQLR 98


>ref|WP_060615258.1| hypothetical protein [Escherichia coli]
 gb|KUH31151.1| hypothetical protein ARC91_05610 [Escherichia coli]
          Length = 99

 Score =  198 bits (504), Expect = 1e-60
 Identities = 96/98 (97%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNML+RWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLIRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_097310636.1| hypothetical protein [Escherichia coli]
          Length = 99

 Score =  197 bits (502), Expect = 2e-60
 Identities = 96/98 (97%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTL+QQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLRQQQLR 98


>ref|WP_095079549.1| hypothetical protein [Escherichia coli]
 gb|PAB68601.1| hypothetical protein CDH55_08695 [Escherichia coli]
          Length = 99

 Score =  197 bits (502), Expect = 2e-60
 Identities = 96/98 (97%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLL+LRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLNLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_097301946.1| hypothetical protein [Escherichia coli]
          Length = 99

 Score =  197 bits (501), Expect = 3e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRK QLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKTQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_086642282.1| hypothetical protein [Escherichia coli]
 gb|PQK40271.1| hypothetical protein C5Y84_13340 [Escherichia coli]
          Length = 99

 Score =  197 bits (501), Expect = 3e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSW LVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWTLVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_032233698.1| membrane protein [Escherichia coli]
 emb|CDP76022.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KXR51684.1| hypothetical protein AUQ26_10360 [Escherichia coli]
          Length = 99

 Score =  197 bits (501), Expect = 3e-60
 Identities = 96/98 (97%), Positives = 98/98 (100%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPN+LVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNILVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_032237323.1| membrane protein [Escherichia coli]
 gb|EZJ68699.1| yqjK-like family protein [Escherichia coli 1-392-07_S3_C3]
 gb|KDT31752.1| yqjK-like family protein [Escherichia coli 3-105-05_S1_C1]
 gb|KDU57098.1| yqjK-like family protein [Escherichia coli 3-475-03_S4_C2]
 gb|KDW49746.1| yqjK-like family protein [Escherichia coli 1-392-07_S3_C2]
 gb|KDW96795.1| yqjK-like family protein [Escherichia coli 1-392-07_S3_C1]
 gb|KDZ91278.1| yqjK-like family protein [Escherichia coli 3-105-05_S1_C3]
          Length = 99

 Score =  197 bits (501), Expect = 3e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
             IWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   TIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_001554524.1| hypothetical protein [Escherichia coli]
 gb|ELD97071.1| hypothetical protein A1SA_04108 [Escherichia coli KTE51]
          Length = 99

 Score =  197 bits (501), Expect = 3e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQ R
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQFR 98


>ref|WP_089636792.1| hypothetical protein [Escherichia coli]
          Length = 99

 Score =  197 bits (500), Expect = 4e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSL SWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLHSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_074562392.1| hypothetical protein [Escherichia coli]
 gb|OKT90053.1| hypothetical protein ACN70_10650 [Escherichia coli]
 gb|POV26705.1| hypothetical protein C3383_08940 [Escherichia coli]
          Length = 99

 Score =  197 bits (500), Expect = 4e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQ LR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQHLR 98


>ref|WP_000096086.1| MULTISPECIES: hypothetical protein [Enterobacteriaceae]
 ref|NP_312009.1| hypothetical protein ECs3982 [Escherichia coli O157:H7 str. Sakai]
 ref|YP_002409504.1| hypothetical protein ECIAI39_3601 [Escherichia coli IAI39]
 ref|YP_006121430.1| hypothetical protein NRG857_15430 [Escherichia coli O83:H1 str. NRG
            857C]
 gb|AAG58233.1|AE005539_10 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gb|AAN82303.1|AE016767_63 Hypothetical protein yqjK [Escherichia coli CFT073]
 dbj|BAB37405.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gb|AAZ89836.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gb|ABB67480.1| conserved hypothetical protein [Shigella boydii Sb227]
 gb|ABE08984.1| hypothetical protein UTI89_C3538 [Escherichia coli UTI89]
 gb|ABG71178.1| hypothetical protein YqjK [Escherichia coli 536]
 gb|ABF05200.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gb|ABV07517.1| conserved hypothetical protein [Escherichia coli HS]
 gb|ABV19980.1| conserved hypothetical protein [Escherichia coli O139:H28 str.
            E24377A]
 gb|ACA76272.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gb|ACB16391.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gb|ACD10360.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gb|EDU34680.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4196]
 gb|EDU54446.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4113]
 gb|EDU64543.1| conserved hypothetical protein [Escherichia coli 53638]
 gb|EDU70047.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4076]
 gb|EDU77207.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4401]
 gb|EDU79849.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4486]
 gb|EDU85964.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4501]
 gb|EDU92350.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC869]
 gb|EDU98073.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC508]
 gb|EDV67094.1| conserved hypothetical protein [Escherichia coli F11]
 gb|EDV84825.1| conserved hypothetical protein [Escherichia coli E22]
 gb|EDV89860.1| conserved hypothetical protein [Escherichia coli E110019]
 gb|EDX30454.1| conserved hypothetical protein [Escherichia coli B171]
 gb|EDX34107.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gb|EDX38243.1| conserved hypothetical protein [Escherichia coli 101-1]
 gb|EDZ79050.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4206]
 gb|EDZ82674.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4045]
 gb|EDZ88939.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4042]
 gb|ACI34941.1| conserved hypothetical protein [Escherichia coli O157:H7 str. EC4115]
 gb|ACI77781.1| hypothetical protein ECs3982 [Escherichia coli]
 gb|ACI77782.1| hypothetical protein ECs3982 [Escherichia coli]
 gb|ACI77783.1| hypothetical protein ECs3982 [Escherichia coli]
 gb|ACI77784.1| hypothetical protein ECs3982 [Escherichia coli]
 gb|ACI77785.1| hypothetical protein ECs3982 [Escherichia coli]
 dbj|BAG78909.1| conserved hypothetical protein [Escherichia coli SE11]
 emb|CAS10941.1| conserved inner membrane protein [Escherichia coli O127:H6 str.
            E2348/69]
 gb|EEC28035.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
            TW14588]
 emb|CAR00064.1| conserved hypothetical protein [Escherichia coli IAI1]
 emb|CAR04724.1| conserved hypothetical protein [Escherichia coli S88]
 emb|CAR19717.1| conserved hypothetical protein [Escherichia coli IAI39]
 emb|CAP77572.1| Uncharacterized protein yqjK [Escherichia coli LF82]
 gb|EEH85438.1| hypothetical protein ESAG_01150 [Escherichia sp. 3_2_53FAA]
 gb|EEJ45688.1| hypothetical protein HMPREF0358_4418 [Escherichia coli 83972]
 emb|CAQ33437.1| conserved protein [Escherichia coli BL21(DE3)]
 gb|ACT27708.1| conserved hypothetical protein [Escherichia coli 'BL21-Gold(DE3)pLysS
            AG']
 gb|ACT40618.1| hypothetical protein ECB_02969 [Escherichia coli B str. REL606]
 gb|ACT44773.1| uncharacterized protein ECD_02969 [Escherichia coli BL21(DE3)]
 gb|ACT73812.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 dbj|BAI27381.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 dbj|BAI32560.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 dbj|BAI37706.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 dbj|BAI56483.1| conserved hypothetical protein [Escherichia coli SE15]
 gb|ADD58312.1| hypothetical protein G2583_3824 [Escherichia coli O55:H7 str. CB9615]
 gb|EFE61960.1| yqjK protein [Escherichia coli B088]
 gb|EFF04876.1| yqjK protein [Escherichia coli B185]
 gb|EFF11741.1| yqjK protein [Escherichia coli B354]
 gb|ADE91298.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gb|EFJ56456.1| hypothetical protein HMPREF9549_02097 [Escherichia coli MS 185-1]
 gb|EFJ62794.1| hypothetical protein HMPREF9553_01104 [Escherichia coli MS 200-1]
 gb|EFJ85970.1| hypothetical protein HMPREF9536_03740 [Escherichia coli MS 84-1]
 gb|EFJ94438.1| hypothetical protein HMPREF9531_00426 [Escherichia coli MS 45-1]
 gb|EFJ99330.1| hypothetical protein HMPREF9540_00563 [Escherichia coli MS 115-1]
 gb|EFK04627.1| hypothetical protein HMPREF9548_00582 [Escherichia coli MS 182-1]
 gb|EFK20494.1| hypothetical protein HMPREF9530_02909 [Escherichia coli MS 21-1]
 gb|EFK23701.1| hypothetical protein HMPREF9550_04209 [Escherichia coli MS 187-1]
 gb|EFK46910.1| hypothetical protein HMPREF9346_01535 [Escherichia coli MS 119-7]
 gb|EFK51358.1| hypothetical protein HMPREF9345_01999 [Escherichia coli MS 107-1]
 gb|EFK70590.1| hypothetical protein HMPREF9347_00411 [Escherichia coli MS 124-1]
 gb|EFK75424.1| hypothetical protein HMPREF9535_00595 [Escherichia coli MS 78-1]
 gb|EFM50571.1| hypothetical protein ECNC101_08014 [Escherichia coli NC101]
 gb|EFN39663.1| conserved hypothetical protein [Escherichia coli W]
 gb|ADN47980.1| cell division MukB-like protein [Escherichia coli ABU 83972]
 gb|ADN69592.1| hypothetical protein UM146_00815 [Escherichia coli UM146]
 gb|EFO59891.1| hypothetical protein HMPREF9348_00834 [Escherichia coli MS 145-7]
 gb|EFR14681.1| uncharacterized protein yqjK [Escherichia coli 2362-75]
 gb|ADR28496.1| hypothetical protein NRG857_15430 [Escherichia coli O83:H1 str. NRG
            857C]
 gb|ADT76737.1| conserved hypothetical protein [Escherichia coli W]
 gb|EFU36988.1| hypothetical protein HMPREF9350_01049 [Escherichia coli MS 85-1]
 gb|EFU48283.1| hypothetical protein HMPREF9539_01150 [Escherichia coli MS 110-3]
 gb|EFU54316.1| hypothetical protein HMPREF9544_00573 [Escherichia coli MS 153-1]
 gb|EFU57119.1| hypothetical protein HMPREF9545_03150 [Escherichia coli MS 16-3]
 gb|EFW49532.1| Inner membrane protein YqjK [Shigella dysenteriae CDC 74-1112]
 gb|EFW52720.1| Inner membrane protein YqjK [Shigella boydii ATCC 9905]
 gb|EFW59404.1| Inner membrane protein YqjK [Shigella flexneri CDC 796-83]
 gb|EFW64111.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. EC1212]
 gb|EFW76590.1| Inner membrane protein YqjK [Escherichia coli EC4100B]
 gb|EFX09745.1| hypothetical protein ECO5101_09436 [Escherichia coli O157:H7 str.
            G5101]
 gb|EFX14479.1| hypothetical protein ECO9389_07592 [Escherichia coli O157:H- str.
            493-89]
 gb|EFX19238.1| hypothetical protein ECO2687_13839 [Escherichia coli O157:H- str. H
            2687]
 gb|EFX24072.1| hypothetical protein ECO7815_18429 [Escherichia coli O55:H7 str.
            3256-97]
 gb|EFX29258.1| hypothetical protein ECO5905_12273 [Escherichia coli O55:H7 str. USDA
            5905]
 gb|EFX33977.1| hypothetical protein ECOSU61_07717 [Escherichia coli O157:H7 str.
            LSU-61]
 gb|EFZ40764.1| hypothetical protein ECEPECA14_3610 [Escherichia coli EPECa14]
 gb|EFZ48987.1| hypothetical protein ECE128010_0751 [Escherichia coli E128010]
 gb|EFZ50849.1| hypothetical protein SS53G_4522 [Shigella sonnei 53G]
 gb|EFZ59274.1| hypothetical protein ECLT68_1962 [Escherichia coli LT-68]
 gb|EFZ64387.1| hypothetical protein ECOK1180_2544 [Escherichia coli OK1180]
 gb|EFZ68452.1| hypothetical protein ECOK1357_3469 [Escherichia coli OK1357]
 gb|EFZ74553.1| hypothetical protein ECRN5871_2870 [Escherichia coli RN587/1]
 gb|ADX49270.1| hypothetical protein EKO11_0615 [Escherichia coli KO11FL]
 gb|EGB37976.1| hypothetical protein ERDG_01572 [Escherichia coli E482]
 gb|EGB42844.1| hypothetical protein EREG_01624 [Escherichia coli H120]
 gb|EGB47244.1| hypothetical protein ERKG_02012 [Escherichia coli H252]
 gb|EGB53455.1| hypothetical protein ERLG_01067 [Escherichia coli H263]
 gb|EGB56646.1| hypothetical protein ERGG_02498 [Escherichia coli H489]
 gb|EGB62061.1| hypothetical protein ERJG_02217 [Escherichia coli M863]
 gb|EGB65478.1| hypothetical protein ERHG_03749 [Escherichia coli TA007]
 gb|EGB74068.1| hypothetical protein ERFG_00168 [Escherichia coli TW10509]
 gb|EGB78046.1| hypothetical protein HMPREF9532_01459 [Escherichia coli MS 57-2]
 gb|EGB81255.1| hypothetical protein HMPREF9533_03928 [Escherichia coli MS 60-1]
 gb|EGB87469.1| hypothetical protein HMPREF9542_03100 [Escherichia coli MS 117-3]
 gb|EGC13350.1| hypothetical protein ERBG_00496 [Escherichia coli E1167]
 gb|EGD61638.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. 1125]
 gb|EGD71094.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. 1044]
 gb|EGE63572.1| hypothetical protein ECSTEC7V_3739 [Escherichia coli STEC_7v]
 gb|EGI26006.1| putative inner membrane protein [Escherichia coli TA206]
 gb|EGI34699.1| putative inner membrane protein [Escherichia coli TA271]
 gb|EGI91332.1| hypothetical protein SB521682_3887 [Shigella boydii 5216-82]
 gb|EGI97055.1| hypothetical protein SB359474_3434 [Shigella boydii 3594-74]
 gb|EGJ05776.1| hypothetical protein SSJG_01824 [Escherichia coli D9]
 gb|EGJ83550.1| hypothetical protein SF434370_3346 [Shigella flexneri 4343-70]
 gb|EGK18370.1| hypothetical protein SFVA6_4056 [Shigella flexneri VA-6]
 gb|EGK19464.1| hypothetical protein SFK218_4133 [Shigella flexneri K-218]
 gb|EGM60322.1| hypothetical protein SFJ1713_3607 [Shigella flexneri SFJ17B]
 gb|EGU98454.1| putative inner membrane protein [Escherichia coli MS 79-10]
 gb|EGW66268.1| hypothetical protein EC253486_4125 [Escherichia coli 2534-86]
 gb|EGW68611.1| hypothetical protein ECSTECB2F1_3406 [Escherichia coli STEC_B2F1]
 gb|EGW80301.1| hypothetical protein ECSTEC94C_3800 [Escherichia coli STEC_94C]
 gb|EGW81943.1| hypothetical protein EC30301_3654 [Escherichia coli 3030-1]
 gb|EGW88452.1| hypothetical protein ECSTECDG1313_4203 [Escherichia coli
            STEC_DG131-3]
 gb|EGX02929.1| hypothetical protein ECSTECMHI813_3498 [Escherichia coli STEC_MHI813]
 gb|EGX06339.1| hypothetical protein ECSTECH18_3955 [Escherichia coli STEC_H.1.8]
 gb|EGX21946.1| hypothetical protein ECTX1999_3721 [Escherichia coli TX1999]
 gb|AEQ14355.1| conserved protein [Escherichia coli O7:K1 str. CE10]
 gb|EHF99476.1| hypothetical protein i01_04405 [Escherichia coli cloneA_i1]
 gb|EHN83364.1| hypothetical protein ESQG_03003 [Escherichia coli H494]
 gb|EHN89765.1| hypothetical protein ESRG_00158 [Escherichia coli TA124]
 gb|EHN93850.1| hypothetical protein ESPG_03785 [Escherichia coli H397]
 gb|EHN95005.1| hypothetical protein ESOG_01213 [Escherichia coli E101]
 gb|AEZ42207.1| hypothetical protein ECO55CA74_18230 [Escherichia coli O55:H7 str.
            RM12579]
 gb|EHU05944.1| hypothetical protein ECDEC1A_3522 [Escherichia coli DEC1A]
 gb|EHU06412.1| hypothetical protein ECDEC1C_3833 [Escherichia coli DEC1C]
 gb|EHU09549.1| hypothetical protein ECDEC1B_3754 [Escherichia coli DEC1B]
 gb|EHU19505.1| cell division MukB-like protein [Escherichia coli DEC1D]
 gb|EHU22676.1| hypothetical protein ECDEC1E_3874 [Escherichia coli DEC1E]
 gb|EHU26114.1| cell division MukB-like protein [Escherichia coli DEC2A]
 gb|EHU36421.1| hypothetical protein ECDEC2B_3807 [Escherichia coli DEC2B]
 gb|EHU39126.1| hypothetical protein ECDEC2C_3787 [Escherichia coli DEC2C]
 gb|EHU41411.1| hypothetical protein ECDEC2D_3720 [Escherichia coli DEC2D]
 gb|EHU51546.1| hypothetical protein ECDEC2E_3771 [Escherichia coli DEC2E]
 gb|EHU55408.1| hypothetical protein ECDEC3A_4014 [Escherichia coli DEC3A]
 gb|EHU56171.1| hypothetical protein ECDEC3B_4183 [Escherichia coli DEC3B]
 gb|EHU67826.1| hypothetical protein ECDEC3C_4466 [Escherichia coli DEC3C]
 gb|EHU71944.1| hypothetical protein ECDEC3D_4174 [Escherichia coli DEC3D]
 gb|EHU73791.1| hypothetical protein ECDEC3E_4415 [Escherichia coli DEC3E]
 gb|EHU83134.1| hypothetical protein ECDEC3F_4321 [Escherichia coli DEC3F]
 gb|EHU88349.1| hypothetical protein ECDEC4A_3970 [Escherichia coli DEC4A]
 gb|EHU92578.1| hypothetical protein ECDEC4B_4119 [Escherichia coli DEC4B]
 gb|EHV03597.1| hypothetical protein ECDEC4D_3960 [Escherichia coli DEC4D]
 gb|EHV03892.1| hypothetical protein ECDEC4C_4046 [Escherichia coli DEC4C]
 gb|EHV09541.1| hypothetical protein ECDEC4E_4057 [Escherichia coli DEC4E]
 gb|EHV19360.1| hypothetical protein ECDEC4F_3977 [Escherichia coli DEC4F]
 gb|EHV21969.1| hypothetical protein ECDEC5A_3840 [Escherichia coli DEC5A]
 gb|EHV26773.1| hypothetical protein ECDEC5B_4195 [Escherichia coli DEC5B]
 gb|EHV35148.1| hypothetical protein ECDEC5C_3865 [Escherichia coli DEC5C]
 gb|EHV36105.1| hypothetical protein ECDEC5D_3985 [Escherichia coli DEC5D]
 gb|EHV46036.1| cell division MukB-like protein [Escherichia coli DEC5E]
 gb|EHV76640.1| cell division MukB-like protein [Escherichia coli DEC7A]
 gb|EHV85304.1| hypothetical protein ECDEC7C_3658 [Escherichia coli DEC7C]
 gb|EHV88508.1| hypothetical protein ECDEC7D_3875 [Escherichia coli DEC7D]
 gb|EHV99179.1| cell division MukB-like protein [Escherichia coli DEC7E]
 gb|EHW06815.1| cell division MukB-like protein [Escherichia coli DEC8A]
 gb|EHW07595.1| hypothetical protein ECDEC8B_4238 [Escherichia coli DEC8B]
 gb|EHW13072.1| hypothetical protein ECDEC8C_4780 [Escherichia coli DEC8C]
 gb|EHW22278.1| hypothetical protein ECDEC8D_4275 [Escherichia coli DEC8D]
 gb|EHW25609.1| hypothetical protein ECDEC8E_4063 [Escherichia coli DEC8E]
 gb|EHW32368.1| hypothetical protein ECDEC9A_4119 [Escherichia coli DEC9A]
 gb|EHW37070.1| hypothetical protein ECDEC9B_3782 [Escherichia coli DEC9B]
 gb|EHW43414.1| hypothetical protein ECDEC9C_3908 [Escherichia coli DEC9C]
 gb|EHW50017.1| hypothetical protein ECDEC9D_3769 [Escherichia coli DEC9D]
 gb|EHW53273.1| hypothetical protein ECDEC9E_4261 [Escherichia coli DEC9E]
 gb|EHW59761.1| hypothetical protein ECDEC10A_4227 [Escherichia coli DEC10A]
 gb|EHW65290.1| hypothetical protein ECDEC10B_4602 [Escherichia coli DEC10B]
 gb|EHW69720.1| hypothetical protein ECDEC10C_4654 [Escherichia coli DEC10C]
 gb|EHW75739.1| hypothetical protein ECDEC10D_4233 [Escherichia coli DEC10D]
 gb|EHW87120.1| hypothetical protein ECDEC10E_3716 [Escherichia coli DEC10E]
 gb|EHW88351.1| hypothetical protein ECDEC11A_3681 [Escherichia coli DEC11A]
 gb|EHW89230.1| hypothetical protein ECDEC10F_4691 [Escherichia coli DEC10F]
 gb|EHX00533.1| hypothetical protein ECDEC11B_3680 [Escherichia coli DEC11B]
 gb|EHX07000.1| cell division MukB-like protein [Escherichia coli DEC11D]
 gb|EHX08948.1| cell division MukB-like protein [Escherichia coli DEC11C]
 gb|EHX17200.1| cell division MukB-like protein [Escherichia coli DEC11E]
 gb|EHX23451.1| hypothetical protein ECDEC12B_4330 [Escherichia coli DEC12B]
 gb|EHX28430.1| cell division MukB-like protein [Escherichia coli DEC12C]
 gb|EHX40676.1| hypothetical protein ECDEC12D_4015 [Escherichia coli DEC12D]
 gb|EHX45433.1| hypothetical protein ECDEC13A_3433 [Escherichia coli DEC13A]
 gb|EHX45633.1| hypothetical protein ECDEC12E_3795 [Escherichia coli DEC12E]
 gb|EHX57561.1| hypothetical protein ECDEC13C_3792 [Escherichia coli DEC13C]
 gb|EHX58165.1| hypothetical protein ECDEC13B_3281 [Escherichia coli DEC13B]
 gb|EHX61103.1| hypothetical protein ECDEC13D_3570 [Escherichia coli DEC13D]
 gb|EHX70935.1| hypothetical protein ECDEC13E_3625 [Escherichia coli DEC13E]
 gb|EHX74690.1| cell division MukB-like protein [Escherichia coli DEC14A]
 gb|EHX77358.1| hypothetical protein ECDEC14B_3769 [Escherichia coli DEC14B]
 gb|EHX86261.1| hypothetical protein ECDEC14C_3676 [Escherichia coli DEC14C]
 gb|EHX89449.1| hypothetical protein ECDEC14D_3620 [Escherichia coli DEC14D]
 gb|EHX96276.1| hypothetical protein ECDEC15A_3877 [Escherichia coli DEC15A]
 gb|EHY01259.1| hypothetical protein ECDEC15B_3679 [Escherichia coli DEC15B]
 gb|EHY05832.1| hypothetical protein ECDEC15C_3587 [Escherichia coli DEC15C]
 gb|EHY13235.1| hypothetical protein ECDEC15D_3531 [Escherichia coli DEC15D]
 gb|EHY17446.1| hypothetical protein ECDEC15E_3867 [Escherichia coli DEC15E]
 gb|EIA35085.1| hypothetical protein OQA_15471 [Escherichia coli SCI-07]
 gb|AFH16419.1| hypothetical protein KO11_07185 [Escherichia coli KO11FL]
 gb|AFH12942.1| hypothetical protein WFL_16475 [Escherichia coli W]
 gb|EID63443.1| hypothetical protein SF5M90T_3069 [Shigella flexneri 5a str. M90T]
 gb|EID68013.1| putative inner membrane protein [Escherichia coli W26]
 gb|EIE54075.1| putative inner membrane protein [Escherichia coli AI27]
 gb|EIG47432.1| hypothetical protein ESTG_01874 [Escherichia coli B799]
 gb|EIG80441.1| hypothetical protein EC12741_2519 [Escherichia coli 1.2741]
 gb|EIG93465.1| hypothetical protein EC970246_3014 [Escherichia coli 97.0246]
 gb|EIH04418.1| hypothetical protein EC50588_3414 [Escherichia coli 5.0588]
 gb|EIH10838.1| hypothetical protein EC990741_3504 [Escherichia coli 97.0259]
 gb|EIH24620.1| hypothetical protein EC12264_1539 [Escherichia coli 1.2264]
 gb|EIH33188.1| hypothetical protein EC960497_3478 [Escherichia coli 96.0497]
 gb|EIH45303.1| hypothetical protein EC970259_3764 [Escherichia coli 99.0741]
 gb|EIH56539.1| hypothetical protein EC32608_4121 [Escherichia coli 3.2608]
 gb|EIH65252.1| hypothetical protein EC930624_3909 [Escherichia coli 93.0624]
 gb|EIH77439.1| hypothetical protein EC40522_4338 [Escherichia coli 4.0522]
 gb|EIH89915.1| hypothetical protein ECJB195_2171 [Escherichia coli JB1-95]
 gb|EII02149.1| hypothetical protein EC96154_3346 [Escherichia coli 96.154]
 gb|EII21026.1| hypothetical protein EC90111_1756 [Escherichia coli 9.0111]
 gb|EII37183.1| hypothetical protein EC40967_2017 [Escherichia coli 4.0967]
 gb|EII57723.1| hypothetical protein EC33884_1736 [Escherichia coli 3.3884]
 gb|EII87318.1| hypothetical protein EC3003_3470 [Escherichia coli 3003]
 gb|EII97248.1| hypothetical protein ECTW07793_3239 [Escherichia coli TW07793]
 gb|EIJ15018.1| hypothetical protein EC900105_4165 [Escherichia coli 900105 (10e)]
 gb|AFJ30779.1| hypothetical protein CDCO157_3723 [Escherichia coli Xuzhou21]
 gb|EIL03481.1| hypothetical protein ECO9340_03872 [Escherichia coli O103:H25 str.
            CVM9340]
 gb|EIL05493.1| hypothetical protein ECO9534_14427 [Escherichia coli O111:H11 str.
            CVM9534]
 gb|EIL06937.1| hypothetical protein ECO9450_07476 [Escherichia coli O103:H2 str.
            CVM9450]
 gb|EIL13267.1| hypothetical protein ECO9570_05883 [Escherichia coli O111:H8 str.
            CVM9570]
 gb|EIL20891.1| hypothetical protein ECO9545_15418 [Escherichia coli O111:H11 str.
            CVM9545]
 gb|EIL28205.1| hypothetical protein ECO9574_00782 [Escherichia coli O111:H8 str.
            CVM9574]
 gb|EIL36394.1| hypothetical protein ECO10026_27043 [Escherichia coli O26:H11 str.
            CVM10026]
 gb|EIL41526.1| hypothetical protein ECO9942_01592 [Escherichia coli O26:H11 str.
            CVM9942]
 gb|EIL52960.1| hypothetical protein EC54115_12676 [Escherichia coli 541-15]
 gb|EIL67546.1| hypothetical protein EC5411_05008 [Escherichia coli 541-1]
 gb|EIL73461.1| hypothetical protein ECHM605_18754 [Escherichia coli HM605]
 gb|EIL81614.1| hypothetical protein ECMT8_01957 [Escherichia coli CUMT8]
 gb|EIN18802.1| cell division MukB-like protein [Escherichia coli FRIK1996]
 gb|EIN20445.1| cell division MukB-like protein [Escherichia coli FDA517]
 gb|EIN20813.1| cell division MukB-like protein [Escherichia coli FDA505]
 gb|EIN36401.1| cell division MukB-like protein [Escherichia coli FRIK1985]
 gb|EIN36600.1| cell division MukB-like protein [Escherichia coli 93-001]
 gb|EIN51749.1| cell division MukB-like protein [Escherichia coli PA3]
 gb|EIN55017.1| cell division MukB-like protein [Escherichia coli PA5]
 gb|EIN58345.1| cell division MukB-like protein [Escherichia coli PA9]
 gb|EIN68879.1| cell division MukB-like protein [Escherichia coli PA10]
 gb|EIN73155.1| cell division MukB-like protein [Escherichia coli PA14]
 gb|EIN73457.1| cell division MukB-like protein [Escherichia coli PA15]
 gb|EIN85856.1| cell division MukB-like protein [Escherichia coli PA22]
 gb|EIN92682.1| cell division MukB-like protein [Escherichia coli PA25]
 gb|EIN94741.1| cell division MukB-like protein [Escherichia coli PA24]
 gb|EIN98225.1| cell division MukB-like protein [Escherichia coli PA28]
 gb|EIO10574.1| cell division MukB-like protein [Escherichia coli PA31]
 gb|EIO11314.1| cell division MukB-like protein [Escherichia coli PA32]
 gb|EIO14528.1| cell division MukB-like protein [Escherichia coli PA33]
 gb|EIO26242.1| cell division MukB-like protein [Escherichia coli PA40]
 gb|EIO33600.1| cell division MukB-like protein [Escherichia coli PA39]
 gb|EIO34514.1| cell division MukB-like protein [Escherichia coli PA41]
 gb|EIO36159.1| cell division MukB-like protein [Escherichia coli PA42]
 gb|EIO47965.1| cell division MukB-like protein [Escherichia coli TW06591]
 gb|EIO55052.1| cell division MukB-like protein [Escherichia coli TW07945]
 gb|EIO56403.1| cell division MukB-like protein [Escherichia coli TW10246]
 gb|EIO61962.1| cell division MukB-like protein [Escherichia coli TW11039]
 gb|EIO70102.1| cell division MukB-like protein [Escherichia coli TW09098]
 gb|EIO72624.1| cell division MukB-like protein [Escherichia coli TW09109]
 gb|EIO81119.1| cell division MukB-like protein [Escherichia coli TW10119]
 gb|EIO90123.1| cell division MukB-like protein [Escherichia coli EC4203]
 gb|EIO92200.1| cell division MukB-like protein [Escherichia coli TW09195]
 gb|EIO94529.1| cell division MukB-like protein [Escherichia coli EC4196]
 gb|EIP07308.1| cell division MukB-like protein [Escherichia coli O157:H7 str.
            TW14313]
 gb|EIP08166.1| cell division MukB-like protein [Escherichia coli TW14301]
 gb|EIP12671.1| cell division MukB-like protein [Escherichia coli EC4421]
 gb|EIP21906.1| cell division MukB-like protein [Escherichia coli EC4422]
 gb|EIP26231.1| cell division MukB-like protein [Escherichia coli EC4013]
 gb|EIP30341.1| cell division MukB-like protein [Escherichia coli EC4402]
 gb|EIP37785.1| cell division MukB-like protein [Escherichia coli EC4439]
 gb|EIP42703.1| cell division MukB-like protein [Escherichia coli EC4436]
 gb|EIP51260.1| cell division MukB-like protein [Escherichia coli EC4437]
 gb|EIP53654.1| cell division MukB-like protein [Escherichia coli EC4448]
 gb|EIP57972.1| cell division MukB-like protein [Escherichia coli EC1738]
 gb|EIP65695.1| cell division MukB-like protein [Escherichia coli EC1734]
 gb|EIP75546.1| cell division MukB-like protein [Escherichia coli EC1863]
 gb|EIP76880.1| cell division MukB-like protein [Escherichia coli EC1845]
 gb|EIQ05746.1| cell division MukB-like protein [Shigella flexneri 2850-71]
 gb|EIQ07090.1| cell division MukB-like protein [Shigella flexneri K-1770]
 gb|EIQ08237.1| cell division MukB-like protein [Shigella flexneri CCH060]
 gb|EIQ18724.1| cell division MukB-like protein [Shigella flexneri K-315]
 gb|EIQ34827.1| cell division MukB-like protein [Shigella boydii 4444-74]
 gb|EIQ37413.1| cell division MukB-like protein [Shigella sonnei 3226-85]
 gb|EIQ41507.1| cell division MukB-like protein [Shigella sonnei 3233-85]
 gb|EIQ51006.1| hypothetical protein SS482266_3503 [Shigella sonnei 4822-66]
 gb|EIQ57366.1| cell division MukB-like protein [Shigella dysenteriae 225-75]
 gb|EIQ61469.1| cell division MukB-like protein [Escherichia coli EPECa12]
 gb|EIQ68539.1| hypothetical protein ECEPECC34262_4062 [Escherichia coli EPEC
            C342-62]
 gb|EIQ69869.1| cell division MukB-like protein [Shigella flexneri 1235-66]
 gb|EJE66294.1| hypothetical protein ECO9602_08997 [Escherichia coli O111:H8 str.
            CVM9602]
 gb|EJE67575.1| hypothetical protein ECO10224_08096 [Escherichia coli O26:H11 str.
            CVM10224]
 gb|EJE72109.1| hypothetical protein ECO9634_10728 [Escherichia coli O111:H8 str.
            CVM9634]
 gb|EJE77133.1| hypothetical protein ECO9553_24355 [Escherichia coli O111:H11 str.
            CVM9553]
 gb|EJE84514.1| hypothetical protein ECO10021_00305 [Escherichia coli O26:H11 str.
            CVM10021]
 gb|EJE97179.1| hypothetical protein ECO9455_33177 [Escherichia coli O111:H11 str.
            CVM9455]
 gb|EJF02988.1| hypothetical protein ECO9952_10294 [Escherichia coli O26:H11 str.
            CVM9952]
 gb|EJF04970.1| hypothetical protein ECO10030_28205 [Escherichia coli O26:H11 str.
            CVM10030]
 gb|EJK94691.1| hypothetical protein ECSTECO31_3420 [Escherichia coli STEC_O31]
 gb|EJL11897.1| hypothetical protein SF660363_3649 [Shigella flexneri 6603-63]
 gb|EJL13079.1| hypothetical protein SSMOSELEY_4087 [Shigella sonnei str. Moseley]
 gb|EJZ63570.1| hypothetical protein SF148580_3501 [Shigella flexneri 1485-80]
 gb|EKG97527.1| cell division MukB-like protein [Escherichia coli PA7]
 gb|EKG99719.1| cell division MukB-like protein [Escherichia coli FRIK920]
 gb|EKH02753.1| cell division MukB-like protein [Escherichia coli PA34]
 gb|EKH12022.1| cell division MukB-like protein [Escherichia coli FDA506]
 gb|EKH15339.1| cell division MukB-like protein [Escherichia coli FDA507]
 gb|EKH23135.1| cell division MukB-like protein [Escherichia coli FDA504]
 gb|EKH29040.1| cell division MukB-like protein [Escherichia coli FRIK1999]
 gb|EKH34988.1| cell division MukB-like protein [Escherichia coli FRIK1997]
 gb|EKH39103.1| cell division MukB-like protein [Escherichia coli NE1487]
 gb|EKH45401.1| cell division MukB-like protein [Escherichia coli NE037]
 gb|EKH50863.1| cell division MukB-like protein [Escherichia coli FRIK2001]
 gb|EKH56583.1| cell division MukB-like protein [Escherichia coli PA4]
 gb|EKH65876.1| cell division MukB-like protein [Escherichia coli PA23]
 gb|EKH68230.1| cell division MukB-like protein [Escherichia coli PA49]
 gb|EKH74248.1| cell division MukB-like protein [Escherichia coli PA45]
 gb|EKH81953.1| cell division MukB-like protein [Escherichia coli TT12B]
 gb|EKH86563.1| cell division MukB-like protein [Escherichia coli MA6]
 gb|EKH90375.1| cell division MukB-like protein [Escherichia coli 5905]
 gb|EKH98835.1| cell division MukB-like protein [Escherichia coli CB7326]
 gb|EKI05054.1| cell division MukB-like protein [Escherichia coli EC96038]
 gb|EKI08304.1| cell division MukB-like protein [Escherichia coli 5412]
 gb|EKI24287.1| cell division MukB-like protein [Escherichia coli ARS4.2123]
 gb|EKI35589.1| cell division MukB-like protein [Escherichia coli 3006]
 gb|EKI39811.1| cell division MukB-like protein [Escherichia coli PA38]
 gb|EKI49120.1| cell division MukB-like protein [Escherichia coli EC1735]
 gb|EKI50144.1| cell division MukB-like protein [Escherichia coli N1]
 gb|EKI59591.1| cell division MukB-like protein [Escherichia coli EC1736]
 gb|EKI62985.1| cell division MukB-like protein [Escherichia coli EC1737]
 gb|EKI67264.1| cell division MukB-like protein [Escherichia coli EC1846]
 gb|EKI75379.1| cell division MukB-like protein [Escherichia coli EC1847]
 gb|EKI78863.1| cell division MukB-like protein [Escherichia coli EC1848]
 gb|EKI84900.1| cell division MukB-like protein [Escherichia coli EC1849]
 gb|EKI92768.1| cell division MukB-like protein [Escherichia coli EC1850]
 gb|EKI95587.1| cell division MukB-like protein [Escherichia coli EC1856]
 gb|EKJ03085.1| cell division MukB-like protein [Escherichia coli EC1862]
 gb|EKJ08641.1| cell division MukB-like protein [Escherichia coli EC1864]
 gb|EKJ13144.1| cell division MukB-like protein [Escherichia coli EC1865]
 gb|EKJ22944.1| cell division MukB-like protein [Escherichia coli EC1868]
 gb|EKJ23651.1| cell division MukB-like protein [Escherichia coli EC1866]
 gb|EKJ33411.1| cell division MukB-like protein [Escherichia coli EC1869]
 gb|EKJ38769.1| cell division MukB-like protein [Escherichia coli EC1870]
 gb|EKJ40901.1| cell division MukB-like protein [Escherichia coli NE098]
 gb|EKJ49934.1| cell division MukB-like protein [Escherichia coli FRIK523]
 gb|EKJ56557.1| cell division MukB-like protein [Escherichia coli 0.1288]
 gb|EKJ59023.1| cell division MukB-like protein [Escherichia coli 0.1304]
 gb|EKK24948.1| yqjK-like family protein [Escherichia coli 5.2239]
 gb|EKK25192.1| yqjK-like family protein [Escherichia coli 3.4870]
 gb|EKK26310.1| cell division MukB-like protein [Escherichia coli 6.0172]
 gb|EKK42208.1| yqjK-like family protein [Escherichia coli 8.0586]
 gb|EKK52874.1| cell division MukB-like protein [Escherichia coli 10.0833]
 gb|EKK55440.1| yqjK-like family protein [Escherichia coli 8.2524]
 gb|EKK64380.1| yqjK-like family protein [Escherichia coli 10.0869]
 gb|EKK69238.1| yqjK-like family protein [Escherichia coli 88.0221]
 gb|EKK73745.1| cell division MukB-like protein [Escherichia coli 8.0416]
 gb|EKK84033.1| yqjK-like family protein [Escherichia coli 10.0821]
 emb|CCK48415.1| hypothetical protein BN16_37361 [Escherichia coli chi7122]
 emb|CCJ45729.1| hypothetical protein BN17_30431 [Escherichia coli]
 gb|EKT99957.1| hypothetical protein CFSAN001632_09135 [Escherichia coli O111:H8 str.
            CFSAN001632]
 gb|EKU03468.1| hypothetical protein CFSAN001629_04282 [Escherichia coli O26:H11 str.
            CFSAN001629]
 gb|EKU06036.1| hypothetical protein CFSAN001630_06896 [Escherichia coli O111:H11
            str. CFSAN001630]
 gb|EKV73109.1| yqjK-like family protein [Escherichia coli 88.1042]
 gb|EKV74357.1| yqjK-like family protein [Escherichia coli 89.0511]
 gb|EKV76839.1| yqjK-like family protein [Escherichia coli 88.1467]
 gb|EKV88079.1| yqjK-like family protein [Escherichia coli 90.0091]
 gb|EKV91402.1| yqjK-like family protein [Escherichia coli 90.2281]
 gb|EKV94475.1| yqjK-like family protein [Escherichia coli 90.0039]
 gb|EKW07399.1| yqjK-like family protein [Escherichia coli 93.0056]
 gb|EKW07634.1| yqjK-like family protein [Escherichia coli 93.0055]
 gb|EKW11548.1| yqjK-like family protein [Escherichia coli 94.0618]
 gb|EKW24679.1| yqjK-like family protein [Escherichia coli 95.0183]
 gb|EKW25657.1| yqjK-like family protein [Escherichia coli 95.0943]
 gb|EKW28003.1| yqjK-like family protein [Escherichia coli 95.1288]
 gb|EKW39457.1| yqjK-like family protein [Escherichia coli 96.0428]
 gb|EKW42180.1| yqjK-like family protein [Escherichia coli 96.0427]
 gb|EKW45954.1| yqjK-like family protein [Escherichia coli 96.0939]
 gb|EKW53773.1| yqjK-like family protein [Escherichia coli 96.0932]
 gb|EKW60183.1| yqjK-like family protein [Escherichia coli 96.0107]
 gb|EKW62109.1| yqjK-like family protein [Escherichia coli 97.0003]
 gb|EKW72382.1| yqjK-like family protein [Escherichia coli 97.1742]
 gb|EKW75288.1| yqjK-like family protein [Escherichia coli 97.0007]
 gb|EKW79604.1| yqjK-like family protein [Escherichia coli 99.0672]
 gb|EKW87481.1| cell division MukB-like protein [Escherichia coli 99.0678]
 gb|EKW89135.1| yqjK-like family protein [Escherichia coli 99.0713]
 gb|EKY36646.1| yqjK-like family protein [Escherichia coli 96.0109]
 gb|EKY38178.1| yqjK-like family protein [Escherichia coli 97.0010]
 gb|ELB98163.1| hypothetical protein WCC_03532 [Escherichia coli KTE4]
 gb|ELC07098.1| hypothetical protein WCE_03399 [Escherichia coli KTE5]
 gb|ELC14422.1| hypothetical protein WCM_00488 [Escherichia coli KTE10]
 gb|ELC18970.1| hypothetical protein WCQ_03194 [Escherichia coli KTE12]
 gb|ELC26052.1| hypothetical protein WCY_04139 [Escherichia coli KTE16]
 gb|ELC27510.1| hypothetical protein WCU_03005 [Escherichia coli KTE15]
 gb|ELC34792.1| hypothetical protein WEI_04008 [Escherichia coli KTE25]
 gb|ELC48743.1| hypothetical protein WEO_03395 [Escherichia coli KTE28]
 gb|ELC54257.1| hypothetical protein WG9_03836 [Escherichia coli KTE39]
 gb|ELC70735.1| hypothetical protein A13K_03636 [Escherichia coli KTE187]
 gb|ELC79200.1| hypothetical protein A13M_03654 [Escherichia coli KTE188]
 gb|ELC94601.1| hypothetical protein A13W_02309 [Escherichia coli KTE193]
 gb|ELC97213.1| hypothetical protein A15C_04046 [Escherichia coli KTE201]
 gb|ELD12534.1| hypothetical protein A15M_03358 [Escherichia coli KTE206]
 gb|ELD28268.1| hypothetical protein A15Y_03372 [Escherichia coli KTE212]
 gb|ELD35117.1| hypothetical protein A173_04411 [Escherichia coli KTE214]
 gb|ELD39663.1| hypothetical protein A177_03785 [Escherichia coli KTE216]
 gb|ELD47510.1| hypothetical protein A17E_03064 [Escherichia coli KTE220]
 gb|ELD50002.1| hypothetical protein A17M_03378 [Escherichia coli KTE224]
 gb|ELD59062.1| hypothetical protein A17Y_03573 [Escherichia coli KTE230]
 gb|ELD68184.1| hypothetical protein A193_03899 [Escherichia coli KTE234]
 gb|ELD70671.1| hypothetical protein A191_01174 [Escherichia coli KTE233]
 gb|ELD79945.1| hypothetical protein A197_03444 [Escherichia coli KTE236]
 gb|ELD85006.1| hypothetical protein A199_03812 [Escherichia coli KTE237]
 gb|ELE03560.1| hypothetical protein A1SE_03940 [Escherichia coli KTE53]
 gb|ELE10232.1| hypothetical protein A1SI_04024 [Escherichia coli KTE55]
 gb|ELE21876.1| hypothetical protein A1SO_03871 [Escherichia coli KTE58]
 gb|ELE29063.1| hypothetical protein A1SS_03749 [Escherichia coli KTE60]
 gb|ELE31413.1| hypothetical protein A1SW_04110 [Escherichia coli KTE62]
 gb|ELE38123.1| hypothetical protein A1U7_04172 [Escherichia coli KTE67]
 gb|ELE40082.1| hypothetical protein A1U5_03799 [Escherichia coli KTE66]
 gb|ELE48729.1| hypothetical protein A1UG_03503 [Escherichia coli KTE72]
 gb|ELE53073.1| hypothetical protein A1UM_03808 [Escherichia coli KTE75]
 gb|ELE79045.1| hypothetical protein A1W5_03562 [Escherichia coli KTE86]
 gb|ELE87882.1| hypothetical protein A1W7_03734 [Escherichia coli KTE87]
 gb|ELE88252.1| hypothetical protein A1WE_03480 [Escherichia coli KTE93]
 gb|ELF06640.1| hypothetical protein A1Y7_03755 [Escherichia coli KTE119]
 gb|ELF10165.1| hypothetical protein A1YU_02774 [Escherichia coli KTE142]
 gb|ELF15809.1| hypothetical protein A1YW_03586 [Escherichia coli KTE143]
 gb|ELF27736.1| hypothetical protein A31I_03469 [Escherichia coli KTE162]
 gb|ELF35562.1| hypothetical protein A31M_03394 [Escherichia coli KTE169]
 gb|ELF47300.1| hypothetical protein WCI_03342 [Escherichia coli KTE8]
 gb|ELF53158.1| hypothetical protein WCK_03881 [Escherichia coli KTE9]
 gb|ELF55504.1| hypothetical protein WE1_03634 [Escherichia coli KTE17]
 gb|ELF62880.1| hypothetical protein WE3_03637 [Escherichia coli KTE18]
 gb|ELF63879.1| hypothetical protein WGK_03734 [Escherichia coli KTE45]
 gb|ELF72910.1| hypothetical protein WEE_03567 [Escherichia coli KTE23]
 gb|ELF80934.1| hypothetical protein WGG_03221 [Escherichia coli KTE43]
 gb|ELF84935.1| hypothetical protein WEQ_03000 [Escherichia coli KTE29]
 gb|ELF89877.1| hypothetical protein WEA_03046 [Escherichia coli KTE22]
 gb|ELF94578.1| hypothetical protein A1S1_03102 [Escherichia coli KTE46]
 gb|ELF96843.1| hypothetical protein A1S5_04074 [Escherichia coli KTE48]
 gb|ELG12760.1| hypothetical protein A1SQ_03793 [Escherichia coli KTE59]
 gb|ELG15563.1| hypothetical protein A1SY_03950 [Escherichia coli KTE63]
 gb|ELG23251.1| hypothetical protein A1U3_03254 [Escherichia coli KTE65]
 gb|ELG40562.1| hypothetical protein A1WA_03273 [Escherichia coli KTE91]
 gb|ELG47766.1| hypothetical protein A1WM_01981 [Escherichia coli KTE101]
 gb|ELG48463.1| hypothetical protein A1Y1_03285 [Escherichia coli KTE115]
 gb|ELG52844.1| hypothetical protein A1Y5_04175 [Escherichia coli KTE118]
 gb|ELG63528.1| hypothetical protein A1YA_00681 [Escherichia coli KTE123]
 gb|ELG67720.1| hypothetical protein A1YM_00511 [Escherichia coli KTE135]
 gb|ELG68242.1| hypothetical protein A1YO_03437 [Escherichia coli KTE136]
 gb|ELG77236.1| hypothetical protein A1YS_03609 [Escherichia coli KTE141]
 gb|ELG82088.1| hypothetical protein A1YY_02954 [Escherichia coli KTE144]
 gb|ELG92716.1| hypothetical protein A313_01863 [Escherichia coli KTE147]
 gb|ELH01385.1| hypothetical protein A317_01123 [Escherichia coli KTE154]
 gb|ELH06212.1| hypothetical protein A13U_03547 [Escherichia coli KTE192]
 gb|ELH11139.1| hypothetical protein A13Y_03691 [Escherichia coli KTE194]
 gb|ELH13387.1| hypothetical protein A31K_00508 [Escherichia coli KTE165]
 gb|ELH18669.1| hypothetical protein A133_04038 [Escherichia coli KTE173]
 gb|ELH23162.1| hypothetical protein A135_04103 [Escherichia coli KTE175]
 gb|ELH31782.1| hypothetical protein A13E_04604 [Escherichia coli KTE184]
 gb|ELH36158.1| hypothetical protein A153_03876 [Escherichia coli KTE196]
 gb|ELH41678.1| hypothetical protein A13C_02286 [Escherichia coli KTE183]
 gb|ELH48816.1| hypothetical protein A15G_04295 [Escherichia coli KTE203]
 gb|ELH59551.1| hypothetical protein A15O_03963 [Escherichia coli KTE207]
 gb|ELH67032.1| hypothetical protein A15S_01185 [Escherichia coli KTE209]
 gb|ELH69436.1| hypothetical protein A15W_03708 [Escherichia coli KTE211]
 gb|ELH72088.1| hypothetical protein A179_04014 [Escherichia coli KTE217]
 gb|ELH75806.1| hypothetical protein A175_03432 [Escherichia coli KTE215]
 gb|ELH82411.1| hypothetical protein A17A_03960 [Escherichia coli KTE218]
 gb|ELH84399.1| hypothetical protein A17K_03825 [Escherichia coli KTE223]
 gb|ELH89524.1| hypothetical protein A17S_04286 [Escherichia coli KTE227]
 gb|ELH99583.1| hypothetical protein A17W_02037 [Escherichia coli KTE229]
 gb|ELI17150.1| hypothetical protein WIA_03138 [Escherichia coli KTE109]
 gb|ELI22031.1| hypothetical protein WIC_03563 [Escherichia coli KTE112]
 gb|ELI23995.1| hypothetical protein WIE_03470 [Escherichia coli KTE113]
 gb|ELI28276.1| hypothetical protein WIG_03190 [Escherichia coli KTE117]
 gb|ELI40445.1| hypothetical protein WIM_03353 [Escherichia coli KTE124]
 gb|ELI64786.1| hypothetical protein WIU_03170 [Escherichia coli KTE131]
 gb|ELI69232.1| hypothetical protein WIW_03188 [Escherichia coli KTE133]
 gb|ELI72107.1| hypothetical protein WIY_03232 [Escherichia coli KTE137]
 gb|ELI78114.1| hypothetical protein WK1_03137 [Escherichia coli KTE138]
 gb|ELI82705.1| hypothetical protein WK3_03127 [Escherichia coli KTE139]
 gb|ELI86512.1| hypothetical protein WK5_03253 [Escherichia coli KTE145]
 gb|ELI93560.1| hypothetical protein WK7_03236 [Escherichia coli KTE148]
 gb|ELI94772.1| hypothetical protein WK9_03229 [Escherichia coli KTE150]
 gb|ELJ00498.1| hypothetical protein WKA_03192 [Escherichia coli KTE153]
 gb|ELJ09959.1| hypothetical protein WKE_03156 [Escherichia coli KTE160]
 gb|ELJ12064.1| hypothetical protein WKG_03411 [Escherichia coli KTE163]
 gb|ELJ22024.1| hypothetical protein WKI_03265 [Escherichia coli KTE166]
 gb|ELJ24697.1| hypothetical protein WKM_03008 [Escherichia coli KTE167]
 gb|ELJ26430.1| hypothetical protein WKO_03251 [Escherichia coli KTE168]
 gb|ELJ34985.1| hypothetical protein WKQ_03400 [Escherichia coli KTE174]
 gb|ELJ37684.1| hypothetical protein WKS_03199 [Escherichia coli KTE176]
 gb|ELJ50474.1| hypothetical protein WKW_03325 [Escherichia coli KTE179]
 gb|ELJ51925.1| hypothetical protein WKY_03337 [Escherichia coli KTE180]
 gb|ELJ55766.1| hypothetical protein WGQ_03266 [Escherichia coli KTE232]
 gb|ELJ68470.1| hypothetical protein WGS_02982 [Escherichia coli KTE88]
 gb|ELJ78065.1| hypothetical protein WGU_03473 [Escherichia coli KTE90]
 gb|ELJ92647.1| hypothetical protein WI1_03001 [Escherichia coli KTE97]
 gb|ELJ96494.1| hypothetical protein WI3_03257 [Escherichia coli KTE99]
 emb|CCQ00879.1| Inner membrane protein YqjK [Escherichia coli O5:K4(L):H4 str. ATCC
            23502]
 emb|CCQ06121.1| Inner membrane protein YqjK [Escherichia coli Nissle 1917]
 gb|AGC88585.1| hypothetical protein APECO78_19340 [Escherichia coli APEC O78]
 gb|ELV16440.1| yqjK-like family protein [Escherichia coli 99.0814]
 gb|ELV18009.1| yqjK-like family protein [Escherichia coli 09BKT078844]
 gb|ELV25196.1| yqjK-like family protein [Escherichia coli 99.0815]
 gb|ELV33427.1| yqjK-like family protein [Escherichia coli 99.0839]
 gb|ELV33776.1| yqjK-like family protein [Escherichia coli 99.0816]
 gb|ELV38464.1| yqjK-like family protein [Escherichia coli 99.0848]
 gb|ELV47264.1| yqjK-like family protein [Escherichia coli 99.1753]
 gb|ELV50708.1| yqjK-like family protein [Escherichia coli 99.1775]
 gb|ELV53989.1| yqjK-like family protein [Escherichia coli 99.1793]
 gb|ELV66455.1| yqjK-like family protein [Escherichia coli PA11]
 gb|ELV66551.1| yqjK-like family protein [Escherichia coli ATCC 700728]
 gb|ELV67898.1| yqjK-like family protein [Escherichia coli 99.1805]
 gb|ELV79184.1| yqjK-like family protein [Escherichia coli PA13]
 gb|ELV80208.1| yqjK-like family protein [Escherichia coli PA19]
 gb|ELV87957.1| yqjK-like family protein [Escherichia coli PA2]
 gb|ELV95362.1| yqjK-like family protein [Escherichia coli PA47]
 gb|ELV95947.1| yqjK-like family protein [Escherichia coli PA48]
 gb|ELW01959.1| yqjK-like family protein [Escherichia coli PA8]
 gb|ELW10013.1| yqjK-like family protein [Escherichia coli 7.1982]
 gb|ELW12776.1| yqjK-like family protein [Escherichia coli 99.1781]
 gb|ELW16744.1| yqjK-like family protein [Escherichia coli 99.1762]
 gb|ELW25474.1| yqjK-like family protein [Escherichia coli PA35]
 gb|ELW30875.1| yqjK-like family protein [Escherichia coli 3.4880]
 gb|ELW33656.1| yqjK-like family protein [Escherichia coli 95.0083]
 gb|ELW40567.1| yqjK-like family protein [Escherichia coli 99.0670]
 gb|EMD05228.1| hypothetical protein C202_15286 [Escherichia coli O08]
 gb|EMU59152.1| yqjK-like family protein [Escherichia coli MP021552.7]
 gb|EMU59279.1| yqjK-like family protein [Escherichia coli MP021552.11]
 gb|EMU68101.1| yqjK-like family protein [Escherichia coli MP021552.12]
 gb|EMV17795.1| yqjK-like family protein [Escherichia coli C-34666]
 gb|EMV19831.1| yqjK-like family protein [Escherichia coli BCE034_MS-14]
 gb|EMV30845.1| yqjK-like family protein [Escherichia coli BCE002_MS12]
 gb|EMV36114.1| yqjK-like family protein [Escherichia coli 2875000]
 gb|EMV44452.1| yqjK-like family protein [Escherichia coli 2872800]
 gb|EMV55509.1| yqjK-like family protein [Escherichia coli 2867750]
 gb|EMV68063.1| yqjK-like family protein [Escherichia coli 2866550]
 gb|EMV68933.1| yqjK-like family protein [Escherichia coli 2866450]
 gb|EMV72640.1| yqjK-like family protein [Escherichia coli 2866750]
 gb|EMV87646.1| yqjK-like family protein [Escherichia coli 2865200]
 gb|EMV90937.1| yqjK-like family protein [Escherichia coli 2860050]
 gb|EMV99465.1| yqjK-like family protein [Escherichia coli 2853500]
 gb|EMV99878.1| yqjK-like family protein [Escherichia coli 2851500]
 gb|EMW05299.1| yqjK-like family protein [Escherichia coli 2850750]
 gb|EMW15980.1| yqjK-like family protein [Escherichia coli 2850400]
 gb|EMW29278.1| yqjK-like family protein [Escherichia coli 2845350]
 gb|EMW40182.1| yqjK-like family protein [Escherichia coli 2788150]
 gb|EMW47692.1| yqjK-like family protein [Escherichia coli 2780750]
 gb|EMW48732.1| yqjK-like family protein [Escherichia coli 2770900]
 gb|EMW59039.1| yqjK-like family protein [Escherichia coli 2756500]
 gb|EMW72302.1| yqjK-like family protein [Escherichia coli 2747800]
 gb|EMW78004.1| yqjK-like family protein [Escherichia coli 180600]
 gb|EMW93986.1| yqjK-like family protein [Escherichia coli ThroopD]
 gb|EMW98391.1| yqjK-like family protein [Escherichia coli P0304777.1]
 gb|EMX08359.1| yqjK-like family protein [Escherichia coli P0302308.1]
 gb|EMX12790.1| yqjK-like family protein [Escherichia coli P0302293.2]
 gb|EMX18829.1| yqjK-like family protein [Escherichia coli P0301867.1]
 gb|EMX36887.1| yqjK-like family protein [Escherichia coli MP021552.8]
 gb|EMX47049.1| yqjK-like family protein [Escherichia coli MP020980.2]
 gb|EMX48742.1| yqjK-like family protein [Escherichia coli Jurua 20/10]
 gb|EMX53009.1| yqjK-like family protein [Escherichia coli MP020940.1]
 gb|EMX62075.1| yqjK-like family protein [Escherichia coli Jurua 18/11]
 gb|EMX67495.1| yqjK-like family protein [Escherichia coli Envira 10/1]
 gb|EMX67961.1| yqjK-like family protein [Escherichia coli Envira 8/11]
 gb|EMX74670.1| yqjK-like family protein [Escherichia coli 2726800]
 gb|EMX83416.1| yqjK-like family protein [Escherichia coli 2719100]
 gb|EMX87549.1| yqjK-like family protein [Escherichia coli BCE001_MS16]
 gb|EMX91114.1| yqjK-like family protein [Escherichia coli 2720900]
 gb|EMZ43494.1| hypothetical protein C827_02442 [Escherichia coli SWW33]
 gb|EMZ61870.1| yqjK-like family protein [Escherichia coli 174900]
 gb|EMZ65255.1| yqjK-like family protein [Escherichia coli 2735000]
 gb|EMZ76621.1| yqjK-like family protein [Escherichia coli 199900.1]
 gb|EMZ82065.1| yqjK-like family protein [Escherichia coli p0305293.1]
 gb|EMZ96136.1| yqjK-like family protein [Escherichia coli P0304816.1]
 gb|ENA04836.1| yqjK-like family protein [Escherichia coli P0299917.1]
 gb|ENA12214.1| yqjK-like family protein [Escherichia coli P0298942.1]
 gb|ENA38029.1| yqjK-like family protein [Escherichia coli P0301867.4]
 gb|ENA43376.1| yqjK-like family protein [Escherichia coli P0301867.2]
 gb|ENA49779.1| yqjK-like family protein [Escherichia coli 2729250]
 gb|ENA59354.1| yqjK-like family protein [Escherichia coli 178900]
 gb|ENA60940.1| yqjK-like family protein [Escherichia coli 179550]
 gb|ENA64936.1| yqjK-like family protein [Escherichia coli 180200]
 gb|ENA78608.1| yqjK-like family protein [Escherichia coli 2730350]
 gb|ENA90904.1| yqjK-like family protein [Escherichia coli 2860650]
 gb|ENA93062.1| yqjK-like family protein [Escherichia coli 2864350]
 gb|ENA93804.1| yqjK-like family protein [Escherichia coli 2862600]
 gb|ENB05388.1| yqjK-like family protein [Escherichia coli 2866350]
 gb|ENB09992.1| yqjK-like family protein [Escherichia coli 2875150]
 gb|ENB34790.1| yqjK-like family protein [Escherichia coli MP021561.3]
 gb|ENB37662.1| yqjK-like family protein [Escherichia coli P0298942.10]
 gb|ENB46162.1| yqjK-like family protein [Escherichia coli P0298942.11]
 gb|ENB52542.1| yqjK-like family protein [Escherichia coli P0298942.14]
 gb|ENB55390.1| yqjK-like family protein [Escherichia coli P0298942.12]
 gb|ENB58754.1| yqjK-like family protein [Escherichia coli P0298942.15]
 gb|ENB60803.1| yqjK-like family protein [Escherichia coli P0298942.2]
 gb|ENB68493.1| yqjK-like family protein [Escherichia coli P0298942.6]
 gb|ENB73934.1| yqjK-like family protein [Escherichia coli P0298942.8]
 gb|ENB75978.1| yqjK-like family protein [Escherichia coli P0298942.7]
 gb|ENB76129.1| yqjK-like family protein [Escherichia coli P0298942.9]
 gb|ENB93360.1| yqjK-like family protein [Escherichia coli P0299438.11]
 gb|ENB96879.1| yqjK-like family protein [Escherichia coli P0299438.3]
 gb|ENC08670.1| yqjK-like family protein [Escherichia coli P0299438.5]
 gb|ENC13403.1| yqjK-like family protein [Escherichia coli P0299438.6]
 gb|ENC14562.1| yqjK-like family protein [Escherichia coli P0299438.7]
 gb|ENC23049.1| yqjK-like family protein [Escherichia coli P0299438.8]
 gb|ENC30602.1| yqjK-like family protein [Escherichia coli P02997067.6]
 gb|ENC38554.1| yqjK-like family protein [Escherichia coli P0299917.10]
 gb|ENC45220.1| yqjK-like family protein [Escherichia coli P0299917.2]
 gb|ENC51846.1| yqjK-like family protein [Escherichia coli P0299917.3]
 gb|ENC53843.1| yqjK-like family protein [Escherichia coli P0299917.4]
 gb|ENC59211.1| yqjK-like family protein [Escherichia coli P0299917.5]
 gb|ENC69000.1| yqjK-like family protein [Escherichia coli P0299917.6]
 gb|ENC69131.1| yqjK-like family protein [Escherichia coli P0299917.8]
 gb|ENC76822.1| yqjK-like family protein [Escherichia coli P0299917.7]
 gb|ENC81678.1| yqjK-like family protein [Escherichia coli P0299917.9]
 gb|ENC89561.1| yqjK-like family protein [Escherichia coli P0301867.11]
 gb|ENC92190.1| yqjK-like family protein [Escherichia coli P0301867.8]
 gb|ENC97161.1| yqjK-like family protein [Escherichia coli P0302308.10]
 gb|END00726.1| yqjK-like family protein [Escherichia coli P0302308.11]
 gb|END08989.1| yqjK-like family protein [Escherichia coli P0302308.3]
 gb|END12176.1| yqjK-like family protein [Escherichia coli P0302308.2]
 gb|END20828.1| yqjK-like family protein [Escherichia coli P0302308.5]
 gb|END23071.1| yqjK-like family protein [Escherichia coli P0302308.4]
 gb|END31246.1| yqjK-like family protein [Escherichia coli 179100]
 gb|END37810.1| yqjK-like family protein [Escherichia coli p0305293.13]
 gb|END39088.1| yqjK-like family protein [Escherichia coli 2854350]
 gb|END39820.1| yqjK-like family protein [Escherichia coli 2733950]
 gb|END51387.1| yqjK-like family protein [Escherichia coli MP020980.1]
 gb|END63742.1| yqjK-like family protein [Escherichia coli P0298942.4]
 gb|END64712.1| yqjK-like family protein [Escherichia coli P0298942.3]
 gb|END66190.1| yqjK-like family protein [Escherichia coli P0299483.1]
 gb|END77598.1| yqjK-like family protein [Escherichia coli P0299483.2]
 gb|END80788.1| yqjK-like family protein [Escherichia coli P0299483.3]
 gb|END88940.1| yqjK-like family protein [Escherichia coli P0301867.13]
 gb|END96469.1| yqjK-like family protein [Escherichia coli P0302293.7]
 gb|ENE03837.1| yqjK-like family protein [Escherichia coli P0304799.3]
 gb|ENE18895.1| yqjK-like family protein [Escherichia coli P0302293.10]
 gb|ENE20719.1| yqjK-like family protein [Escherichia coli P0302293.3]
 gb|ENE28018.1| yqjK-like family protein [Escherichia coli P0302293.4]
 gb|ENE34630.1| yqjK-like family protein [Escherichia coli P0302293.6]
 gb|ENE39656.1| yqjK-like family protein [Escherichia coli P0302293.8]
 gb|ENE44053.1| yqjK-like family protein [Escherichia coli P0304777.10]
 gb|ENE49412.1| yqjK-like family protein [Escherichia coli P0302293.9]
 gb|ENE55120.1| yqjK-like family protein [Escherichia coli P0304777.11]
 gb|ENE62066.1| yqjK-like family protein [Escherichia coli P0304777.12]
 gb|ENE63632.1| yqjK-like family protein [Escherichia coli P0304777.13]
 gb|ENE69443.1| yqjK-like family protein [Escherichia coli P0304777.14]
 gb|ENE75344.1| yqjK-like family protein [Escherichia coli P0304777.15]
 gb|ENE79465.1| yqjK-like family protein [Escherichia coli P0304777.2]
 gb|ENE85248.1| yqjK-like family protein [Escherichia coli P0304777.3]
 gb|ENE92280.1| yqjK-like family protein [Escherichia coli P0304777.4]
 gb|ENE97942.1| yqjK-like family protein [Escherichia coli P0304777.5]
 gb|ENE98993.1| yqjK-like family protein [Escherichia coli P0304777.7]
 gb|ENF07054.1| yqjK-like family protein [Escherichia coli P0304777.8]
 gb|ENF10438.1| yqjK-like family protein [Escherichia coli P0304777.9]
 gb|ENF17954.1| yqjK-like family protein [Escherichia coli P0304816.11]
 gb|ENF22366.1| yqjK-like family protein [Escherichia coli P0304816.10]
 gb|ENF29333.1| yqjK-like family protein [Escherichia coli P0304816.12]
 gb|ENF32688.1| yqjK-like family protein [Escherichia coli P0304816.14]
 gb|ENF38571.1| yqjK-like family protein [Escherichia coli P0304816.13]
 gb|ENF45197.1| yqjK-like family protein [Escherichia coli P0304816.15]
 gb|ENF48823.1| yqjK-like family protein [Escherichia coli P0304816.2]
 gb|ENF49737.1| yqjK-like family protein [Escherichia coli P0304816.6]
 gb|ENF60801.1| yqjK-like family protein [Escherichia coli P0304816.7]
 gb|ENF66673.1| yqjK-like family protein [Escherichia coli P0304816.8]
 gb|ENF69581.1| yqjK-like family protein [Escherichia coli P0304816.9]
 gb|ENG28493.1| yqjK-like family protein [Escherichia coli p0305293.10]
 gb|ENG39723.1| yqjK-like family protein [Escherichia coli p0305293.11]
 gb|ENG40878.1| yqjK-like family protein [Escherichia coli p0305293.12]
 gb|ENG49487.1| yqjK-like family protein [Escherichia coli p0305293.15]
 gb|ENG53459.1| yqjK-like family protein [Escherichia coli p0305293.2]
 gb|ENG59527.1| yqjK-like family protein [Escherichia coli p0305293.3]
 gb|ENG62738.1| yqjK-like family protein [Escherichia coli p0305293.4]
 gb|ENG69425.1| yqjK-like family protein [Escherichia coli p0305293.8]
 gb|ENG75987.1| yqjK-like family protein [Escherichia coli p0305293.9]
 gb|ENG81319.1| yqjK-like family protein [Escherichia coli 178200]
 gb|ENG89506.1| yqjK-like family protein [Escherichia coli 178850]
 gb|ENG95011.1| yqjK-like family protein [Escherichia coli P0301867.3]
 gb|ENH00375.1| yqjK-like family protein [Escherichia coli P0301867.5]
 gb|ENH07009.1| yqjK-like family protein [Escherichia coli P0301867.7]
 gb|ENH14001.1| yqjK-like family protein [Escherichia coli P0302308.13]
 gb|ENH15542.1| yqjK-like family protein [Escherichia coli P0302308.12]
 gb|ENH18063.1| yqjK-like family protein [Escherichia coli P0302308.14]
 gb|ENH30545.1| yqjK-like family protein [Escherichia coli P0304816.3]
 gb|ENH30966.1| yqjK-like family protein [Escherichia coli P0304816.4]
 gb|ENH37679.1| yqjK-like family protein [Escherichia coli P0304816.5]
 gb|ENH43823.1| yqjK-like family protein [Escherichia coli p0305293.5]
 gb|ENH47229.1| yqjK-like family protein [Escherichia coli p0305293.6]
 gb|ENH50131.1| yqjK-like family protein [Escherichia coli p0305293.7]
 gb|ENO10950.1| hypothetical protein T22_004946 [Escherichia coli O157:H43 str. T22]
 gb|EOR51466.1| hypothetical protein K758_15367 [Escherichia coli ATCC 25922]
 gb|EOU29765.1| hypothetical protein WAW_04182 [Escherichia coli KTE7]
 gb|EOU30856.1| hypothetical protein WAY_03152 [Escherichia coli KTE13]
 gb|EOU31183.1| hypothetical protein WAU_03930 [Escherichia coli KTE3]
 gb|EOU69809.1| hypothetical protein WEG_03855 [Escherichia coli KTE24]
 gb|EOU74605.1| hypothetical protein WEM_04035 [Escherichia coli KTE27]
 gb|EOU88178.1| hypothetical protein WG3_03845 [Escherichia coli KTE36]
 gb|EOU89147.1| hypothetical protein WG5_04001 [Escherichia coli KTE37]
 gb|EOV03064.1| hypothetical protein WG7_03862 [Escherichia coli KTE38]
 gb|EOV09888.1| hypothetical protein WGA_03116 [Escherichia coli KTE40]
 gb|EOV24271.1| hypothetical protein A159_02894 [Escherichia coli KTE199]
 gb|EOV34960.1| hypothetical protein A17G_03598 [Escherichia coli KTE221]
 gb|EOV42789.1| hypothetical protein A17I_00541 [Escherichia coli KTE222]
 gb|EOV55046.1| hypothetical protein A1U1_03317 [Escherichia coli KTE64]
 gb|EOV62430.1| hypothetical protein A1UA_03787 [Escherichia coli KTE69]
 gb|EOV70765.1| hypothetical protein A1UC_03912 [Escherichia coli KTE70]
 gb|EOV76104.1| hypothetical protein A1UI_03382 [Escherichia coli KTE73]
 gb|EOV87246.1| hypothetical protein A1UK_03526 [Escherichia coli KTE74]
 gb|EOV87461.1| hypothetical protein A1W9_03193 [Escherichia coli KTE89]
 gb|EOW01083.1| hypothetical protein A1WI_01864 [Escherichia coli KTE98]
 gb|EOW02475.1| hypothetical protein A1WO_04612 [Escherichia coli KTE102]
 gb|EOW03369.1| hypothetical protein A1WK_04185 [Escherichia coli KTE100]
 gb|EOW19514.1| hypothetical protein A1WS_03824 [Escherichia coli KTE107]
 gb|EOW28809.1| hypothetical protein A1Y9_02875 [Escherichia coli KTE121]
 gb|EOW93185.1| hypothetical protein WGC_03801 [Escherichia coli KTE41]
 gb|EOX06886.1| hypothetical protein A17Q_03365 [Escherichia coli KTE226]
 gb|EOX09609.1| hypothetical protein A19A_03328 [Escherichia coli KTE240]
 gb|EPH50551.1| Inner membrane protein YqjK [Escherichia coli E2265]
 emb|CDC81713.1| putative uncharacterized protein ECs3982 [Escherichia coli CAG:4]
 gb|EQN00657.1| hypothetical protein G682_03470 [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN03259.1| hypothetical protein G683_03262 [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN12575.1| hypothetical protein G681_00162 [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN16746.1| hypothetical protein G685_04004 [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN30806.1| hypothetical protein G687_03295 [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN44552.1| hypothetical protein G691_03429 [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN46562.1| hypothetical protein G692_03284 [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN60062.1| hypothetical protein G696_03279 [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN63140.1| hypothetical protein G694_03253 [Escherichia coli HVH 18 (4-8589585)]
 gb|EQN93765.1| hypothetical protein G703_03229 [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO06718.1| hypothetical protein G704_03300 [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO14489.1| hypothetical protein G706_03135 [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO15309.1| hypothetical protein G707_03257 [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO20773.1| hypothetical protein G708_03290 [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO27532.1| hypothetical protein G709_04161 [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO30297.1| hypothetical protein G710_03327 [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO36228.1| hypothetical protein G712_03421 [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO40257.1| hypothetical protein G714_03249 [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO44541.1| hypothetical protein G713_03315 [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO50856.1| hypothetical protein G715_03147 [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO58663.1| hypothetical protein G716_03379 [Escherichia coli HVH 41 (4-2677849)]
 gb|EQO59147.1| hypothetical protein G717_03476 [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO82893.1| hypothetical protein G722_03244 [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO84153.1| hypothetical protein G721_03164 [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO89972.1| hypothetical protein G724_03326 [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO96508.1| hypothetical protein G727_03492 [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP02986.1| hypothetical protein G725_00860 [Escherichia coli HVH 53 (4-0631051)]
 gb|EQP05694.1| hypothetical protein G728_03062 [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP08156.1| hypothetical protein G729_03404 [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP15877.1| hypothetical protein G730_03249 [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP18251.1| hypothetical protein G731_03092 [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP34123.1| hypothetical protein G734_03425 [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP48510.1| hypothetical protein G737_03460 [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP48876.1| hypothetical protein G738_03353 [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP59809.1| hypothetical protein G739_03315 [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP68180.1| hypothetical protein G740_03142 [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP84816.1| hypothetical protein G743_00161 [Escherichia coli HVH 80 (4-2428830)]
 gb|EQP90477.1| hypothetical protein G744_01014 [Escherichia coli HVH 82 (4-2209276)]
 gb|EQQ02064.1| hypothetical protein G749_03611 [Escherichia coli HVH 87 (4-5977630)]
 gb|EQQ03421.1| hypothetical protein G751_03321 [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ19067.1| hypothetical protein G753_03156 [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ22145.1| hypothetical protein G754_03326 [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ24570.1| hypothetical protein G756_03400 [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ36363.1| hypothetical protein G757_03474 [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ38249.1| hypothetical protein G763_03570 [Escherichia coli HVH 102
            (4-6906788)]
 gb|EQQ40052.1| hypothetical protein G761_01688 [Escherichia coli HVH 100
            (4-2850729)]
 gb|EQQ47726.1| hypothetical protein G765_03460 [Escherichia coli HVH 104
            (4-6977960)]
 gb|EQQ49563.1| hypothetical protein G764_03414 [Escherichia coli HVH 103
            (4-5904188)]
 gb|EQQ69816.1| hypothetical protein G770_03505 [Escherichia coli HVH 109
            (4-6977162)]
 gb|EQQ85382.1| hypothetical protein G773_03220 [Escherichia coli HVH 112
            (4-5987253)]
 gb|EQQ86570.1| hypothetical protein G775_03260 [Escherichia coli HVH 114
            (4-7037740)]
 gb|EQQ96649.1| hypothetical protein G777_04078 [Escherichia coli HVH 115
            (4-4465989)]
 gb|EQR00081.1| hypothetical protein G776_03445 [Escherichia coli HVH 115
            (4-4465997)]
 gb|EQR05004.1| hypothetical protein G778_03294 [Escherichia coli HVH 116
            (4-6879942)]
 gb|EQR12751.1| hypothetical protein G779_03483 [Escherichia coli HVH 117
            (4-6857191)]
 gb|EQR16198.1| hypothetical protein G780_03303 [Escherichia coli HVH 118
            (4-7345399)]
 gb|EQR26275.1| hypothetical protein G782_03224 [Escherichia coli HVH 120
            (4-6978681)]
 gb|EQR35805.1| hypothetical protein G783_03381 [Escherichia coli HVH 121
            (4-6877826)]
 gb|EQR46032.1| hypothetical protein G786_03467 [Escherichia coli HVH 126
            (4-6034225)]
 gb|EQR51921.1| hypothetical protein G787_03284 [Escherichia coli HVH 127
            (4-7303629)]
 gb|EQR64037.1| hypothetical protein G790_03268 [Escherichia coli HVH 132
            (4-6876862)]
 gb|EQR86718.1| hypothetical protein G795_03076 [Escherichia coli HVH 137
            (4-2124971)]
 gb|EQR94604.1| hypothetical protein G797_03227 [Escherichia coli HVH 139
            (4-3192644)]
 gb|EQS15285.1| hypothetical protein G800_03338 [Escherichia coli HVH 142
            (4-5627451)]
 gb|EQS16439.1| hypothetical protein G802_03523 [Escherichia coli HVH 144
            (4-4451937)]
 gb|EQS31546.1| hypothetical protein G805_03288 [Escherichia coli HVH 147
            (4-5893887)]
 gb|EQS37633.1| hypothetical protein G807_03156 [Escherichia coli HVH 149
            (4-4451880)]
 gb|EQS47363.1| hypothetical protein G811_03318 [Escherichia coli HVH 153
            (3-9344314)]
 gb|EQS53338.1| hypothetical protein G808_03214 [Escherichia coli HVH 150
            (4-3258106)]
 gb|EQS70408.1| hypothetical protein G819_01351 [Escherichia coli HVH 161
            (4-3119890)]
 gb|EQS93962.1| hypothetical protein G824_03315 [Escherichia coli HVH 169
            (4-1075578)]
 gb|EQT02133.1| hypothetical protein G825_03435 [Escherichia coli HVH 170
            (4-3026949)]
 gb|EQT08664.1| hypothetical protein G827_03363 [Escherichia coli HVH 172
            (4-3248542)]
 gb|EQT26017.1| hypothetical protein G833_03387 [Escherichia coli HVH 180
            (4-3051617)]
 gb|EQT47551.1| hypothetical protein G837_03272 [Escherichia coli HVH 185
            (4-2876639)]
 gb|EQT67367.1| hypothetical protein G839_00310 [Escherichia coli HVH 187
            (4-4471660)]
 gb|EQT70585.1| hypothetical protein G842_00895 [Escherichia coli HVH 190
            (4-3255514)]
 gb|EQT75314.1| hypothetical protein G843_03370 [Escherichia coli HVH 191
            (3-9341900)]
 gb|EQT81750.1| hypothetical protein G844_03336 [Escherichia coli HVH 192
            (4-3054470)]
 gb|EQT92257.1| hypothetical protein G847_03126 [Escherichia coli HVH 195
            (3-7155360)]
 gb|EQT99826.1| hypothetical protein G848_03128 [Escherichia coli HVH 196
            (4-4530470)]
 gb|EQU08640.1| hypothetical protein G850_03205 [Escherichia coli HVH 198
            (4-3206106)]
 gb|EQU10006.1| hypothetical protein G851_03319 [Escherichia coli HVH 199
            (4-5670322)]
 gb|EQU20996.1| hypothetical protein G853_03346 [Escherichia coli HVH 201
            (4-4459431)]
 gb|EQU21525.1| hypothetical protein G852_03586 [Escherichia coli HVH 200
            (4-4449924)]
 gb|EQU32599.1| hypothetical protein G855_03166 [Escherichia coli HVH 203
            (4-3126218)]
 gb|EQU39854.1| hypothetical protein G856_03069 [Escherichia coli HVH 204
            (4-3112802)]
 gb|EQU52855.1| hypothetical protein G859_03389 [Escherichia coli HVH 207
            (4-3113221)]
 gb|EQU68433.1| hypothetical protein G863_03328 [Escherichia coli HVH 211
            (4-3041891)]
 gb|EQU71229.1| hypothetical protein G864_03298 [Escherichia coli HVH 212
            (3-9305343)]
 gb|EQU91125.1| hypothetical protein G869_03411 [Escherichia coli HVH 217
            (4-1022806)]
 gb|EQU92186.1| hypothetical protein G868_03223 [Escherichia coli HVH 216
            (4-3042952)]
 gb|EQU98767.1| hypothetical protein G870_03268 [Escherichia coli HVH 218
            (4-4500903)]
 gb|EQV05634.1| hypothetical protein G872_03066 [Escherichia coli HVH 221
            (4-3136817)]
 gb|EQV06615.1| hypothetical protein G871_03205 [Escherichia coli HVH 220
            (4-5876842)]
 gb|EQV12180.1| hypothetical protein G873_03237 [Escherichia coli HVH 222
            (4-2977443)]
 gb|EQV23953.1| hypothetical protein G876_03370 [Escherichia coli HVH 227
            (4-2277670)]
 gb|EQV30970.1| hypothetical protein G881_03251 [Escherichia coli KOEGE 30 (63a)]
 gb|EQV43723.1| hypothetical protein G882_00773 [Escherichia coli KOEGE 32 (66a)]
 gb|EQV44720.1| hypothetical protein G883_03156 [Escherichia coli KOEGE 33 (68a)]
 gb|EQV51846.1| hypothetical protein G884_00661 [Escherichia coli KOEGE 40 (102a)]
 gb|EQV52429.1| hypothetical protein G885_03310 [Escherichia coli KOEGE 43 (105a)]
 gb|EQV55495.1| hypothetical protein G886_03284 [Escherichia coli KOEGE 44 (106a)]
 gb|EQV64998.1| hypothetical protein G889_03469 [Escherichia coli KOEGE 61 (174a)]
 gb|EQV66660.1| hypothetical protein G888_03173 [Escherichia coli KOEGE 58 (171a)]
 gb|EQV81969.1| hypothetical protein G892_03219 [Escherichia coli KOEGE 70 (185a)]
 gb|EQW08138.1| hypothetical protein G896_00680 [Escherichia coli KOEGE 118 (317a)]
 gb|EQW10682.1| hypothetical protein G897_03261 [Escherichia coli KOEGE 131 (358a)]
 gb|EQW15739.1| hypothetical protein G898_03238 [Escherichia coli UMEA 3014-1]
 gb|EQW16992.1| hypothetical protein G899_03282 [Escherichia coli UMEA 3022-1]
 gb|EQW29129.1| hypothetical protein G902_03408 [Escherichia coli UMEA 3052-1]
 gb|EQW29739.1| hypothetical protein G900_01804 [Escherichia coli UMEA 3033-1]
 gb|EQW30279.1| hypothetical protein G901_03241 [Escherichia coli UMEA 3041-1]
 gb|EQW39254.1| hypothetical protein G903_03301 [Escherichia coli UMEA 3053-1]
 gb|EQW41434.1| hypothetical protein G904_03438 [Escherichia coli UMEA 3065-1]
 gb|EQW49144.1| hypothetical protein G905_03350 [Escherichia coli UMEA 3087-1]
 gb|EQW53245.1| hypothetical protein G907_03103 [Escherichia coli UMEA 3097-1]
 gb|EQW64544.1| hypothetical protein G908_03192 [Escherichia coli UMEA 3108-1]
 gb|EQW64935.1| hypothetical protein G909_03250 [Escherichia coli UMEA 3113-1]
 gb|EQW77018.1| hypothetical protein G911_03375 [Escherichia coli UMEA 3121-1]
 gb|EQW79331.1| hypothetical protein G910_00160 [Escherichia coli UMEA 3117-1]
 gb|EQW85025.1| hypothetical protein G913_03134 [Escherichia coli UMEA 3124-1]
 gb|EQX04974.1| hypothetical protein G921_03180 [Escherichia coli UMEA 3155-1]
 gb|EQX06910.1| hypothetical protein G915_01132 [Escherichia coli UMEA 3140-1]
 gb|EQX08169.1| hypothetical protein G922_03329 [Escherichia coli UMEA 3159-1]
 gb|EQX16827.1| hypothetical protein G924_03450 [Escherichia coli UMEA 3161-1]
 gb|EQX17102.1| hypothetical protein G923_03312 [Escherichia coli UMEA 3160-1]
 gb|EQX26027.1| hypothetical protein G925_03337 [Escherichia coli UMEA 3162-1]
 gb|EQX30449.1| hypothetical protein G926_03280 [Escherichia coli UMEA 3163-1]
 gb|EQX31503.1| hypothetical protein G927_03317 [Escherichia coli UMEA 3172-1]
 gb|EQX40865.1| hypothetical protein G930_03312 [Escherichia coli UMEA 3175-1]
 gb|EQX41907.1| hypothetical protein G928_03246 [Escherichia coli UMEA 3173-1]
 gb|EQX54165.1| hypothetical protein G931_03236 [Escherichia coli UMEA 3176-1]
 gb|EQX55057.1| hypothetical protein G932_03444 [Escherichia coli UMEA 3178-1]
 gb|EQX67395.1| hypothetical protein G935_04905 [Escherichia coli UMEA 3190-1]
 gb|EQX98200.1| hypothetical protein G940_03358 [Escherichia coli UMEA 3203-1]
 gb|EQX98750.1| hypothetical protein G941_03330 [Escherichia coli UMEA 3206-1]
 gb|EQY04269.1| hypothetical protein G939_00165 [Escherichia coli UMEA 3201-1]
 gb|EQY09038.1| hypothetical protein G942_03212 [Escherichia coli UMEA 3208-1]
 gb|EQY20263.1| hypothetical protein G945_03151 [Escherichia coli UMEA 3216-1]
 gb|EQY26394.1| hypothetical protein G946_03242 [Escherichia coli UMEA 3217-1]
 gb|EQY30722.1| hypothetical protein G947_03340 [Escherichia coli UMEA 3220-1]
 gb|EQY42229.1| hypothetical protein G949_03419 [Escherichia coli UMEA 3222-1]
 gb|EQY53339.1| hypothetical protein G951_03412 [Escherichia coli UMEA 3233-1]
 gb|EQY57506.1| hypothetical protein G952_03239 [Escherichia coli UMEA 3240-1]
 gb|EQY65344.1| hypothetical protein G956_03450 [Escherichia coli UMEA 3264-1]
 gb|EQY68534.1| hypothetical protein G955_03232 [Escherichia coli UMEA 3257-1]
 gb|EQY74561.1| hypothetical protein G957_03447 [Escherichia coli UMEA 3268-1]
 gb|EQY81169.1| hypothetical protein G962_02756 [Escherichia coli UMEA 3304-1]
 gb|EQY85764.1| hypothetical protein G963_03226 [Escherichia coli UMEA 3314-1]
 gb|EQY97298.1| hypothetical protein G969_03348 [Escherichia coli UMEA 3337-1]
 gb|EQZ09261.1| hypothetical protein G970_03241 [Escherichia coli UMEA 3341-1]
 gb|EQZ11918.1| hypothetical protein G972_03422 [Escherichia coli UMEA 3355-1]
 gb|EQZ15768.1| hypothetical protein G973_03328 [Escherichia coli UMEA 3391-1]
 gb|EQZ22424.1| hypothetical protein G976_03345 [Escherichia coli UMEA 3490-1]
 gb|EQZ31910.1| hypothetical protein G977_00604 [Escherichia coli UMEA 3585-1]
 gb|EQZ36603.1| hypothetical protein G980_03176 [Escherichia coli UMEA 3617-1]
 gb|EQZ49377.1| hypothetical protein G981_03204 [Escherichia coli UMEA 3632-1]
 gb|EQZ51654.1| hypothetical protein G983_03153 [Escherichia coli UMEA 3656-1]
 gb|EQZ54781.1| hypothetical protein G984_03392 [Escherichia coli UMEA 3662-1]
 gb|EQZ63046.1| hypothetical protein G986_03203 [Escherichia coli UMEA 3682-1]
 gb|EQZ63657.1| hypothetical protein G985_03237 [Escherichia coli UMEA 3671-1]
 gb|EQZ68793.1| hypothetical protein G987_03451 [Escherichia coli UMEA 3687-1]
 gb|EQZ73572.1| hypothetical protein G989_03498 [Escherichia coli UMEA 3694-1]
 gb|EQZ76431.1| hypothetical protein G990_03108 [Escherichia coli UMEA 3702-1]
 gb|EQZ87553.1| hypothetical protein G993_03232 [Escherichia coli UMEA 3707-1]
 gb|EQZ90376.1| hypothetical protein G992_03041 [Escherichia coli UMEA 3705-1]
 gb|EQZ98179.1| hypothetical protein G994_03327 [Escherichia coli UMEA 3718-1]
 gb|ERA03856.1| hypothetical protein G995_03338 [Escherichia coli UMEA 3805-1]
 gb|ERA06377.1| hypothetical protein G996_03467 [Escherichia coli UMEA 3821-1]
 gb|ERA17596.1| hypothetical protein G997_03437 [Escherichia coli UMEA 3834-1]
 gb|ERA19526.1| hypothetical protein G999_03296 [Escherichia coli UMEA 3893-1]
 gb|ERA43552.1| hypothetical protein H004_03399 [Escherichia coli UMEA 4207-1]
 gb|ERA56671.1| membrane protein [Escherichia coli 95NR1]
 gb|ERA70184.1| hypothetical protein G814_03333 [Escherichia coli HVH 156
            (4-3206505)]
 gb|ERA71558.1| hypothetical protein G815_03285 [Escherichia coli HVH 157
            (4-3406229)]
 gb|ERA76246.1| hypothetical protein G817_03456 [Escherichia coli HVH 159
            (4-5818141)]
 gb|ERA83580.1| hypothetical protein G818_03303 [Escherichia coli HVH 160
            (4-5695937)]
 gb|ERA88138.1| hypothetical protein G862_03333 [Escherichia coli HVH 210
            (4-3042480)]
 gb|ERB02673.1| hypothetical protein G879_03191 [Escherichia coli KOEGE 7 (16a)]
 gb|ERB17489.1| hypothetical protein G919_03267 [Escherichia coli UMEA 3151-1]
 gb|ERB31786.1| hypothetical protein G961_03389 [Escherichia coli UMEA 3298-1]
 gb|ERB33184.1| hypothetical protein G960_03405 [Escherichia coli UMEA 3292-1]
 gb|ERB70615.1| yqjK-like family protein [Escherichia coli B102]
 gb|ERB71282.1| yqjK-like family protein [Escherichia coli B107]
 gb|ERB73805.1| yqjK-like family protein [Escherichia coli 09BKT076207]
 gb|ERB81712.1| yqjK-like family protein [Escherichia coli B26-1]
 gb|ERB88787.1| yqjK-like family protein [Escherichia coli B26-2]
 gb|ERB95443.1| yqjK-like family protein [Escherichia coli B28-2]
 gb|ERB95728.1| yqjK-like family protein [Escherichia coli B28-1]
 gb|ERC03910.1| yqjK-like family protein [Escherichia coli B29-1]
 gb|ERC11417.1| yqjK-like family protein [Escherichia coli B29-2]
 gb|ERC15581.1| yqjK-like family protein [Escherichia coli B36-1]
 gb|ERC18808.1| yqjK-like family protein [Escherichia coli B36-2]
 gb|ERC27848.1| yqjK-like family protein [Escherichia coli B7-1]
 gb|ERC32828.1| yqjK-like family protein [Escherichia coli B7-2]
 gb|ERC37549.1| yqjK-like family protein [Escherichia coli B93]
 gb|ERC43121.1| yqjK-like family protein [Escherichia coli B94]
 gb|ERC49716.1| yqjK-like family protein [Escherichia coli B95]
 gb|ERC55306.1| yqjK-like family protein [Escherichia coli TW07509]
 gb|ERC58039.1| yqjK-like family protein [Escherichia coli 08BKT055439]
 gb|ERC63966.1| yqjK-like family protein [Escherichia coli Bd5610_99]
 gb|ERC68185.1| yqjK-like family protein [Escherichia coli T1840_97]
 gb|ERC76812.1| yqjK-like family protein [Escherichia coli T234_00]
 gb|ERC83431.1| yqjK-like family protein [Escherichia coli T924_01]
 gb|ERC93322.1| yqjK-like family protein [Escherichia coli 2886-75]
 gb|ERC96971.1| yqjK-like family protein [Escherichia coli B103]
 gb|ERC97219.1| yqjK-like family protein [Escherichia coli B104]
 gb|ERD07816.1| yqjK-like family protein [Escherichia coli B105]
 gb|ERD12628.1| yqjK-like family protein [Escherichia coli B106]
 gb|ERD12962.1| yqjK-like family protein [Escherichia coli B108]
 gb|ERD24925.1| yqjK-like family protein [Escherichia coli B109]
 gb|ERD26542.1| yqjK-like family protein [Escherichia coli B112]
 gb|ERD30751.1| yqjK-like family protein [Escherichia coli B113]
 gb|ERD39240.1| yqjK-like family protein [Escherichia coli B114]
 gb|ERD42899.1| yqjK-like family protein [Escherichia coli B15]
 gb|ERD47895.1| yqjK-like family protein [Escherichia coli B17]
 gb|ERD57227.1| yqjK-like family protein [Escherichia coli B40-2]
 gb|ERD59105.1| yqjK-like family protein [Escherichia coli B40-1]
 gb|ERD61534.1| yqjK-like family protein [Escherichia coli B49-2]
 gb|ERD70297.1| yqjK-like family protein [Escherichia coli B5-2]
 gb|ERD75396.1| yqjK-like family protein [Escherichia coli B83]
 gb|ERD78826.1| yqjK-like family protein [Escherichia coli B84]
 gb|ERD86116.1| yqjK-like family protein [Escherichia coli B85]
 gb|ERD90709.1| yqjK-like family protein [Escherichia coli B86]
 gb|ERD98272.1| membrane protein [Escherichia coli 95JB1]
 gb|ERE02219.1| yqjK-like family protein [Escherichia coli 08BKT77219]
 gb|ERE12903.1| yqjK-like family protein [Escherichia coli 09BKT024447]
 gb|ERE16645.1| yqjK-like family protein [Escherichia coli T1282_01]
 gb|ERE24298.1| yqjK-like family protein [Escherichia coli B89]
 gb|ERE27083.1| yqjK-like family protein [Escherichia coli B90]
 gb|ERE32057.1| yqjK-like family protein [Escherichia coli Tx1686]
 gb|ERE39527.1| yqjK-like family protein [Escherichia coli Tx3800]
 gb|ERF53032.1| hypothetical protein G982_02254 [Escherichia coli UMEA 3652-1]
 gb|ERF92044.1| membrane protein [Escherichia coli O104:H21 str. CFSAN002237]
 gb|AGW10207.1| membrane protein [Escherichia coli LY180]
 emb|CDH66772.1| hypothetical protein ECOPMV1_03417 [Escherichia coli PMV-1]
 gb|ESA65480.1| hypothetical protein HMPREF1589_04105 [Escherichia coli 113290]
 gb|ESA66203.1| hypothetical protein HMPREF1591_02145 [Escherichia coli 113303]
 gb|ESA75159.1| hypothetical protein HMPREF1592_03321 [Escherichia coli 907357]
 gb|ESA87389.1| hypothetical protein HMPREF1620_04343 [Escherichia coli 909945-2]
 gb|ESC94891.1| hypothetical protein HMPREF1590_03416 [Escherichia coli 113302]
 gb|ESC99308.1| hypothetical protein HMPREF1594_01616 [Escherichia coli 907446]
 gb|ESC99665.1| hypothetical protein HMPREF1593_01336 [Escherichia coli 907391]
 gb|ESD11401.1| hypothetical protein HMPREF1595_00749 [Escherichia coli 907672]
 gb|ESD19577.1| hypothetical protein HMPREF1598_03158 [Escherichia coli 907710]
 gb|ESD38096.1| hypothetical protein HMPREF1604_03554 [Escherichia coli 908519]
 gb|ESD38933.1| hypothetical protein HMPREF1603_01667 [Escherichia coli 907892]
 gb|ESD63144.1| hypothetical protein HMPREF1608_05041 [Escherichia coli 908525]
 gb|ESD69676.1| hypothetical protein HMPREF1610_02501 [Escherichia coli 908555]
 gb|ESD77910.1| hypothetical protein HMPREF1609_00893 [Escherichia coli 908541]
 gb|ESE09479.1| hypothetical protein HMPREF1617_04879 [Escherichia coli 908675]
 gb|ESE30646.1| hypothetical protein HMPREF1621_04332 [Escherichia coli A25922R]
 gb|ESE33455.1| hypothetical protein HMPREF1622_03097 [Escherichia coli A35218R]
 gb|ESK01297.1| hypothetical protein G759_03437 [Escherichia coli HVH 98 (4-5799287)]
 gb|ESK04606.1| hypothetical protein G968_03107 [Escherichia coli UMEA 3336-1]
 gb|ESK13413.1| hypothetical protein G974_03809 [Escherichia coli UMEA 3426-1]
 gb|ESK15324.1| hypothetical protein G959_03230 [Escherichia coli UMEA 3290-1]
 gb|ESK15878.1| hypothetical protein G723_01021 [Escherichia coli HVH 50 (4-2593475)]
 gb|ESK27216.1| hypothetical protein G971_03431 [Escherichia coli UMEA 3342-1]
 gb|ESM34277.1| hypothetical protein L403_03346 [Escherichia coli BWH 32]
 gb|ESP07448.1| hypothetical protein G711_03693 [Escherichia coli HVH 36 (4-5675286)]
 gb|ESP16174.1| hypothetical protein G690_03105 [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP19002.1| hypothetical protein G748_03446 [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP30203.1| hypothetical protein G832_03237 [Escherichia coli HVH 178
            (4-3189163)]
 gb|ESP35156.1| hypothetical protein G810_03014 [Escherichia coli HVH 152
            (4-3447545)]
 gb|ESP37930.1| hypothetical protein G806_00190 [Escherichia coli HVH 148
            (4-3192490)]
 gb|ESP42602.1| hypothetical protein G769_03140 [Escherichia coli HVH 108
            (4-6924867)]
 gb|ESS90867.1| Inner membrane protein YqjK [Escherichia coli CE516]
 gb|EST68322.1| hypothetical protein M13_13060 [Escherichia coli P4-96]
 gb|EST69239.1| hypothetical protein MOI_13944 [Escherichia coli P4-NR]
 gb|EST86253.1| hypothetical protein ECC1470_05904 [Escherichia coli ECC-1470]
 gb|ESV02753.1| Inner membrane protein YqjK [Escherichia coli E1777]
 gb|ETD63620.1| membrane protein [Escherichia coli ATCC BAA-2209]
 gb|ETE13692.1| membrane protein [Escherichia coli LAU-EC6]
 gb|ETE17309.1| membrane protein [Escherichia coli LAU-EC10]
 gb|ETF25066.1| hypothetical protein G699_01794 [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF29086.1| hypothetical protein G745_00260 [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF32076.1| hypothetical protein G866_02181 [Escherichia coli HVH 214
            (4-3062198)]
 gb|ETF34975.1| hypothetical protein G975_02468 [Escherichia coli UMEA 3489-1]
 gb|ETI76221.1| membrane protein [Escherichia coli ATCC BAA-2196]
 gb|ETJ57379.1| membrane protein [Escherichia coli ATCC BAA-2193]
 gb|ETJ69509.1| membrane protein [Escherichia coli ATCC 35150]
 gb|ETJ77036.1| membrane protein [Escherichia coli ATCC BAA-2192]
 emb|CDK47887.1| Inner membrane protein YqjK [Escherichia coli IS1]
 emb|CDL27351.1| Inner membrane protein YqjK [Escherichia coli ISC7]
 emb|CDK76715.1| Inner membrane protein YqjK [Klebsiella pneumoniae IS22]
 emb|CDK59136.1| Inner membrane protein YqjK [Escherichia coli IS9]
 gb|AHG16494.1| Inner membrane protein YqjK [Escherichia coli O145:H28 str. RM13516]
 gb|AHG10720.1| Inner membrane protein YqjK [Escherichia coli O145:H28 str. RM13514]
 gb|ETY55294.1| hypothetical protein P811_01890 [Escherichia coli BIDMC 49b]
 gb|ETY58434.1| hypothetical protein P810_01879 [Escherichia coli BIDMC 49a]
 gb|EWC56527.1| hypothetical protein G654_05980 [Escherichia coli EC096/10]
 gb|EWY54323.1| membrane protein [Escherichia coli MP1]
 gb|AHM29805.1| membrane protein [Escherichia coli]
 gb|AHM33058.1| membrane protein [Escherichia coli]
 gb|AHM37661.1| membrane protein [Escherichia coli]
 gb|EYB43355.1| membrane protein [Escherichia coli]
 gb|EYB50600.1| membrane protein [Escherichia coli]
 gb|EYB57021.1| membrane protein [Escherichia coli]
 gb|EYB61488.1| membrane protein [Escherichia coli]
 gb|EYE00521.1| yqjK-like family protein [Escherichia coli 1-110-08_S4_C1]
 gb|EYE11117.1| yqjK-like family protein [Escherichia coli 1-110-08_S3_C3]
 gb|EYE18697.1| yqjK-like family protein [Escherichia coli 1-110-08_S3_C2]
 gb|EYE21373.1| yqjK-like family protein [Escherichia coli 1-110-08_S3_C1]
 gb|EYE34804.1| yqjK-like family protein [Escherichia coli 1-110-08_S1_C2]
 gb|EYT08900.1| hypothetical protein T654_02726 [Escherichia coli K02]
 gb|EYU82810.1| membrane protein [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU84637.1| membrane protein [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU88046.1| membrane protein [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU95273.1| membrane protein [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYU97795.1| membrane protein [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYV14699.1| membrane protein [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV15984.1| membrane protein [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV21624.1| membrane protein [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV25062.1| membrane protein [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV27477.1| membrane protein [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV42679.1| membrane protein [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV50818.1| membrane protein [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV51463.1| membrane protein [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV54619.1| membrane protein [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV58828.1| membrane protein [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYV64088.1| membrane protein [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYV68848.1| membrane protein [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV74247.1| membrane protein [Escherichia coli O157:H7 str. K5806]
 gb|EYV92362.1| membrane protein [Escherichia coli O157:H7 str. F7350]
 gb|EYV95707.1| membrane protein [Escherichia coli O86:H34 str. 99-3124]
 gb|EYW01879.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2312]
 gb|EYW07121.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2288]
 gb|EYW10081.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2289]
 gb|EYW17835.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2287]
 gb|EYW19749.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2286]
 gb|EYW21587.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2114]
 gb|EYW32219.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2113]
 gb|EYW32963.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2112]
 gb|EYW40540.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2111]
 gb|EYW44028.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2109]
 gb|EYW54231.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2107]
 gb|EYW54383.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2108]
 gb|EYW65618.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2106]
 gb|EYW66201.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2105]
 gb|EYW68366.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2104]
 gb|EYW73058.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2103]
 gb|EYW75053.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2101]
 gb|EYW84336.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2099]
 gb|EYW90298.1| membrane protein [Escherichia coli O111:NM str. 08-4487]
 gb|EYW94929.1| membrane protein [Escherichia coli O157:H7 str. 08-4169]
 gb|EYW96229.1| membrane protein [Escherichia coli O145:NM str. 08-4270]
 gb|EYW98090.1| membrane protein [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX11202.1| membrane protein [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX13327.1| membrane protein [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX21260.1| membrane protein [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX23273.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2098]
 gb|EYX23670.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2097]
 gb|EYX35041.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2096]
 gb|EYX41570.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2093]
 gb|EYX43869.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2094]
 gb|EYX46805.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2092]
 gb|EYX57848.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2091]
 gb|EYX60406.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2090]
 gb|EYX67408.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-1107]
 gb|EYX74914.1| membrane protein [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX77527.1| membrane protein [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX83682.1| membrane protein [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYX86164.1| membrane protein [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX94262.1| membrane protein [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYY08600.1| membrane protein [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY18233.1| membrane protein [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY43446.1| membrane protein [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYY48118.1| membrane protein [Escherichia coli O165:H25 str. 2010C-4874]
 gb|EYY66253.1| membrane protein [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY66468.1| membrane protein [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY76967.1| membrane protein [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY77759.1| membrane protein [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY83489.1| membrane protein [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY97242.1| membrane protein [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYY98945.1| membrane protein [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYZ06419.1| membrane protein [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ11432.1| membrane protein [Escherichia coli O103:H25 str. 2010C-4529]
 gb|EYZ18990.1| membrane protein [Escherichia coli O145:NM str. 2010C-4557C2]
 gb|EYZ24492.1| membrane protein [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ31320.1| membrane protein [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ34040.1| membrane protein [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ36888.1| membrane protein [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ43892.1| membrane protein [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ53462.1| membrane protein [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ61461.1| membrane protein [Escherichia coli O79:H7 str. 06-3501]
 gb|EYZ63434.1| membrane protein [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ64683.1| membrane protein [Escherichia coli O55:H7 str. 06-3555]
 gb|EYZ73302.1| membrane protein [Escherichia coli O145:NM str. 06-3484]
 gb|EYZ77417.1| membrane protein [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ88368.1| membrane protein [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ90828.1| membrane protein [Escherichia coli O118:H16 str. 06-3256]
 gb|EZA02050.1| membrane protein [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA03823.1| membrane protein [Escherichia coli O111:NM str. 03-3484]
 gb|EZA19884.1| membrane protein [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA25527.1| membrane protein [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA39056.1| membrane protein [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA42521.1| membrane protein [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA65177.1| membrane protein [Escherichia coli O104:H21 str. 94-3025]
 gb|EZA82501.1| membrane protein [Escherichia coli O111:H8 str. F6627]
 gb|EZA90180.1| membrane protein [Escherichia coli O157:H7 str. F6142]
 gb|EZB02348.1| membrane protein [Escherichia coli O157:H7 str. F6750]
 gb|EZB03166.1| membrane protein [Escherichia coli O157:H7 str. F6749]
 gb|EZB07257.1| membrane protein [Escherichia coli O157:H7 str. F6751]
 gb|EZB13716.1| membrane protein [Escherichia coli O157:H7 str. F7384]
 gb|EZB15361.1| membrane protein [Escherichia coli O157:H7 str. F7377]
 gb|EZB30460.1| membrane protein [Escherichia coli O157:H7 str. F7410]
 gb|EZB35136.1| membrane protein [Escherichia coli O157:H7 str. G5303]
 gb|EZB42005.1| membrane protein [Escherichia coli O157:H7 str. H2498]
 gb|EZB44412.1| membrane protein [Escherichia coli O157:H7 str. H2495]
 gb|EZB47443.1| membrane protein [Escherichia coli O157:H7 str. K1420]
 gb|EZB57680.1| membrane protein [Escherichia coli O157:H7 str. K1793]
 gb|EZB60210.1| membrane protein [Escherichia coli O157:H7 str. K1792]
 gb|EZB62611.1| membrane protein [Escherichia coli O157:H7 str. K1795]
 gb|EZB65188.1| membrane protein [Escherichia coli O157:H7 str. K1796]
 gb|EZB66759.1| membrane protein [Escherichia coli O157:H7 str. K1845]
 gb|EZB90258.1| membrane protein [Escherichia coli O157:H7 str. K1927]
 gb|EZB90978.1| membrane protein [Escherichia coli O157:H7 str. K1921]
 gb|EZB92947.1| membrane protein [Escherichia coli O157:H7 str. K2192]
 gb|EZB93031.1| membrane protein [Escherichia coli O157:H7 str. K2188]
 gb|EZC01026.1| membrane protein [Escherichia coli O157:H7 str. K2191]
 gb|EZC07100.1| membrane protein [Escherichia coli O157:H7 str. K2324]
 gb|EZC07250.1| membrane protein [Escherichia coli O157:H7 str. K2581]
 gb|EZC12109.1| membrane protein [Escherichia coli O157:H7 str. K2845]
 gb|EZC17334.1| membrane protein [Escherichia coli O157:H7 str. K2622]
 gb|EZC19511.1| membrane protein [Escherichia coli O157:H7 str. K2854]
 gb|EZC26030.1| membrane protein [Escherichia coli O157:H7 str. K4396]
 gb|EZC27837.1| membrane protein [Escherichia coli O157:H7 str. K4405]
 gb|EZC42080.1| membrane protein [Escherichia coli O157:H7 str. K4527]
 gb|EZC42398.1| membrane protein [Escherichia coli O157:H7 str. K4406]
 gb|EZC60933.1| membrane protein [Escherichia coli O157:H7 str. K5418]
 gb|EZC61238.1| membrane protein [Escherichia coli O157:H7 str. K5448]
 gb|EZC69918.1| membrane protein [Escherichia coli O157:H7 str. K5453]
 gb|EZC76914.1| membrane protein [Escherichia coli O157:H7 str. K5449]
 gb|EZC82827.1| membrane protein [Escherichia coli O157:H7 str. K5460]
 gb|EZC84537.1| membrane protein [Escherichia coli O157:H7 str. K5602]
 gb|EZC87381.1| membrane protein [Escherichia coli O157:H7 str. K5467]
 gb|EZC92714.1| membrane protein [Escherichia coli O157:H7 str. K5607]
 gb|EZC93552.1| membrane protein [Escherichia coli O157:H7 str. K5609]
 gb|EZD00995.1| membrane protein [Escherichia coli O157:H7 str. K6590]
 gb|EZD06925.1| membrane protein [Escherichia coli O157:H7 str. K5852]
 gb|EZD14094.1| membrane protein [Escherichia coli O157:H7 str. K6676]
 gb|EZD14917.1| membrane protein [Escherichia coli O157:H7 str. K6590]
 gb|EZD26331.1| membrane protein [Escherichia coli O157:H7 str. K6687]
 gb|EZD28533.1| membrane protein [Escherichia coli O111:NM str. K6723]
 gb|EZD31006.1| membrane protein [Escherichia coli O111:NM str. K6722]
 gb|EZD40160.1| membrane protein [Escherichia coli O111:NM str. K6728]
 gb|EZD44487.1| membrane protein [Escherichia coli O111:NM str. K6890]
 gb|EZD46811.1| membrane protein [Escherichia coli O111:NM str. K6895]
 gb|EZD53927.1| membrane protein [Escherichia coli O111:NM str. K6897]
 gb|EZD59260.1| membrane protein [Escherichia coli O111:NM str. K6898]
 gb|EZD60637.1| membrane protein [Escherichia coli O111:NM str. K6908]
 gb|EZD63628.1| membrane protein [Escherichia coli O111:NM str. K6904]
 gb|EZD71340.1| membrane protein [Escherichia coli O157:H7 str. K7140]
 gb|EZD71747.1| membrane protein [Escherichia coli O111:NM str. K6915]
 gb|EZD82251.1| membrane protein [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD84341.1| membrane protein [Escherichia coli O39:NM str. F8704-2]
 gb|EZD89318.1| membrane protein [Escherichia coli O157:NM str. 08-4540]
 gb|EZD92407.1| membrane protein [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZD97944.1| membrane protein [Escherichia coli O145:H28 str. 2009C-3292]
 gb|EZE02797.1| membrane protein [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE08086.1| membrane protein [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE13512.1| membrane protein [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE25278.1| membrane protein [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE30162.1| membrane protein [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE36769.1| membrane protein [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE44583.1| membrane protein [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE52485.1| membrane protein [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE58012.1| membrane protein [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZE60123.1| membrane protein [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE64956.1| membrane protein [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE66859.1| membrane protein [Escherichia coli O91:H21 str. 2009C-4646]
 gb|EZE76950.1| membrane protein [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZE87062.1| membrane protein [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZE96265.1| membrane protein [Escherichia coli O145:NM str. 2010C-3508]
 gb|EZF07044.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2290]
 gb|EZF07315.1| membrane protein [Escherichia coli O157:H7 str. 2011EL-2313]
 gb|EZG30721.1| membrane protein [Escherichia coli E1728]
 gb|EZG47822.1| membrane protein [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG53871.1| membrane protein [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG61883.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG65219.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG74742.1| membrane protein [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG75099.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG85705.1| membrane protein [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG88899.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG91177.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZG97252.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZH01099.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZH16716.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH18304.1| membrane protein [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH18658.1| membrane protein [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH26836.1| membrane protein [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH31671.1| membrane protein [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH32414.1| membrane protein [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH41219.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH44149.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH50215.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH54645.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH58259.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZJ18354.1| yqjK-like family protein [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ27199.1| yqjK-like family protein [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ34885.1| yqjK-like family protein [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ40274.1| yqjK-like family protein [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ52316.1| yqjK-like family protein [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ59789.1| yqjK-like family protein [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ70651.1| yqjK-like family protein [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ81810.1| yqjK-like family protein [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ83319.1| yqjK-like family protein [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ90475.1| yqjK-like family protein [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ94064.1| yqjK-like family protein [Escherichia coli 1-182-04_S1_C3]
 gb|EZK12324.1| yqjK-like family protein [Escherichia coli 2-005-03_S1_C3]
 gb|EZK20123.1| yqjK-like family protein [Escherichia coli 2-011-08_S1_C2]
 gb|EZK28718.1| yqjK-like family protein [Escherichia coli 1-182-04_S1_C1]
 gb|EZK30995.1| yqjK-like family protein [Escherichia coli 2-005-03_S1_C2]
 gb|EZK41724.1| yqjK-like family protein [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ25640.1| membrane protein [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ31790.1| membrane protein [Escherichia coli O111:H8 str. 2009EL-2169]
 gb|EZQ34828.1| membrane protein [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ44692.1| membrane protein [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ45461.1| membrane protein [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ46787.1| membrane protein [Escherichia coli O111:H8 str. 2011C-3453]
 gb|EZQ52718.1| membrane protein [Escherichia coli O157: str. 2010EL-2044]
 gb|AHY66817.1| Inner membrane protein YqjK [Escherichia coli O145:H28 str. RM12761]
 gb|AHY72540.1| Inner membrane protein YqjK [Escherichia coli O145:H28 str. RM12581]
 gb|KDA56552.1| yqjK-like family protein [Escherichia coli 2-011-08_S1_C1]
 gb|KDA62429.1| yqjK-like family protein [Escherichia coli 2-052-05_S1_C1]
 gb|KDA66931.1| yqjK-like family protein [Escherichia coli 1-182-04_S1_C2]
 gb|KDF65911.1| hypothetical protein AE34_03660 [Escherichia coli BIDMC 59]
 gb|KDF96507.1| hypothetical protein AE40_03293 [Escherichia coli BIDMC 65]
 gb|KDG20231.1| hypothetical protein AE49_02447 [Escherichia coli BIDMC 74]
 gb|KDG54877.1| hypothetical protein AF33_03405 [Escherichia coli CHS 77]
 gb|KDG62072.1| hypothetical protein AF43_03552 [Escherichia coli MGH 57]
 gb|KDG76599.1| hypothetical protein AE12_02996 [Escherichia coli UCI 53]
 gb|KDG83945.1| hypothetical protein AE16_02980 [Escherichia coli UCI 57]
 gb|KDG87751.1| hypothetical protein AE17_02932 [Escherichia coli UCI 58]
 gb|KDG95016.1| hypothetical protein AE25_03215 [Escherichia coli UCI 66]
 gb|KDM71951.1| membrane protein [Escherichia coli]
 gb|KDM80070.1| membrane protein [Escherichia coli]
 gb|KDM83109.1| membrane protein [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM89102.1| membrane protein [Escherichia coli]
 gb|KDO89119.1| membrane protein [Escherichia coli]
 gb|KDT04486.1| yqjK-like family protein [Escherichia coli 2-011-08_S4_C1]
 gb|KDT11556.1| yqjK-like family protein [Escherichia coli 2-052-05_S1_C3]
 gb|KDT16647.1| yqjK-like family protein [Escherichia coli 2-011-08_S4_C3]
 gb|KDT63441.1| yqjK-like family protein [Escherichia coli 3-267-03_S1_C3]
 gb|KDT84973.1| yqjK-like family protein [Escherichia coli 3-475-03_S1_C1]
 gb|KDT97746.1| yqjK-like family protein [Escherichia coli 3-267-03_S3_C2]
 gb|KDU17076.1| yqjK-like family protein [Escherichia coli 3-105-05_S3_C3]
 gb|KDU20300.1| yqjK-like family protein [Escherichia coli 3-267-03_S1_C1]
 gb|KDU27261.1| yqjK-like family protein [Escherichia coli 3-267-03_S4_C2]
 gb|KDV15548.1| membrane protein [Escherichia coli O111:NM str. 01-3076]
 gb|KDV18951.1| membrane protein [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV33856.1| membrane protein [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV36729.1| membrane protein [Escherichia coli O145:H25 str. 07-3858]
 gb|KDV41259.1| membrane protein [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV44911.1| membrane protein [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDV58328.1| membrane protein [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV63523.1| membrane protein [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV68957.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDV74616.1| membrane protein [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV80749.1| yqjK-like family protein [Escherichia coli 2-052-05_S4_C2]
 gb|KDV99022.1| yqjK-like family protein [Escherichia coli 2-156-04_S3_C1]
 gb|KDW00215.1| yqjK-like family protein [Escherichia coli 2-156-04_S1_C3]
 gb|KDW14459.1| yqjK-like family protein [Escherichia coli 2-177-06_S3_C1]
 gb|KDW17212.1| yqjK-like family protein [Escherichia coli 2-177-06_S1_C1]
 gb|KDW17650.1| yqjK-like family protein [Escherichia coli 2-156-04_S4_C1]
 gb|KDW29513.1| yqjK-like family protein [Escherichia coli 2-156-04_S3_C2]
 gb|KDW30428.1| yqjK-like family protein [Escherichia coli 2-177-06_S1_C2]
 gb|KDW38881.1| yqjK-like family protein [Escherichia coli 2-177-06_S1_C3]
 gb|KDW40924.1| yqjK-like family protein [Escherichia coli 2-177-06_S4_C2]
 gb|KDW60157.1| yqjK-like family protein [Escherichia coli 2-005-03_S3_C1]
 gb|KDW69006.1| yqjK-like family protein [Escherichia coli 2-005-03_S3_C3]
 gb|KDW75376.1| yqjK-like family protein [Escherichia coli 1-392-07_S1_C1]
 gb|KDW84433.1| yqjK-like family protein [Escherichia coli 1-392-07_S1_C2]
 gb|KDW90107.1| yqjK-like family protein [Escherichia coli 2-210-07_S4_C1]
 gb|KDX02078.1| yqjK-like family protein [Escherichia coli 2-210-07_S3_C2]
 gb|KDX24120.1| yqjK-like family protein [Escherichia coli 2-156-04_S4_C2]
 gb|KDX39350.1| yqjK-like family protein [Escherichia coli 2-156-04_S4_C3]
 gb|KDX58448.1| yqjK-like family protein [Escherichia coli 2-210-07_S4_C2]
 gb|KDX63913.1| yqjK-like family protein [Escherichia coli 2-210-07_S4_C3]
 gb|KDX69172.1| yqjK-like family protein [Escherichia coli 2-222-05_S1_C1]
 gb|KDX76924.1| yqjK-like family protein [Escherichia coli 2-222-05_S1_C2]
 gb|KDX80771.1| yqjK-like family protein [Escherichia coli 2-222-05_S1_C3]
 gb|KDX94491.1| yqjK-like family protein [Escherichia coli 2-222-05_S4_C2]
 gb|KDY01346.1| yqjK-like family protein [Escherichia coli 2-316-03_S3_C2]
 gb|KDY05804.1| yqjK-like family protein [Escherichia coli 2-316-03_S3_C3]
 gb|KDY27319.1| yqjK-like family protein [Escherichia coli 2-427-07_S1_C2]
 gb|KDY30969.1| yqjK-like family protein [Escherichia coli 2-427-07_S3_C3]
 gb|KDY34129.1| yqjK-like family protein [Escherichia coli 2-427-07_S3_C1]
 gb|KDY93974.1| yqjK-like family protein [Escherichia coli 2-427-07_S1_C3]
 gb|KDZ06159.1| yqjK-like family protein [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ12060.1| yqjK-like family protein [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ26232.1| yqjK-like family protein [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ29004.1| yqjK-like family protein [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ35116.1| yqjK-like family protein [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ44708.1| yqjK-like family protein [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ52961.1| yqjK-like family protein [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ75606.1| yqjK-like family protein [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ94751.1| yqjK-like family protein [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ08061.1| yqjK-like family protein [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ08318.1| yqjK-like family protein [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ10463.1| yqjK-like family protein [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ28506.1| yqjK-like family protein [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ44764.1| yqjK-like family protein [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ58742.1| yqjK-like family protein [Escherichia coli 3-267-03_S4_C1]
 gb|KEJ72863.1| yqjK-like family protein [Escherichia coli 5-366-08_S1_C3]
 gb|KEK79461.1| yqjK-like family protein [Escherichia coli 3-475-03_S3_C1]
 gb|KEK85289.1| yqjK-like family protein [Escherichia coli 3-475-03_S1_C2]
 gb|KEK89251.1| yqjK-like family protein [Escherichia coli 3-475-03_S3_C2]
 gb|KEL69532.1| yqjK-like family protein [Escherichia coli 5-366-08_S1_C1]
 gb|KEL87112.1| yqjK-like family protein [Escherichia coli 5-366-08_S3_C2]
 gb|KEM11808.1| yqjK-like family protein [Escherichia coli 6-319-05_S1_C2]
 gb|KEM24953.1| yqjK-like family protein [Escherichia coli 6-319-05_S1_C3]
 gb|KEM38943.1| yqjK-like family protein [Escherichia coli 6-537-08_S1_C1]
 gb|KEM51340.1| yqjK-like family protein [Escherichia coli 6-175-07_S1_C3]
 gb|KEM74584.1| yqjK-like family protein [Escherichia coli 6-537-08_S3_C1]
 gb|KEM82143.1| yqjK-like family protein [Escherichia coli 6-537-08_S3_C3]
 gb|KEM88138.1| yqjK-like family protein [Escherichia coli 2-222-05_S4_C1]
 gb|KEN00029.1| yqjK-like family protein [Escherichia coli 6-319-05_S1_C1]
 gb|KEN11277.1| yqjK-like family protein [Escherichia coli 7-233-03_S4_C2]
 gb|KEN16065.1| yqjK-like family protein [Escherichia coli 6-537-08_S3_C2]
 gb|KEN31880.1| yqjK-like family protein [Escherichia coli 8-415-05_S3_C3]
 gb|KEN38497.1| yqjK-like family protein [Escherichia coli 8-415-05_S3_C1]
 gb|KEN46239.1| yqjK-like family protein [Escherichia coli 6-537-08_S1_C2]
 gb|KEN53013.1| yqjK-like family protein [Escherichia coli 6-537-08_S1_C3]
 gb|KEN65187.1| yqjK-like family protein [Escherichia coli 1-392-07_S4_C3]
 gb|KEN70225.1| yqjK-like family protein [Escherichia coli 8-415-05_S3_C2]
 gb|KEN83591.1| yqjK-like family protein [Escherichia coli 2-474-04_S4_C1]
 gb|KEN97905.1| yqjK-like family protein [Escherichia coli 1-392-07_S4_C1]
 gb|KEO14884.1| yqjK-like family protein [Escherichia coli 2-222-05_S4_C3]
 gb|KEO28015.1| yqjK-like family protein [Escherichia coli 2-460-02_S1_C1]
 gb|KEO29557.1| yqjK-like family protein [Escherichia coli 1-250-04_S3_C2]
 gb|AID80243.1| membrane protein [Escherichia coli Nissle 1917]
 gb|KEO96987.1| membrane protein [Escherichia coli]
 gb|KEP00594.1| membrane protein [Escherichia coli]
 gb|KEP02760.1| membrane protein [Escherichia coli]
 gb|KEP09193.1| membrane protein [Escherichia coli]
 gb|KEP77934.1| membrane protein [Escherichia coli E1140]
 gb|AIF95648.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. SS17]
 gb|AIG70473.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. EDL933]
 gb|KFB96625.1| inner membrane protein [Escherichia coli DSM 30083 = JCM 1649 = ATCC
            11775]
 gb|KFH80485.1| membrane protein [Escherichia coli]
 gb|KFH84331.1| membrane protein [Escherichia coli]
 gb|KFH91018.1| membrane protein [Escherichia coli]
 gb|AIL17433.1| yqjK-like family protein [Escherichia coli ATCC 25922]
 gb|KFV24146.1| membrane protein [Escherichia coli]
 gb|KFV30981.1| membrane protein [Escherichia coli]
 gb|KFV32873.1| membrane protein [Escherichia coli]
 gb|KFV34830.1| membrane protein [Escherichia coli]
 gb|KGI48876.1| Inner membrane protein YqjK [Escherichia coli]
 gb|AIT36272.1| membrane protein [Escherichia coli FAP1]
 gb|KHG73722.1| membrane protein [Escherichia coli]
 gb|KHG76395.1| membrane protein [Escherichia coli]
 gb|KHG81388.1| membrane protein [Escherichia coli]
 gb|KHG86622.1| membrane protein [Escherichia coli]
 gb|KHG93380.1| membrane protein [Escherichia coli]
 gb|KHG97597.1| membrane protein [Escherichia coli]
 gb|KHG98680.1| membrane protein [Escherichia coli]
 gb|KHH06488.1| membrane protein [Escherichia coli]
 gb|KHH10623.1| membrane protein [Escherichia coli]
 gb|KHH19855.1| membrane protein [Escherichia coli]
 gb|KHH23884.1| membrane protein [Escherichia coli]
 gb|KHH29272.1| membrane protein [Escherichia coli]
 gb|KHH32221.1| membrane protein [Escherichia coli]
 gb|KHH32960.1| membrane protein [Escherichia coli]
 gb|KHH43085.1| membrane protein [Escherichia coli]
 gb|KHH45245.1| membrane protein [Escherichia coli]
 gb|KHH58124.1| membrane protein [Escherichia coli]
 gb|KHH60876.1| membrane protein [Escherichia coli]
 gb|KHH72289.1| membrane protein [Escherichia coli]
 gb|KHH78496.1| membrane protein [Escherichia coli]
 gb|KHH85172.1| membrane protein [Escherichia coli]
 gb|KHH99524.1| membrane protein [Escherichia coli]
 gb|KHI02169.1| membrane protein [Escherichia coli]
 gb|KHI11868.1| membrane protein [Escherichia coli]
 gb|KHI34069.1| membrane protein [Escherichia coli]
 gb|KHI36618.1| membrane protein [Escherichia coli]
 gb|KHI38358.1| membrane protein [Escherichia coli]
 gb|KHI41356.1| membrane protein [Escherichia coli]
 gb|KHI44767.1| membrane protein [Escherichia coli]
 gb|KHI58131.1| membrane protein [Escherichia coli]
 gb|KHI62310.1| membrane protein [Escherichia coli]
 gb|KHI66155.1| membrane protein [Escherichia coli]
 gb|KHI72033.1| membrane protein [Escherichia coli]
 gb|KHI73411.1| membrane protein [Escherichia coli]
 gb|KHI77977.1| membrane protein [Escherichia coli]
 gb|KHI87808.1| membrane protein [Escherichia coli]
 gb|KHI99232.1| membrane protein [Escherichia coli]
 gb|KHJ01301.1| membrane protein [Escherichia coli]
 gb|KHJ03411.1| membrane protein [Escherichia coli]
 gb|KHJ04799.1| membrane protein [Escherichia coli]
 gb|KHJ13861.1| membrane protein [Escherichia coli]
 gb|KHJ14508.1| membrane protein [Escherichia coli]
 gb|KHJ23477.1| membrane protein [Escherichia coli]
 gb|KHJ26251.1| membrane protein [Escherichia coli]
 gb|AIZ84167.1| membrane protein [Escherichia coli]
 gb|AIZ88744.1| membrane protein [Escherichia coli]
 gb|AJA28104.1| Inner membrane protein YqjK [Escherichia coli O157:H7 str. SS52]
 gb|KHO60551.1| membrane protein [Escherichia coli]
 emb|CEK06994.1| conserved hypothetical protein [Escherichia coli O26:H11]
 gb|AJB36329.1| membrane protein [Escherichia coli APEC IMT5155]
 gb|KIE68245.1| membrane protein [Escherichia coli]
 gb|KIE72602.1| membrane protein [Escherichia coli]
 gb|KIE82267.1| membrane protein [Escherichia coli RS218]
 gb|KIG24806.1| membrane protein [Escherichia coli C691-71 (14b)]
 gb|KIG30493.1| membrane protein [Escherichia coli]
 gb|KIG37987.1| membrane protein [Escherichia coli]
 gb|KIG52868.1| membrane protein [Escherichia coli]
 gb|KIG58012.1| membrane protein [Escherichia coli]
 gb|KIG59428.1| membrane protein [Escherichia coli]
 gb|KIG68888.1| membrane protein [Escherichia coli]
 gb|KIG74851.1| membrane protein [Escherichia coli]
 gb|KIG86757.1| membrane protein [Escherichia coli]
 gb|KIG91314.1| membrane protein [Escherichia coli]
 gb|KIH16164.1| membrane protein [Escherichia coli]
 gb|KIH25812.1| membrane protein [Escherichia coli]
 gb|KIH27361.1| membrane protein [Escherichia coli]
 gb|KIH30002.1| membrane protein [Escherichia coli]
 gb|KIH36671.1| membrane protein [Escherichia coli]
 gb|KII09779.1| membrane protein [Escherichia coli]
 gb|AJF78227.1| membrane protein [Escherichia coli]
 gb|KIN85690.1| membrane protein [Escherichia coli]
 gb|AJG10126.1| PHB family membrane protein [Escherichia coli ECC-1470]
 gb|KIO41156.1| membrane protein [Escherichia coli O139:H28 str. E24377A]
 gb|AJH11743.1| membrane protein [Escherichia coli]
 gb|KIO85275.1| hypothetical protein EC970264_3526 [Escherichia coli 97.0264]
 gb|KIQ39083.1| membrane protein [Escherichia coli]
 gb|KIQ45014.1| membrane protein [Escherichia coli]
 gb|AJM75325.1| membrane protein [Escherichia coli RS218]
 gb|KIY27935.1| membrane protein [Escherichia coli]
 gb|KIZ08139.1| membrane protein [Escherichia coli]
 gb|KIZ69355.1| membrane protein [Escherichia coli]
 gb|KJG99067.1| membrane protein [Escherichia coli]
 gb|KJH07587.1| membrane protein [Escherichia coli]
 gb|KJJ47413.1| membrane protein [Escherichia coli]
 gb|KJJ80416.1| PHB family membrane protein [Escherichia coli]
 gb|KJW28477.1| membrane protein [Escherichia coli]
 gb|KJW31510.1| membrane protein [Escherichia coli]
 gb|KJW48496.1| membrane protein [Escherichia coli]
 gb|KJW51234.1| membrane protein [Escherichia coli]
 gb|KJW57015.1| membrane protein [Escherichia coli]
 gb|KJW64098.1| membrane protein [Escherichia coli]
 gb|KJW68870.1| membrane protein [Escherichia coli]
 gb|KJW73241.1| membrane protein [Escherichia coli]
 gb|KKA58752.1| hypothetical protein EC91649_3374 [Escherichia coli 9.1649]
 gb|AKC14727.1| membrane protein [Escherichia coli]
 gb|KKF76510.1| membrane protein [Escherichia coli O157:H7]
 gb|KKF83577.1| membrane protein [Escherichia coli O157:H7]
 gb|KKJ11351.1| membrane protein [Escherichia coli MRSN 10204]
 gb|KKK31403.1| membrane protein [Escherichia coli]
 gb|KKO26821.1| membrane protein [Escherichia coli]
 gb|KKO29983.1| membrane protein [Escherichia coli]
 gb|KKO31164.1| membrane protein [Escherichia coli]
 gb|KKO39078.1| membrane protein [Escherichia coli]
 gb|KKY46089.1| membrane protein [Escherichia coli O157:H7]
 gb|AKH23796.1| membrane protein [Escherichia coli]
 gb|KLD46246.1| membrane protein [Escherichia coli]
 gb|KLG34199.1| membrane protein [Escherichia coli]
 gb|KLG37117.1| membrane protein [Escherichia coli]
 gb|KLG44563.1| membrane protein [Escherichia coli]
 gb|KLG45590.1| membrane protein [Escherichia coli]
 gb|KLG54789.1| membrane protein [Escherichia coli]
 gb|KLG57487.1| membrane protein [Escherichia coli]
 gb|KLG63950.1| membrane protein [Escherichia coli]
 gb|KLG67745.1| membrane protein [Escherichia coli]
 gb|KLG73336.1| membrane protein [Escherichia coli]
 gb|KLG79051.1| membrane protein [Escherichia coli]
 gb|KLG84833.1| membrane protein [Escherichia coli]
 gb|KLG88695.1| membrane protein [Escherichia coli]
 gb|KLG89900.1| membrane protein [Escherichia coli]
 gb|KLG97166.1| membrane protein [Escherichia coli]
 gb|KLH06168.1| membrane protein [Escherichia coli]
 gb|KLH07274.1| membrane protein [Escherichia coli]
 gb|KLH16032.1| membrane protein [Escherichia coli]
 gb|KLH16373.1| membrane protein [Escherichia coli]
 gb|KLH22186.1| membrane protein [Escherichia coli]
 gb|KLH28278.1| membrane protein [Escherichia coli]
 gb|KLH45955.1| membrane protein [Escherichia coli]
 gb|KLH48034.1| membrane protein [Escherichia coli]
 gb|KLH55274.1| membrane protein [Escherichia coli]
 gb|KLH60479.1| membrane protein [Escherichia coli]
 gb|KLH68704.1| membrane protein [Escherichia coli]
 gb|KLH68897.1| membrane protein [Escherichia coli]
 gb|KLH74804.1| membrane protein [Escherichia coli]
 gb|KLH77966.1| membrane protein [Escherichia coli]
 gb|KLH87470.1| membrane protein [Escherichia coli]
 gb|KLH90882.1| membrane protein [Escherichia coli]
 gb|KLH95690.1| membrane protein [Escherichia coli]
 gb|AKI67991.1| membrane protein [Shigella boydii]
 gb|AKK49946.1| Putative inner membrane protein [Escherichia coli PCN033]
 gb|AKK37088.1| membrane protein [Escherichia coli APEC O18]
 gb|AKK44286.1| membrane protein [Escherichia coli]
 gb|KLX15323.1| hypothetical protein SK69_02522 [Escherichia coli]
 gb|KLX43976.1| hypothetical protein SK76_03664 [Escherichia coli]
 gb|KLX48761.1| hypothetical protein SK75_00598 [Escherichia coli]
 gb|KLX69698.1| hypothetical protein SK80_01777 [Escherichia coli]
 gb|KLX74190.1| hypothetical protein SK81_03057 [Escherichia coli]
 gb|KLY00497.1| hypothetical protein SK87_03391 [Escherichia coli]
 gb|AKN48982.1| membrane protein [Escherichia coli]
 gb|AKP86081.1| putative inner membrane protein [Escherichia coli ACN001]
 gb|KMV38376.1| membrane protein [Escherichia coli]
 gb|KMV43599.1| membrane protein [Escherichia coli]
 gb|KMV46618.1| membrane protein [Escherichia coli]
 gb|KMV48419.1| membrane protein [Escherichia coli]
 gb|KMV57537.1| membrane protein [Escherichia coli]
 emb|CTD29724.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD27951.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP98227.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD19968.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS32972.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD18264.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR79129.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP21187.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ59394.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ71073.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP58310.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP36626.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG54873.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD09076.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP81724.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG37624.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ54215.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF01464.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP88975.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE43670.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC99779.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ34267.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ54252.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN96591.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR96305.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI19551.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP44775.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR65865.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO33877.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR00753.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR21642.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE67304.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE37278.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE82569.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN91374.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE55468.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ18585.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN87204.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ08557.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR84826.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO05623.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP59080.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG62437.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF42529.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF68183.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO25061.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF27728.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ86619.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP46010.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP12266.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ67787.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR05393.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE61502.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ18772.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE99294.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR48429.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD02643.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR63613.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR10386.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ39860.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE90711.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG12681.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE99517.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG06156.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG44087.1| Uncharacterised protein [Shigella sonnei]
 emb|CST20540.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF38526.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO81017.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE86941.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ41795.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS44431.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE92081.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP37634.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ60567.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO50784.1| Uncharacterised protein [Shigella sonnei]
 emb|CST64798.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO77050.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG28623.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ97828.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP47830.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG48525.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN82585.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP97909.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR71887.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR35231.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS03348.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN09873.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ77833.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO39623.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN27231.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP06970.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP32538.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE33105.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO04847.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO40867.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP17693.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO23358.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL03290.1| Uncharacterised protein [Shigella sonnei]
 emb|CST66034.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR77393.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE58497.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF21526.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN47012.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO51337.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP49993.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO97410.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN79157.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP22415.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU16069.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ43919.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO80861.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO97745.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ78324.1| Uncharacterised protein [Shigella sonnei]
 emb|CST57621.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP65679.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM97192.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG13952.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ19298.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ71083.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP91810.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK38906.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK09043.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR72277.1| Uncharacterised protein [Shigella sonnei]
 emb|CST10838.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS37449.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ23756.1| Uncharacterised protein [Shigella sonnei]
 emb|CST31539.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW71104.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO92324.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN16770.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE99385.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL91581.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF31973.1| Uncharacterised protein [Shigella sonnei]
 emb|CTP72101.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF65969.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV29333.1| Uncharacterised protein [Shigella sonnei]
 emb|CST40191.1| Uncharacterised protein [Shigella sonnei]
 emb|CST11738.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW24175.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL59417.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG15895.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF54218.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW11796.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO06582.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL57111.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO74624.1| Uncharacterised protein [Shigella sonnei]
 emb|CST22260.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ22807.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO58899.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU16902.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE41975.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP99492.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS39678.1| Uncharacterised protein [Shigella sonnei]
 emb|CST20420.1| Uncharacterised protein [Shigella sonnei]
 emb|CST93956.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF67788.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO43402.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR47935.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR89397.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW08263.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG17318.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF72079.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG66355.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN54009.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP80365.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP00903.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM52336.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI97825.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW80069.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE31607.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV75345.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC55691.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF66844.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC62732.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX55111.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF98001.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ80296.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA26141.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW70982.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL50327.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS27116.1| Uncharacterised protein [Shigella sonnei]
 emb|CST40819.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV23789.1| Uncharacterised protein [Shigella sonnei]
 emb|CTP73949.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF94022.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS20140.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR66848.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS80066.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF89354.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM36741.1| Uncharacterised protein [Shigella sonnei]
 emb|CST74124.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS58807.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN60607.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ84051.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL77528.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ10941.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV24266.1| Uncharacterised protein [Shigella sonnei]
 emb|CST77422.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH00546.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV99571.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV85129.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV61870.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL97599.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW93277.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ08757.1| Uncharacterised protein [Shigella sonnei]
 emb|CST33957.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX09321.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS21690.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY64963.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU64809.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ96633.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL35017.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW62569.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS13949.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY39554.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ75387.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO17394.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF70137.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX38571.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV86174.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ65067.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK72622.1| Uncharacterised protein [Shigella sonnei]
 emb|CST00163.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV70601.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL45326.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU21982.1| Uncharacterised protein [Shigella sonnei]
 emb|CTP72163.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI79708.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO18089.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW79591.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH01865.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY30627.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK88693.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS46627.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA02061.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL32126.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW35492.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV35545.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ93227.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF80303.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU27096.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX84481.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL37151.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ22962.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX28180.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK84925.1| Uncharacterised protein [Shigella sonnei]
 emb|CSE74962.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS27809.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN48176.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM15044.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS69861.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV84966.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW00324.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ91085.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY44496.1| Uncharacterised protein [Shigella sonnei]
 emb|CSQ79452.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK19002.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK98207.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY64670.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI37339.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ33972.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV52979.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK12820.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI93991.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL19874.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB38063.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU47064.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR85232.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM77948.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR31575.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK62251.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU50396.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI77312.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU02767.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL13760.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK83543.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL34955.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS88290.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK92711.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX57064.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU14692.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ15896.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK27009.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX61523.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV89431.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL79110.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX67241.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG09066.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA95602.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV25427.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR80403.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH82988.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR72867.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL21111.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL73792.1| Uncharacterised protein [Shigella sonnei]
 emb|CST87634.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV96822.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB75189.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ32181.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ66406.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF48199.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK24266.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV00615.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW54177.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY44247.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW00297.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX67666.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI63096.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK51221.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ94148.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY87601.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ56177.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY38930.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF85696.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG56583.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV86231.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN03105.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR17498.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC02008.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC57226.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY81151.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV22948.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA03731.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ09103.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB69502.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW18573.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY53289.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW36708.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM75888.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ91520.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY36060.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF61772.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ52782.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH24983.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ82130.1| Uncharacterised protein [Shigella sonnei]
 emb|CST91818.1| Uncharacterised protein [Shigella sonnei]
 emb|CSF24300.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI88072.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM29044.1| Uncharacterised protein [Shigella sonnei]
 emb|CTE01011.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM09922.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV93925.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ38176.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS91070.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY87592.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG97122.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI71089.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV26213.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM88319.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV45790.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN74643.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS94490.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV91626.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM49348.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI09713.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV34457.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY35630.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY49528.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY67878.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX69782.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ55717.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO88427.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC14859.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO65669.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ68444.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY17940.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM29408.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW79957.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH11362.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB73259.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY41614.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD85342.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV29991.1| Uncharacterised protein [Shigella sonnei]
 emb|CST87088.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX16238.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU93456.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA16800.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW15381.1| Uncharacterised protein [Shigella sonnei]
 emb|CSO30134.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR13164.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX53847.1| Uncharacterised protein [Shigella sonnei]
 emb|CSR02951.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ53925.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI01120.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB72186.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH89783.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX26844.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI25052.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX57921.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY64954.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB97087.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ45253.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH87944.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX32806.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX64855.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN15874.1| Uncharacterised protein [Shigella sonnei]
 emb|CSP05611.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI01956.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU73940.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK52814.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ90152.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD01854.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV24018.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ45504.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB63519.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV23018.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY15251.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX36419.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI14340.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS55563.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB78461.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS46566.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV49188.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB86701.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI63683.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM71758.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI03342.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ55217.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH37881.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA24286.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN00430.1| Uncharacterised protein [Shigella sonnei]
 emb|CSL87007.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ19592.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK21559.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ68448.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ09844.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN18264.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC19577.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB65358.1| Uncharacterised protein [Shigella sonnei]
 emb|CTE16439.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC51119.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB71128.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC42650.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM12802.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY31284.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ92332.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY70064.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH34561.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC25386.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX59037.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU79038.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ73062.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC28320.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI00605.1| Uncharacterised protein [Shigella sonnei]
 emb|CST05598.1| Uncharacterised protein [Shigella sonnei]
 emb|CST58789.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM44098.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC69038.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU68995.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV10553.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY81353.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ11523.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY39271.1| Uncharacterised protein [Shigella sonnei]
 emb|CST94250.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB79157.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ40192.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH28696.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU26440.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC83993.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY47278.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX39688.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH48282.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG81970.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI82174.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH09859.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV21904.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG56110.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK44472.1| Uncharacterised protein [Shigella sonnei]
 emb|CSZ15192.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC35644.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM89874.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK35433.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY62877.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ78619.1| Uncharacterised protein [Shigella sonnei]
 emb|CSU82867.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV52950.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG75320.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV09161.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI27485.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH87698.1| Uncharacterised protein [Shigella sonnei]
 emb|CSV46434.1| Uncharacterised protein [Shigella sonnei]
 emb|CSW92208.1| Uncharacterised protein [Shigella sonnei]
 emb|CSX69797.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH16941.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG73909.1| Uncharacterised protein [Shigella sonnei]
 emb|CSG69661.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB11320.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB03596.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA03936.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA99584.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA50481.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA36205.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI05823.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI15919.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN35655.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS98473.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH61329.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN38798.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY61482.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH55221.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM28552.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS29613.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM78935.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA60665.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM92337.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM85579.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM53863.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB28081.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH99862.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM34849.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB39438.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM95355.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH95127.1| Uncharacterised protein [Shigella sonnei]
 emb|CSS89147.1| Uncharacterised protein [Shigella sonnei]
 emb|CSN18660.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA26449.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM86596.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA76953.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB48373.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA33275.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM94989.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ91559.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK01496.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH76474.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM48686.1| Uncharacterised protein [Shigella sonnei]
 emb|CSJ51072.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB64806.1| Uncharacterised protein [Shigella sonnei]
 emb|CSM90049.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB72269.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA73216.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB06463.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH55459.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA68170.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB41665.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA74296.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC41392.1| Uncharacterised protein [Shigella sonnei]
 emb|CSH62720.1| Uncharacterised protein [Shigella sonnei]
 emb|CSI48859.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA42924.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA85749.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB16006.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA53777.1| Uncharacterised protein [Shigella sonnei]
 emb|CTB77370.1| Uncharacterised protein [Shigella sonnei]
 emb|CTA73338.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK34513.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK29614.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK84116.1| Uncharacterised protein [Shigella sonnei]
 emb|CTC18944.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK73967.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK81395.1| Uncharacterised protein [Shigella sonnei]
 emb|CSK45374.1| Uncharacterised protein [Shigella sonnei]
 emb|CSY61144.1| Uncharacterised protein [Shigella sonnei]
 gb|KNF18036.1| membrane protein [Escherichia coli]
 gb|KNF19520.1| membrane protein [Escherichia coli]
 gb|KNF21997.1| membrane protein [Escherichia coli]
 gb|KNF31927.1| membrane protein [Escherichia coli]
 gb|KNF33603.1| membrane protein [Escherichia coli]
 gb|KNF41224.1| membrane protein [Escherichia coli]
 gb|KNF44560.1| membrane protein [Escherichia coli]
 gb|KNF47472.1| membrane protein [Escherichia coli]
 gb|KNF58791.1| membrane protein [Escherichia coli]
 gb|KNF63304.1| membrane protein [Escherichia coli]
 gb|KNF63914.1| membrane protein [Escherichia coli]
 gb|KNF78794.1| membrane protein [Escherichia coli]
 gb|KNF81207.1| membrane protein [Escherichia coli]
 gb|KNF86696.1| membrane protein [Escherichia coli]
 gb|KNF92585.1| membrane protein [Escherichia coli]
 gb|KNF98468.1| membrane protein [Escherichia coli]
 gb|KNG08789.1| membrane protein [Escherichia coli]
 gb|KNG10845.1| membrane protein [Escherichia coli]
 gb|KNG15765.1| membrane protein [Escherichia coli]
 gb|KNG23870.1| membrane protein [Escherichia coli]
 gb|KNG25839.1| membrane protein [Escherichia coli]
 gb|KNG31823.1| membrane protein [Escherichia coli]
 gb|KNG36653.1| membrane protein [Escherichia coli]
 gb|KNG41149.1| membrane protein [Escherichia coli]
 gb|KNY02815.1| membrane protein [Escherichia coli]
 gb|KNY53901.1| hypothetical protein AGA24_19800 [Escherichia coli]
 gb|KNY65543.1| hypothetical protein AGA22_06595 [Escherichia coli]
 gb|KNY66518.1| hypothetical protein AGA21_00850 [Escherichia coli]
 gb|KNY71162.1| hypothetical protein AGA25_10960 [Escherichia coli]
 gb|KNY75786.1| hypothetical protein AGA27_21460 [Escherichia coli]
 gb|KNY86843.1| hypothetical protein AGA28_11770 [Escherichia coli]
 gb|KNY92320.1| hypothetical protein AGA29_01895 [Escherichia coli]
 gb|KNZ00240.1| hypothetical protein AGA37_01210 [Escherichia coli]
 gb|KNZ05413.1| hypothetical protein AGA31_00455 [Escherichia coli]
 gb|KNZ10030.1| hypothetical protein AGA36_03740 [Escherichia coli]
 gb|KNZ16870.1| hypothetical protein AGA20_01535 [Escherichia coli]
 gb|KNZ17214.1| hypothetical protein AGA30_03995 [Escherichia coli]
 gb|KNZ21942.1| hypothetical protein AGA23_08125 [Escherichia coli]
 gb|KNZ28197.1| hypothetical protein AGA32_00860 [Escherichia coli]
 gb|KNZ97469.1| membrane protein [Escherichia coli]
 gb|KOA27146.1| membrane protein [Escherichia coli]
 emb|CTX21411.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW44215.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX24727.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR77413.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR27410.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS73443.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU63621.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR42641.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU11981.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS99293.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU90871.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW69581.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV54892.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR99645.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW24595.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR55526.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT97874.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR54532.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV30781.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU69124.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT02657.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS18602.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS77203.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR43793.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV55361.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW57105.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV72427.1| cell division MukB-like protein [Escherichia coli]
 emb|CTW30612.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS65912.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS77377.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU82906.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS74636.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS60397.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV47417.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR62628.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV49572.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS83826.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU03964.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR42276.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS12485.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV58908.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT56561.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV05234.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU70609.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU25360.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV20365.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT11163.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR82540.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR74398.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS96766.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV19641.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV78068.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS93155.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV26636.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU77693.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS30893.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT56077.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU93755.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS86130.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS08731.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV18488.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR55198.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV50129.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV66761.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS07910.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR39941.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS25539.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR80479.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS36134.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU81853.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR89351.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU74851.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU83658.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU88315.1| cell division MukB-like protein [Escherichia coli]
 emb|CTR81561.1| cell division MukB-like protein [Escherichia coli]
 emb|CTV09028.1| cell division MukB-like protein [Escherichia coli]
 emb|CTS50695.1| cell division MukB-like protein [Escherichia coli]
 emb|CTU96556.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT56504.1| cell division MukB-like protein [Escherichia coli]
 emb|CTT27855.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY15203.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY25324.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY43608.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY55432.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX84559.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY53103.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY55419.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ18001.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ42458.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ19207.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY45443.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX38117.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY48710.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX82553.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX48605.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX86969.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX60256.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ45567.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ45236.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY71579.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ18666.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY86330.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY75393.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ82291.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY17747.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY04241.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY34434.1| cell division MukB-like protein [Escherichia coli]
 emb|CTY30452.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ76991.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ87664.1| cell division MukB-like protein [Escherichia coli]
 emb|CTZ50105.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA15964.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA14234.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA07517.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA09592.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA60995.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA37420.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA62242.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA28390.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA24676.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA40151.1| cell division MukB-like protein [Escherichia coli]
 emb|CUA34434.1| cell division MukB-like protein [Escherichia coli]
 gb|KOQ99056.1| membrane protein [Escherichia coli]
 gb|ALD23488.1| hypothetical protein AN206_03150 [Escherichia coli]
 gb|ALD38445.1| hypothetical protein AN203_03140 [Escherichia coli]
 gb|ALD28725.1| hypothetical protein AN205_03160 [Escherichia coli]
 gb|ALD33681.1| hypothetical protein AN204_03250 [Escherichia coli]
 gb|KOZ08661.1| membrane protein [Escherichia coli]
 gb|KOZ09731.1| membrane protein [Escherichia coli]
 gb|KOZ17196.1| membrane protein [Escherichia coli]
 gb|KOZ25061.1| membrane protein [Escherichia coli]
 gb|KOZ27428.1| membrane protein [Escherichia coli]
 gb|KOZ28951.1| membrane protein [Escherichia coli]
 gb|KOZ38464.1| membrane protein [Escherichia coli]
 gb|KOZ46869.1| membrane protein [Escherichia coli]
 gb|KOZ48536.1| membrane protein [Escherichia coli]
 gb|KOZ54498.1| membrane protein [Escherichia coli]
 gb|KOZ58991.1| membrane protein [Escherichia coli]
 gb|KOZ66360.1| membrane protein [Escherichia coli]
 gb|KOZ72041.1| membrane protein [Escherichia coli]
 gb|KOZ76798.1| membrane protein [Escherichia coli]
 gb|KOZ78804.1| membrane protein [Escherichia coli]
 gb|KOZ88574.1| membrane protein [Escherichia coli]
 gb|KOZ91337.1| membrane protein [Escherichia coli]
 gb|KOZ95255.1| membrane protein [Escherichia coli]
 gb|KPH30980.1| membrane protein [Escherichia coli]
 gb|KPH36150.1| membrane protein [Escherichia coli]
 gb|KPH45492.1| membrane protein [Escherichia coli]
 gb|KPH48702.1| membrane protein [Escherichia coli]
 emb|CTX64331.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX70594.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX39363.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX53241.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX37180.1| cell division MukB-like protein [Escherichia coli]
 emb|CTX56688.1| cell division MukB-like protein [Escherichia coli]
 emb|CTD67955.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD70294.1| Uncharacterised protein [Shigella sonnei]
 emb|CTD39501.1| Uncharacterised protein [Shigella sonnei]
 emb|CTX30870.1| cell division MukB-like protein [Escherichia coli]
 gb|ALH92371.1| hypothetical protein AO055_19875 [Escherichia coli O157:H7]
 gb|KPO09321.1| membrane protein [Escherichia coli]
 gb|KPO14611.1| membrane protein [Escherichia coli]
 gb|KPO18100.1| hypothetical protein VM39_00045 [Escherichia coli]
 gb|KPO20032.1| membrane protein [Escherichia coli]
 gb|KPO26949.1| membrane protein [Escherichia coli]
 gb|KPO34159.1| membrane protein [Escherichia coli]
 gb|KPO42798.1| membrane protein [Escherichia coli]
 gb|KPO51225.1| membrane protein [Escherichia coli]
 gb|KPO54066.1| membrane protein [Escherichia coli]
 gb|KPO54528.1| membrane protein [Escherichia coli]
 gb|KPO56384.1| membrane protein [Escherichia coli]
 gb|KPO65174.1| membrane protein [Escherichia coli]
 gb|KPO81740.1| membrane protein [Escherichia coli]
 gb|KPO82953.1| membrane protein [Escherichia coli]
 gb|KPP04409.1| membrane protein [Escherichia coli]
 gb|KPP15479.1| membrane protein [Escherichia coli]
 gb|KPP20547.1| membrane protein [Escherichia coli]
 gb|KPP24747.1| membrane protein [Escherichia coli]
 gb|KPP26232.1| membrane protein [Escherichia coli]
 gb|KPP31959.1| membrane protein [Escherichia coli]
 gb|KPP43669.1| membrane protein [Escherichia coli]
 gb|KPP46886.1| membrane protein [Escherichia coli]
 gb|KPP48908.1| membrane protein [Escherichia coli]
 gb|KPP50219.1| membrane protein [Escherichia coli]
 gb|KQB26757.1| hypothetical protein APV31_11480 [Escherichia coli]
 gb|KQC25437.1| hypothetical protein AML92_15105 [Escherichia coli]
 gb|KQI79955.1| hypothetical protein AM259_16440 [Escherichia coli]
 gb|KQI86281.1| hypothetical protein AM260_09405 [Escherichia coli]
 gb|KQI92788.1| hypothetical protein AM261_00630 [Escherichia coli]
 gb|KQI99359.1| hypothetical protein AM263_03140 [Escherichia coli]
 gb|KQJ06856.1| hypothetical protein AM264_04890 [Escherichia coli]
 gb|KQJ09165.1| hypothetical protein AM265_11655 [Escherichia coli]
 gb|KQJ32003.1| hypothetical protein AM269_00295 [Escherichia coli]
 gb|KQJ35867.1| hypothetical protein AM271_00900 [Escherichia coli]
 gb|KQJ42923.1| hypothetical protein AM270_10535 [Escherichia coli]
 gb|KQJ44142.1| hypothetical protein AM272_02820 [Escherichia coli]
 gb|KQJ50622.1| hypothetical protein AM273_03450 [Escherichia coli]
 gb|ALL95194.1| hypothetical protein AKK22_21950 [Escherichia coli]
 gb|KQL77917.1| Inner membrane protein YqjK [Escherichia coli]
 gb|KRQ07425.1| hypothetical protein ASO15_20550 [Escherichia coli O157:H7]
 gb|KRR59181.1| hypothetical protein ECK71_08967 [Escherichia coli K71]
 gb|ALN47174.1| hypothetical protein ASE18_14300 [Escherichia coli]
 gb|KST26446.1| hypothetical protein APZ14_03840 [Escherichia coli]
 gb|KST30527.1| hypothetical protein APZ13_01990 [Escherichia coli]
 gb|ALQ57879.1| hypothetical protein AB850_04900 [Escherichia coli]
 gb|KSW84340.1| hypothetical protein APT75_19420 [Escherichia coli]
 gb|KSX97630.1| hypothetical protein APT94_22770 [Escherichia coli]
 gb|KSY19494.1| hypothetical protein APT99_03155 [Escherichia coli]
 gb|KSY49955.1| hypothetical protein APU06_00980 [Escherichia coli]
 gb|KSY74945.1| hypothetical protein APU10_22335 [Escherichia coli]
 gb|KSY85081.1| hypothetical protein APU12_17895 [Escherichia coli]
 gb|KSY89360.1| hypothetical protein APU13_24175 [Escherichia coli]
 gb|KSY97052.1| hypothetical protein APU16_09500 [Escherichia coli]
 emb|CRL90040.1| conserved hypothetical protein [Escherichia coli]
 gb|KUG69279.1| hypothetical protein ARC81_16150 [Escherichia coli]
 gb|KUG71142.1| hypothetical protein ARC96_14785 [Escherichia coli]
 gb|KUG84031.1| hypothetical protein ARC95_16915 [Escherichia coli]
 gb|KUH05308.1| hypothetical protein ARC82_05775 [Escherichia coli]
 gb|KUH07369.1| hypothetical protein ARC83_14945 [Escherichia coli]
 gb|KUH08076.1| hypothetical protein ARC99_22115 [Escherichia coli]
 gb|KUH21628.1| hypothetical protein ARC94_02090 [Escherichia coli]
 gb|KUH24904.1| hypothetical protein ARC89_03610 [Escherichia coli]
 gb|KUH26849.1| hypothetical protein ARC98_12430 [Escherichia coli]
 gb|KUR38757.1| hypothetical protein AWF57_05675 [Escherichia coli]
 gb|ALZ57346.1| Inner membrane protein YqjK [Shigella sonnei]
 gb|KUR87899.1| hypothetical protein AWE64_06865 [Escherichia coli]
 gb|KUR92630.1| hypothetical protein AWE57_13050 [Escherichia coli]
 gb|KUS04575.1| hypothetical protein AWE54_10125 [Escherichia coli]
 gb|KUS07270.1| hypothetical protein AWE52_03385 [Escherichia coli]
 gb|KUS08485.1| hypothetical protein AWE61_11430 [Escherichia coli]
 gb|KUS13154.1| hypothetical protein AWE62_21150 [Escherichia coli]
 gb|KUS29176.1| hypothetical protein AWE56_07325 [Escherichia coli]
 gb|KUS41213.1| hypothetical protein AWE70_06800 [Escherichia coli]
 gb|KUS50293.1| hypothetical protein AWE71_07635 [Escherichia coli]
 gb|KUS59974.1| hypothetical protein AWE60_19240 [Escherichia coli]
 gb|KUS71552.1| hypothetical protein AWE73_15500 [Escherichia coli]
 gb|KUS75398.1| hypothetical protein AWE77_09805 [Escherichia coli]
 gb|KUS78058.1| hypothetical protein AWE78_16815 [Escherichia coli]
 gb|KUS86492.1| hypothetical protein AWE74_13825 [Escherichia coli]
 gb|KUS98383.1| hypothetical protein AWE80_06665 [Escherichia coli]
 gb|KUS98963.1| hypothetical protein AWE79_08905 [Escherichia coli]
 gb|KUT07854.1| hypothetical protein AWE82_19880 [Escherichia coli]
 gb|KUT09564.1| hypothetical protein AWE83_04105 [Escherichia coli]
 gb|KUT22739.1| hypothetical protein AWE58_03645 [Escherichia coli]
 gb|KUT33809.1| hypothetical protein AWE95_06010 [Escherichia coli]
 gb|KUT34131.1| hypothetical protein AWE96_10980 [Escherichia coli]
 gb|KUT43521.1| hypothetical protein AWE98_14395 [Escherichia coli]
 gb|KUT47346.1| hypothetical protein AWE99_00150 [Escherichia coli]
 gb|KUT50991.1| hypothetical protein AWE97_06460 [Escherichia coli]
 gb|KUT61891.1| hypothetical protein AWF00_05680 [Escherichia coli]
 gb|KUT75958.1| hypothetical protein AWF06_03320 [Escherichia coli]
 gb|KUT83274.1| hypothetical protein AWF07_10085 [Escherichia coli]
 gb|KUT86102.1| hypothetical protein AWF08_17975 [Escherichia coli]
 gb|KUT93008.1| hypothetical protein AWF11_03935 [Escherichia coli]
 gb|KUU05645.1| hypothetical protein AWF13_12640 [Escherichia coli]
 gb|KUU07311.1| hypothetical protein AWF12_21570 [Escherichia coli]
 gb|KUU17884.1| hypothetical protein AWF15_01710 [Escherichia coli]
 gb|KUU22458.1| hypothetical protein AWF19_04780 [Escherichia coli]
 gb|KUU70488.1| hypothetical protein AWF29_01050 [Escherichia coli]
 gb|KUU92411.1| hypothetical protein AWF36_04235 [Escherichia coli]
 gb|KUV04881.1| hypothetical protein AWF35_01550 [Escherichia coli]
 gb|KUV24205.1| hypothetical protein AWF40_01470 [Escherichia coli]
 gb|KUV34197.1| hypothetical protein AWF44_03105 [Escherichia coli]
 gb|KUV47831.1| hypothetical protein AWE92_15570 [Escherichia coli]
 gb|KUV51501.1| hypothetical protein AWE89_21170 [Escherichia coli]
 gb|KUV53957.1| hypothetical protein AWF45_20455 [Escherichia coli]
 gb|KUV71562.1| hypothetical protein AWF48_15970 [Escherichia coli]
 gb|KUW23379.1| hypothetical protein AWF59_01655 [Escherichia coli]
 gb|KUW40224.1| hypothetical protein AWF62_01890 [Escherichia coli]
 gb|KUW43144.1| hypothetical protein AWF65_20395 [Escherichia coli]
 gb|KUW67196.1| hypothetical protein AWF68_04605 [Escherichia coli]
 gb|KUW78251.1| hypothetical protein AWF71_09655 [Escherichia coli]
 gb|KUW85257.1| hypothetical protein AWF72_19195 [Escherichia coli]
 gb|KUW86153.1| hypothetical protein AWF73_18660 [Escherichia coli]
 gb|KUW95069.1| hypothetical protein AWF74_18425 [Escherichia coli]
 gb|KUX05959.1| hypothetical protein AWF77_14805 [Escherichia coli]
 gb|KUX24060.1| hypothetical protein AWF81_16385 [Escherichia coli]
 gb|KUX32024.1| hypothetical protein AWF80_22375 [Escherichia coli]
 gb|KUX48128.1| hypothetical protein AWF85_02390 [Escherichia coli]
 gb|KUX69950.1| hypothetical protein AWF89_19730 [Escherichia coli]
 gb|KUX74421.1| hypothetical protein AWF92_15895 [Escherichia coli]
 gb|KUX82748.1| hypothetical protein AWF93_17215 [Escherichia coli]
 gb|KUX93576.1| hypothetical protein AWF96_14510 [Escherichia coli]
 gb|KVI21043.1| hypothetical protein AWE90_09560 [Escherichia coli]
 gb|KVI23693.1| hypothetical protein AWF31_20910 [Escherichia coli]
 gb|KWV19309.1| hypothetical protein AWH70_17265 [Escherichia coli]
 gb|AMB52811.1| hypothetical protein AWB62_02615 [Escherichia coli]
 gb|KXC12560.1| hypothetical protein AWE30_22105 [Escherichia coli]
 gb|AMG17953.1| hypothetical protein AL477_22955 [Shigella sonnei]
 gb|AMG81606.1| hypothetical protein JEONG1266_27705 [Escherichia coli O157:H7]
 gb|AMH23750.1| hypothetical protein C2566_18890 [Escherichia coli B]
 gb|AMH28067.1| hypothetical protein C3029_19510 [Escherichia coli B]
 gb|AMF90257.1| hypothetical protein AL551_19155 [Escherichia coli]
 gb|KXG94685.1| hypothetical protein HMPREF3041_02644 [Escherichia coli]
 gb|AML11059.1| hypothetical protein AVR75_16255 [Escherichia coli]
 gb|KXK75240.1| hypothetical protein AUS51_02465 [Escherichia coli]
 gb|KXK79663.1| hypothetical protein AUS13_15220 [Escherichia coli]
 gb|KXK86365.1| hypothetical protein AUS52_09095 [Escherichia coli]
 gb|KXK92165.1| hypothetical protein AXH20_06010 [Escherichia coli]
 gb|KXK96539.1| hypothetical protein AXH15_05175 [Escherichia coli]
 gb|KXL08844.1| hypothetical protein AXH19_09445 [Escherichia coli]
 gb|KXL23826.1| hypothetical protein AXH14_05715 [Escherichia coli]
 gb|KXL28619.1| hypothetical protein AXH12_19570 [Escherichia coli]
 gb|KXL33472.1| hypothetical protein AXH18_15565 [Escherichia coli]
 gb|KXL35623.1| hypothetical protein AXH10_20885 [Escherichia coli]
 gb|KXL57600.1| hypothetical protein AUS26_20995 [Escherichia coli]
 gb|KXL62677.1| hypothetical protein AUS12_13975 [Escherichia coli]
 gb|KXL63072.1| hypothetical protein AUS22_10640 [Escherichia coli]
 gb|KXL71503.1| hypothetical protein AUS14_24550 [Escherichia coli]
 gb|KXL81649.1| hypothetical protein AUS15_11660 [Escherichia coli]
 gb|KXL83228.1| hypothetical protein AUS48_06130 [Escherichia coli]
 gb|KXL90551.1| hypothetical protein AUS17_03055 [Escherichia coli]
 gb|KXM01913.1| hypothetical protein AUS49_06735 [Escherichia coli]
 gb|KXM02136.1| hypothetical protein AUS16_24580 [Escherichia coli]
 gb|KXM04180.1| hypothetical protein AUS50_21615 [Escherichia coli]
 gb|KXM11111.1| hypothetical protein AUS24_18135 [Escherichia coli]
 gb|KXM14666.1| hypothetical protein AUS19_00230 [Escherichia coli]
 gb|KXM24066.1| hypothetical protein AUS20_11845 [Escherichia coli]
 gb|KXM28823.1| hypothetical protein AUS21_08430 [Escherichia coli]
 gb|KXM32928.1| hypothetical protein AUS23_20215 [Escherichia coli]
 gb|KXM36537.1| hypothetical protein AUS25_21985 [Escherichia coli]
 gb|KXM39037.1| hypothetical protein AUS28_22480 [Escherichia coli]
 gb|KXM45475.1| hypothetical protein AUS29_10840 [Escherichia coli]
 gb|KXM59749.1| hypothetical protein AUS32_10605 [Escherichia coli]
 gb|KXM64089.1| hypothetical protein AUS30_26315 [Escherichia coli]
 gb|KXM64762.1| hypothetical protein AUS33_03285 [Escherichia coli]
 gb|KXM69413.1| hypothetical protein AUS34_18640 [Escherichia coli]
 gb|KXM74883.1| hypothetical protein AUS31_10970 [Escherichia coli]
 gb|KXM76148.1| hypothetical protein AUS36_21225 [Escherichia coli]
 gb|KXM87756.1| hypothetical protein AUS41_13080 [Escherichia coli]
 gb|KXM92416.1| hypothetical protein AUS37_19675 [Escherichia coli]
 gb|KXM96413.1| hypothetical protein AUS39_27035 [Escherichia coli]
 gb|KXN05469.1| hypothetical protein AUS46_12990 [Escherichia coli]
 gb|KXN07682.1| hypothetical protein AUS47_19050 [Escherichia coli]
 gb|KXN14397.1| hypothetical protein AUS38_01915 [Escherichia coli]
 gb|KXN26750.1| hypothetical protein AUS45_06135 [Escherichia coli]
 gb|KXN29883.1| hypothetical protein AUS40_03355 [Escherichia coli]
 gb|KXN31824.1| hypothetical protein AUS18_05045 [Escherichia coli]
 gb|KXN38831.1| hypothetical protein AUS35_12545 [Escherichia coli]
 gb|KXN41897.1| hypothetical protein AUS53_00290 [Escherichia coli]
 gb|KXN49993.1| hypothetical protein AUS42_23515 [Escherichia coli]
 gb|KXN55571.1| hypothetical protein AUS44_26150 [Escherichia coli]
 gb|KXN59439.1| hypothetical protein AUS27_09610 [Escherichia coli]
 gb|KXN63303.1| hypothetical protein AUS43_22305 [Escherichia coli]
 gb|KXP28529.1| hypothetical protein AUP75_00865 [Escherichia coli]
 gb|KXP71597.1| hypothetical protein AUQ08_13560 [Escherichia coli]
 gb|KXP81515.1| hypothetical protein AUP77_16935 [Escherichia coli]
 gb|KXQ00857.1| hypothetical protein AUP85_04105 [Escherichia coli]
 gb|KXQ04803.1| hypothetical protein AUP87_02710 [Escherichia coli]
 gb|KXQ31586.1| hypothetical protein AUQ03_11115 [Escherichia coli]
 gb|KXQ63767.1| hypothetical protein AUQ07_08185 [Escherichia coli]
 gb|KXQ75244.1| hypothetical protein AUP99_18235 [Escherichia coli]
 gb|KXQ89797.1| hypothetical protein AUQ06_15060 [Escherichia coli]
 gb|KXR12092.1| hypothetical protein AUQ15_07840 [Escherichia coli]
 gb|KXR39225.1| hypothetical protein AUQ24_02420 [Escherichia coli]
 gb|KXR60298.1| hypothetical protein AUQ32_02110 [Escherichia coli]
 gb|KXR88081.1| hypothetical protein AUP80_06795 [Escherichia coli]
 gb|AMR24636.1| hypothetical protein A0259_19250 [Shigella sp. PAMC 28760]
 gb|KYL38552.1| hypothetical protein ECEG1_16600 [Escherichia coli]
 gb|KYR06511.1| hypothetical protein AMK98_22655 [Escherichia coli]
 gb|KYR09220.1| hypothetical protein AML00_18830 [Escherichia coli]
 gb|KYR13857.1| hypothetical protein AMK99_10805 [Escherichia coli]
 gb|KYR25279.1| hypothetical protein AML01_09145 [Escherichia coli]
 gb|KYR30180.1| hypothetical protein AML02_09600 [Escherichia coli]
 gb|KYR34819.1| hypothetical protein AML04_23045 [Escherichia coli]
 gb|KYR39924.1| hypothetical protein AML03_00370 [Escherichia coli]
 gb|KYR50484.1| hypothetical protein AML06_06230 [Escherichia coli]
 gb|KYR51509.1| hypothetical protein AML07_13990 [Escherichia coli]
 gb|KYR57241.1| hypothetical protein AML09_23245 [Escherichia coli]
 gb|KYR71059.1| hypothetical protein AML11_09785 [Escherichia coli]
 gb|KYR79877.1| hypothetical protein AML12_13430 [Escherichia coli]
 gb|KYR88559.1| hypothetical protein AML14_17795 [Escherichia coli]
 gb|KYR90279.1| hypothetical protein AML15_21305 [Escherichia coli]
 gb|KYR91264.1| hypothetical protein AML16_22095 [Escherichia coli]
 gb|KYS03054.1| hypothetical protein AML18_24660 [Escherichia coli]
 gb|KYS13380.1| hypothetical protein AML17_04230 [Escherichia coli]
 gb|KYS15448.1| hypothetical protein AML19_11450 [Escherichia coli]
 gb|KYS17910.1| hypothetical protein AML20_13990 [Escherichia coli]
 gb|KYS24937.1| hypothetical protein AML21_13085 [Escherichia coli]
 gb|KYS28381.1| hypothetical protein AML22_10400 [Escherichia coli]
 gb|KYS35965.1| hypothetical protein AML24_15665 [Escherichia coli]
 gb|KYS37355.1| hypothetical protein AML23_20255 [Escherichia coli]
 gb|KYS43644.1| hypothetical protein AML25_11545 [Escherichia coli]
 gb|KYS49100.1| hypothetical protein AML26_12020 [Escherichia coli]
 gb|KYS57045.1| hypothetical protein AML28_16455 [Escherichia coli]
 gb|KYS57838.1| hypothetical protein AML27_07815 [Escherichia coli]
 gb|KYS67587.1| hypothetical protein AML32_25545 [Escherichia coli]
 gb|KYS73018.1| hypothetical protein AML30_05815 [Escherichia coli]
 gb|KYS74753.1| hypothetical protein AML33_24240 [Escherichia coli]
 gb|KYS83194.1| hypothetical protein AML34_20805 [Escherichia coli]
 gb|KYS92367.1| hypothetical protein AML35_14345 [Escherichia coli]
 gb|KYS93262.1| hypothetical protein AML40_16925 [Escherichia coli]
 gb|KYS99952.1| hypothetical protein AML41_13305 [Escherichia coli]
 gb|KYT05429.1| hypothetical protein AML42_22170 [Escherichia coli]
 gb|KYT17872.1| hypothetical protein AML43_03835 [Escherichia coli]
 gb|KYT21395.1| hypothetical protein AML48_24240 [Escherichia coli]
 gb|KYT33376.1| hypothetical protein AML47_07170 [Escherichia coli]
 gb|KYT33452.1| hypothetical protein AML51_24240 [Escherichia coli]
 gb|KYT40237.1| hypothetical protein AML29_12350 [Escherichia coli]
 gb|KYT51841.1| hypothetical protein AML49_05210 [Escherichia coli]
 gb|KYT59402.1| hypothetical protein AML38_22900 [Escherichia coli]
 gb|KYT60710.1| hypothetical protein AML45_03630 [Escherichia coli]
 gb|KYT63159.1| hypothetical protein AML50_17480 [Escherichia coli]
 gb|KYT70732.1| hypothetical protein AML52_11445 [Escherichia coli]
 gb|KYT72240.1| hypothetical protein AML54_08800 [Escherichia coli]
 gb|KYT75313.1| hypothetical protein AML60_02895 [Escherichia coli]
 gb|KYT86268.1| hypothetical protein AML78_13075 [Escherichia coli]
 gb|KYT87077.1| hypothetical protein AML64_09065 [Escherichia coli]
 gb|KYU03143.1| hypothetical protein AML53_09390 [Escherichia coli]
 gb|KYU04403.1| hypothetical protein AML66_11050 [Escherichia coli]
 gb|KYU08166.1| hypothetical protein AML58_04585 [Escherichia coli]
 gb|KYU16066.1| hypothetical protein AML57_01230 [Escherichia coli]
 gb|KYU19564.1| hypothetical protein AML56_04315 [Escherichia coli]
 gb|KYU28230.1| hypothetical protein AML61_12420 [Escherichia coli]
 gb|KYU38425.1| hypothetical protein AML63_15035 [Escherichia coli]
 gb|KYU39699.1| hypothetical protein AML65_18830 [Escherichia coli]
 gb|KYU47092.1| hypothetical protein AML67_22085 [Escherichia coli]
 gb|KYU56236.1| hypothetical protein AML72_24700 [Escherichia coli]
 gb|KYU58246.1| hypothetical protein AML68_16730 [Escherichia coli]
 gb|KYU62185.1| hypothetical protein AML71_00865 [Escherichia coli]
 gb|KYU69419.1| hypothetical protein AML74_01900 [Escherichia coli]
 gb|KYU71765.1| hypothetical protein AML73_11000 [Escherichia coli]
 gb|KYU76526.1| hypothetical protein AML75_14620 [Escherichia coli]
 gb|KYU79974.1| hypothetical protein AML76_14880 [Escherichia coli]
 gb|KYU94695.1| hypothetical protein AML79_19490 [Escherichia coli]
 gb|KYU99326.1| hypothetical protein AML80_14360 [Escherichia coli]
 gb|KYV05871.1| hypothetical protein AML69_15645 [Escherichia coli]
 gb|KYV15682.1| hypothetical protein AML70_17515 [Escherichia coli]
 gb|KYV16247.1| hypothetical protein AML36_20390 [Escherichia coli]
 gb|KYV18722.1| hypothetical protein AML37_04645 [Escherichia coli]
 gb|KYV31635.1| hypothetical protein AMK77_14100 [Escherichia coli]
 gb|KYV33738.1| hypothetical protein AML39_07040 [Escherichia coli]
 gb|KYV35999.1| hypothetical protein AMK76_09455 [Escherichia coli]
 gb|KYV50973.1| hypothetical protein AMK78_15430 [Escherichia coli]
 gb|KYV54547.1| hypothetical protein AMK80_14915 [Escherichia coli]
 gb|KYV60796.1| hypothetical protein AMK82_18835 [Escherichia coli]
 gb|KYV61519.1| hypothetical protein AMK81_18990 [Escherichia coli]
 gb|KYV65827.1| hypothetical protein AMK83_21245 [Escherichia coli]
 gb|KYV74385.1| hypothetical protein AMK84_01060 [Escherichia coli]
 gb|KYV86871.1| hypothetical protein AMK86_10120 [Escherichia coli]
 gb|KYV86993.1| hypothetical protein AMK87_17405 [Escherichia coli]
 gb|KYV91840.1| hypothetical protein AMK85_04870 [Escherichia coli]
 gb|KYW01369.1| hypothetical protein AMK88_11000 [Escherichia coli]
 gb|KYW02704.1| hypothetical protein AMK89_12595 [Escherichia coli]
 gb|KYW03560.1| hypothetical protein AMK90_13990 [Escherichia coli]
 gb|KYW07848.1| hypothetical protein AMK91_02715 [Escherichia coli]
 gb|KYW17677.1| hypothetical protein AMK93_16995 [Escherichia coli]
 gb|KYW35648.1| hypothetical protein AMK96_23570 [Escherichia coli]
 gb|KYW36592.1| hypothetical protein AMK94_04345 [Escherichia coli]
 gb|KYW40248.1| hypothetical protein AML82_06745 [Escherichia coli]
 gb|KYW46162.1| hypothetical protein AMK97_11810 [Escherichia coli]
 gb|KYW57461.1| hypothetical protein AML84_23150 [Escherichia coli]
 gb|KYW58923.1| hypothetical protein AML85_02450 [Escherichia coli]
 gb|KYW65786.1| hypothetical protein AML83_24615 [Escherichia coli]
 gb|KYW70221.1| hypothetical protein AML86_20790 [Escherichia coli]
 gb|KYW77014.1| hypothetical protein AML88_01205 [Escherichia coli]
 gb|KYW78374.1| hypothetical protein AML87_00860 [Escherichia coli]
 gb|KYZ97778.1| hypothetical protein ACM49_14940 [Escherichia coli]
 gb|AMW42894.1| hypothetical protein ARC77_11945 [Escherichia coli]
 gb|AMW48258.1| hypothetical protein AR439_10540 [Escherichia coli]
 gb|AMX30689.1| hypothetical protein A4R39_10600 [Escherichia coli]
 gb|AMX34780.1| hypothetical protein A4R38_06295 [Escherichia coli]
 gb|AMX41151.1| hypothetical protein A4R37_14910 [Escherichia coli]
 gb|KZG97789.1| hypothetical protein AWG47_24870 [Escherichia coli]
 gb|KZG98836.1| hypothetical protein AWG39_14455 [Escherichia coli]
 gb|KZH23847.1| hypothetical protein AWG38_05045 [Escherichia coli]
 gb|KZH63326.1| hypothetical protein AWG40_23105 [Escherichia coli]
 gb|KZH67847.1| hypothetical protein AWG53_06870 [Escherichia coli]
 gb|KZH73684.1| hypothetical protein AWG48_22495 [Escherichia coli]
 gb|KZH97002.1| hypothetical protein AWG61_08670 [Escherichia coli]
 gb|KZI13492.1| hypothetical protein AWG60_15860 [Escherichia coli]
 gb|KZI28441.1| hypothetical protein AWG75_21350 [Escherichia coli]
 gb|KZI36734.1| hypothetical protein AWG66_07900 [Escherichia coli]
 gb|KZI45218.1| hypothetical protein AWG78_14805 [Escherichia coli]
 gb|KZI74060.1| hypothetical protein AWG77_18515 [Escherichia coli]
 gb|KZJ21103.1| hypothetical protein AWG88_03650 [Escherichia coli]
 gb|KZJ82010.1| hypothetical protein AWG94_10985 [Escherichia coli]
 gb|KZJ82112.1| hypothetical protein AWG99_18270 [Escherichia coli]
 gb|KZJ97757.1| hypothetical protein AWH01_26690 [Escherichia coli]
 gb|KZO66840.1| membrane protein [Escherichia coli]
 gb|KZO71385.1| membrane protein [Escherichia coli]
 gb|KZO79807.1| membrane protein [Escherichia coli]
 gb|KZO87861.1| membrane protein [Escherichia coli]
 gb|KZP40693.1| membrane protein [Escherichia coli]
 gb|KZP46500.1| membrane protein [Escherichia coli]
 gb|OAC01798.1| PHB family membrane protein [Escherichia coli]
 gb|OAC12455.1| PHB family membrane protein [Escherichia coli]
 gb|OAC22642.1| PHB family membrane protein [Escherichia coli]
 gb|OAC24189.1| PHB family membrane protein [Escherichia coli]
 gb|OAC39803.1| PHB family membrane protein [Escherichia coli]
 gb|OAE57028.1| hypothetical protein A7J46_16205 [Escherichia coli]
 gb|OAF42168.1| hypothetical protein AXK30_02120 [Escherichia coli]
 gb|OAF42551.1| hypothetical protein AXK29_16240 [Escherichia coli]
 gb|OAI32976.1| hypothetical protein A6M24_07265 [Escherichia coli]
 gb|ANE59432.1| hypothetical protein A5956_06690 [Escherichia coli]
 gb|ANE64121.1| hypothetical protein A5955_07050 [Escherichia coli]
 gb|OAJ79096.1| hypothetical protein A5957_13050 [Escherichia coli]
 gb|OAJ83772.1| hypothetical protein A5959_11445 [Escherichia coli]
 gb|OAN07569.1| hypothetical protein AU469_013030 [Escherichia coli O157:H7]
 gb|OAO49214.1| membrane protein [Escherichia coli]
 gb|OAO67248.1| membrane protein [Escherichia coli]
 gb|OAO68631.1| membrane protein [Escherichia coli]
 gb|ANG70496.1| hypothetical protein A8V31_21355 [Escherichia coli O157:H7]
 gb|ANG75992.1| hypothetical protein A8V32_21065 [Escherichia coli O157:H7]
 gb|ANG81675.1| hypothetical protein A8V30_21365 [Escherichia coli O157:H7]
 gb|OAR94125.1| hypothetical protein AYO02_13005 [Escherichia coli]
 gb|OAR95723.1| hypothetical protein AYO03_01410 [Escherichia coli]
 gb|OAS06997.1| hypothetical protein AYO07_10865 [Escherichia coli]
 gb|OAT63676.1| hypothetical protein A9D68_12100 [Escherichia coli]
 gb|OAV62043.1| hypothetical protein A6I93_03395 [Escherichia coli]
 gb|ANJ33622.1| hypothetical protein A9K64_03185 [Escherichia coli]
 gb|ANJ39631.1| hypothetical protein A9Z04_08880 [Escherichia coli]
 gb|ANK54803.1| hypothetical protein WM90_24590 [Escherichia coli]
 gb|ANM83893.1| hypothetical protein A8V37_15855 [Escherichia coli]
 gb|ANK33942.1| hypothetical protein WM48_17325 [Escherichia coli]
 gb|ANO91030.1| hypothetical protein GJ11_20380 [Escherichia coli]
 gb|ANP09115.1| hypothetical protein CP48_19045 [Escherichia coli]
 gb|ANP19941.1| hypothetical protein GJ12_19865 [Escherichia coli]
 gb|ANP34074.1| hypothetical protein AB847_20140 [Escherichia coli]
 gb|ANO79673.1| hypothetical protein CO57_19520 [Escherichia coli]
 gb|ANQ02468.1| hypothetical protein A9C00_10865 [Escherichia coli]
 gb|ANR82945.1| hypothetical protein BA058_09390 [Escherichia coli]
 gb|OBZ37206.1| hypothetical protein A9X41_18580 [Escherichia coli]
 gb|OBZ38401.1| hypothetical protein A9X39_16790 [Escherichia coli]
 gb|OBZ47198.1| hypothetical protein A9X40_05610 [Escherichia coli]
 gb|OCC33585.1| hypothetical protein AWZ64_18340 [Shigella sonnei]
 gb|OCC41797.1| hypothetical protein AWZ62_03620 [Shigella sonnei]
 gb|OCC43201.1| hypothetical protein AWZ63_03785 [Shigella sonnei]
 gb|OCC47129.1| hypothetical protein AWZ65_18340 [Shigella sonnei]
 gb|OCC49652.1| hypothetical protein AWZ66_14175 [Shigella sonnei]
 gb|OCC53116.1| hypothetical protein AW010_15865 [Shigella sonnei]
 gb|OCC59405.1| hypothetical protein AW008_06480 [Shigella sonnei]
 gb|OCC65246.1| hypothetical protein AW009_15715 [Shigella sonnei]
 gb|OCC65495.1| hypothetical protein AW007_16105 [Shigella sonnei]
 gb|OCC70385.1| hypothetical protein AW003_08400 [Shigella sonnei]
 gb|OCC78577.1| hypothetical protein AW000_19375 [Shigella sonnei]
 gb|OCC79207.1| hypothetical protein AW001_15745 [Shigella sonnei]
 gb|OCC84579.1| hypothetical protein AWZ97_01305 [Shigella sonnei]
 gb|OCC90801.1| hypothetical protein AWZ99_16065 [Shigella sonnei]
 gb|OCC93818.1| hypothetical protein AWZ96_09930 [Shigella sonnei]
 gb|OCC94710.1| hypothetical protein AWZ98_10555 [Shigella sonnei]
 gb|OCD00436.1| hypothetical protein AWZ95_21670 [Shigella sonnei]
 gb|OCD02944.1| hypothetical protein AWZ94_19855 [Shigella sonnei]
 gb|OCD08226.1| hypothetical protein AWZ93_10645 [Shigella sonnei]
 gb|OCD09333.1| hypothetical protein AWZ91_09360 [Shigella sonnei]
 gb|OCD21361.1| hypothetical protein AWZ92_01815 [Shigella sonnei]
 gb|OCD27465.1| hypothetical protein AWZ90_19670 [Shigella sonnei]
 gb|OCD29241.1| hypothetical protein AWZ89_17945 [Shigella sonnei]
 gb|OCD34461.1| hypothetical protein AWZ88_16380 [Shigella sonnei]
 gb|OCD35755.1| hypothetical protein AWZ86_06420 [Shigella sonnei]
 gb|OCD39348.1| hypothetical protein AWZ85_03355 [Shigella sonnei]
 gb|OCD44258.1| hypothetical protein AWZ87_14295 [Shigella sonnei]
 gb|OCD49838.1| hypothetical protein AWZ70_06375 [Shigella sonnei]
 gb|OCD56312.1| hypothetical protein AWZ73_16350 [Shigella sonnei]
 gb|OCD58159.1| hypothetical protein AWZ84_09405 [Shigella sonnei]
 gb|OCD63960.1| hypothetical protein AW028_03285 [Shigella sonnei]
 gb|OCD67532.1| hypothetical protein AWZ69_17215 [Shigella sonnei]
 gb|OCD72102.1| hypothetical protein AW027_12415 [Shigella sonnei]
 gb|OCD72810.1| hypothetical protein AW026_10040 [Shigella sonnei]
 gb|OCD77765.1| hypothetical protein AW024_03165 [Shigella sonnei]
 gb|OCD81792.1| hypothetical protein AW025_01595 [Shigella sonnei]
 gb|OCD84533.1| hypothetical protein AW023_09785 [Shigella sonnei]
 gb|OCD88665.1| hypothetical protein AW021_06315 [Shigella sonnei]
 gb|OCD89605.1| hypothetical protein AW022_03390 [Shigella sonnei]
 gb|OCD99306.1| hypothetical protein AW019_00995 [Shigella sonnei]
 gb|OCE07105.1| hypothetical protein AW020_15715 [Shigella sonnei]
 gb|OCE10274.1| hypothetical protein AW018_12810 [Shigella sonnei]
 gb|OCE12598.1| hypothetical protein AW015_09485 [Shigella sonnei]
 gb|OCE20491.1| hypothetical protein AW017_15835 [Shigella sonnei]
 gb|OCE23743.1| hypothetical protein AW016_10675 [Shigella sonnei]
 gb|OCE26429.1| hypothetical protein AW014_05085 [Shigella sonnei]
 gb|OCE32335.1| hypothetical protein AW013_17435 [Shigella sonnei]
 gb|OCE35885.1| hypothetical protein AW012_13590 [Shigella sonnei]
 gb|OCE46123.1| hypothetical protein AW011_13590 [Shigella sonnei]
 gb|OCE47027.1| hypothetical protein AW006_14230 [Shigella sonnei]
 gb|OCE49146.1| hypothetical protein AW005_16855 [Shigella sonnei]
 gb|OCE50445.1| hypothetical protein AW002_10560 [Shigella sonnei]
 gb|OCE58736.1| hypothetical protein AW004_12725 [Shigella sonnei]
 gb|OCE60854.1| hypothetical protein AWZ83_17185 [Shigella sonnei]
 gb|OCE61098.1| hypothetical protein AWZ82_08365 [Shigella sonnei]
 gb|OCE64732.1| hypothetical protein AWZ81_10065 [Shigella sonnei]
 gb|OCE75935.1| hypothetical protein AWZ80_13020 [Shigella sonnei]
 gb|OCE81464.1| hypothetical protein AWZ79_18705 [Shigella sonnei]
 gb|OCE83978.1| hypothetical protein AWZ77_19665 [Shigella sonnei]
 gb|OCE87785.1| hypothetical protein AWZ78_14715 [Shigella sonnei]
 gb|OCE93844.1| hypothetical protein AWZ76_13665 [Shigella sonnei]
 gb|OCE97185.1| hypothetical protein AWZ75_15235 [Shigella sonnei]
 gb|OCE99545.1| hypothetical protein AWZ74_17685 [Shigella sonnei]
 gb|OCF05395.1| hypothetical protein AWZ72_02335 [Shigella sonnei]
 gb|OCF07342.1| hypothetical protein AWZ67_06775 [Shigella sonnei]
 gb|OCF08821.1| hypothetical protein AWZ71_15840 [Shigella sonnei]
 gb|OCF11602.1| hypothetical protein AWZ61_08935 [Shigella sonnei]
 gb|OCF13035.1| hypothetical protein AWZ68_18705 [Shigella sonnei]
 gb|OCJ85669.1| hypothetical protein BCM29_17080 [Escherichia coli]
 gb|OCJ90466.1| hypothetical protein BCF76_15740 [Escherichia coli]
 gb|OCJ93927.1| hypothetical protein BCH06_14095 [Escherichia coli]
 gb|OCJ96951.1| hypothetical protein BCD90_06230 [Escherichia coli]
 gb|OCK01557.1| hypothetical protein BCD89_01675 [Escherichia coli]
 gb|ANV96248.1| hypothetical protein BB344_21855 [Escherichia coli]
 gb|ANW30182.1| hypothetical protein BB405_15260 [Escherichia coli]
 gb|ANW42029.1| hypothetical protein A9L45_22260 [Escherichia coli O157:H7]
 gb|OCQ15059.1| membrane protein [Escherichia coli]
 gb|OCQ19407.1| hypothetical protein A6I94_02875 [Escherichia coli]
 gb|OCS54277.1| hypothetical protein BBZ49_18945 [Escherichia coli]
 gb|OCS57574.1| hypothetical protein BBZ53_16970 [Escherichia coli]
 gb|OCS62067.1| hypothetical protein BBZ52_16930 [Escherichia coli]
 gb|OCS72030.1| hypothetical protein BBZ54_16240 [Escherichia coli]
 gb|OCT10336.1| hypothetical protein ECO37_24650 [Escherichia coli]
 gb|AOD09780.1| hypothetical protein A7402_08875 [Escherichia coli]
 gb|ODA85492.1| hypothetical protein A9D65_08540 [Escherichia coli]
 gb|ODB43413.1| hypothetical protein A9J90_20160 [Escherichia coli]
 gb|ODG70241.1| hypothetical protein BFF42_19265 [Shigella sp. FC1661]
 gb|ODG75329.1| hypothetical protein BFF49_00905 [Shigella sp. FC2045]
 gb|ODG79092.1| hypothetical protein BFF47_11005 [Shigella sp. FC1764]
 gb|ODG79597.1| hypothetical protein BFF48_10510 [Shigella sp. FC1882]
 gb|ODG83359.1| hypothetical protein BFF50_00635 [Shigella sp. FC2928]
 gb|ODH18050.1| hypothetical protein A6V28_07200 [Escherichia coli]
 gb|ODH36843.1| hypothetical protein A6413_05600 [Escherichia coli]
 gb|ODH43449.1| hypothetical protein A6412_04800 [Escherichia coli]
 gb|ODJ28902.1| hypothetical protein BFR12_10190 [Shigella sp. FC2833]
 gb|ODJ30717.1| hypothetical protein BFR11_19190 [Shigella sp. FC2383]
 gb|ODJ36223.1| hypothetical protein A6I96_18500 [Escherichia coli]
 gb|ODJ40708.1| hypothetical protein A6I97_16545 [Escherichia coli]
 gb|AOM43698.1| Inner membrane protein YqjK [Escherichia coli]
 gb|AOM56265.1| hypothetical protein BCV59_18110 [Escherichia coli]
 gb|AOM59625.1| hypothetical protein CFSAN004177_08450 [Escherichia coli]
 gb|ODQ17657.1| hypothetical protein BGK49_15915 [Shigella sp. FC1544]
 gb|ODQ18847.1| hypothetical protein BGK52_19645 [Shigella sp. FC1056]
 gb|ODQ21289.1| hypothetical protein BGK53_19830 [Shigella sp. FC1139]
 gb|OEB98370.1| hypothetical protein AP216_13925 [Escherichia coli]
 gb|OEG26639.1| hypothetical protein BHQ32_10920 [Shigella sp. FC2117]
 gb|OEG26963.1| hypothetical protein BHQ35_10600 [Shigella sp. FC2175]
 gb|OEG27071.1| hypothetical protein BHQ33_10370 [Shigella sp. FC2125]
 gb|OEG39247.1| hypothetical protein BHQ38_10965 [Shigella sp. FC2710]
 gb|OEG48377.1| hypothetical protein BHQ36_16145 [Shigella sp. FC2531]
 gb|OEG49626.1| hypothetical protein BHQ37_16040 [Shigella sp. FC2541]
 gb|OEG53525.1| hypothetical protein BHQ39_15950 [Shigella sp. FC3196]
 gb|OEG68486.1| hypothetical protein A7H95_01900 [Escherichia coli]
 gb|OEI92526.1| hypothetical protein BHE85_10400 [Shigella sp. FC1567]
 gb|OEJ03835.1| hypothetical protein BHE87_16045 [Shigella sp. FC1708]
 gb|OEJ06228.1| hypothetical protein BHE88_16100 [Shigella sp. FC1737]
 gb|OEL43617.1| hypothetical protein BHF04_23400 [Escherichia coli]
 gb|OEL52019.1| hypothetical protein BHF07_22445 [Escherichia coli]
 gb|OEL67581.1| hypothetical protein BHF09_07705 [Escherichia coli]
 gb|OEL76094.1| hypothetical protein BHF10_04245 [Escherichia coli]
 gb|OEL83055.1| hypothetical protein BHF12_04440 [Escherichia coli]
 gb|OEL89919.1| hypothetical protein BHF14_06490 [Escherichia coli]
 gb|OEL92896.1| hypothetical protein BHF15_15090 [Escherichia coli]
 gb|OEL99376.1| hypothetical protein BHF16_07620 [Escherichia coli]
 gb|OEM02703.1| hypothetical protein BHF17_15155 [Escherichia coli]
 gb|OEM09985.1| hypothetical protein BHF19_11200 [Escherichia coli]
 gb|OEM14669.1| hypothetical protein BHF18_01390 [Escherichia coli]
 gb|OEM17122.1| hypothetical protein BHF21_16435 [Escherichia coli]
 gb|OEM17597.1| hypothetical protein BHF22_20820 [Escherichia coli]
 gb|OEM28734.1| hypothetical protein BHF24_12875 [Escherichia coli]
 gb|OEM36223.1| hypothetical protein BHF26_21130 [Escherichia coli]
 gb|OEM46343.1| hypothetical protein BHF27_14680 [Escherichia coli]
 gb|OEM51895.1| hypothetical protein BHF28_11235 [Escherichia coli]
 gb|OEM59158.1| hypothetical protein BHF29_04770 [Escherichia coli]
 gb|OEM61296.1| hypothetical protein BHF30_15995 [Escherichia coli]
 gb|OEM69024.1| hypothetical protein BHF32_16650 [Escherichia coli]
 gb|OEM79945.1| hypothetical protein BHF34_15285 [Escherichia coli]
 gb|OEM87113.1| hypothetical protein BHF35_07905 [Escherichia coli]
 gb|OEM92405.1| hypothetical protein BHF37_22530 [Escherichia coli]
 gb|OEN03213.1| hypothetical protein BHF39_10125 [Escherichia coli]
 gb|OEN10276.1| hypothetical protein BHF40_08605 [Escherichia coli]
 gb|OEN10846.1| hypothetical protein BHF42_25605 [Escherichia coli]
 gb|OEN25226.1| hypothetical protein BHF43_06345 [Escherichia coli]
 gb|OEN29133.1| hypothetical protein BHF45_10140 [Escherichia coli]
 gb|OEN36760.1| hypothetical protein BHF46_06860 [Escherichia coli]
 gb|OEN43206.1| hypothetical protein BHF47_06780 [Escherichia coli]
 gb|OEN51319.1| hypothetical protein BHF49_22465 [Escherichia coli]
 gb|OEN58551.1| hypothetical protein BHF50_07925 [Escherichia coli]
 gb|OEN65800.1| hypothetical protein BHF51_03885 [Escherichia coli]
 gb|OEN69495.1| hypothetical protein BHF52_07295 [Escherichia coli]
 gb|OEN91990.1| hypothetical protein BHF57_22350 [Escherichia coli]
 gb|OEN97800.1| hypothetical protein BHF59_05155 [Escherichia coli]
 gb|OEN97930.1| hypothetical protein BHF58_06655 [Escherichia coli]
 gb|OEO12093.1| hypothetical protein BHF61_07185 [Escherichia coli]
 gb|OEO14572.1| hypothetical protein BHF23_22125 [Escherichia coli]
 gb|OEO20069.1| hypothetical protein BHF62_07295 [Escherichia coli]
 gb|AOV19982.1| hypothetical protein A4C50_03720 [Escherichia coli O157:H7]
 gb|AOV25338.1| hypothetical protein A4C44_03720 [Escherichia coli O157:H7]
 gb|AOV30688.1| hypothetical protein A4C45_03720 [Escherichia coli O157:H7]
 gb|AOV36060.1| hypothetical protein A4C38_03740 [Escherichia coli O157:H7]
 gb|AOV41468.1| hypothetical protein A4C51_03720 [Escherichia coli O157:H7]
 gb|AOV46817.1| hypothetical protein A4C39_03745 [Escherichia coli O157:H7]
 gb|AOV52229.1| hypothetical protein A4C47_03720 [Escherichia coli O157:H7]
 gb|OFE30192.1| hypothetical protein BBJ27_20025 [Escherichia coli]
 emb|SDP14360.1| YqjK-like protein [Shigella sonnei]
 gb|AOX50581.1| hypothetical protein BHW76_03490 [Escherichia coli]
 gb|AOX55984.1| hypothetical protein BHW77_03490 [Escherichia coli]
 gb|OHV10971.1| hypothetical protein BKN13_10125 [Escherichia coli]
 emb|SEQ33952.1| YqjK-like protein [Escherichia coli]
 gb|OII50658.1| hypothetical protein BFX81_07195 [Escherichia coli]
 gb|OII55465.1| hypothetical protein BFX01_08190 [Escherichia coli]
 gb|APA40518.1| hypothetical protein AU473_06205 [Escherichia coli]
 gb|OII98563.1| hypothetical protein BHF03_08265 [Escherichia coli]
 gb|OIJ07744.1| hypothetical protein BHF01_07535 [Escherichia coli]
 gb|OIU74897.1| hypothetical protein BGM14_14795 [Escherichia coli]
 gb|OIU81754.1| hypothetical protein BGM15_00845 [Escherichia coli]
 gb|OIY21908.1| hypothetical protein BJK29_03195 [Escherichia coli]
 gb|OIY29195.1| hypothetical protein BJK26_05230 [Escherichia coli]
 gb|OIY32396.1| hypothetical protein BJK38_07765 [Escherichia coli]
 gb|OIY45016.1| hypothetical protein BJK34_05595 [Escherichia coli]
 gb|OIY48014.1| hypothetical protein BJK28_15480 [Escherichia coli]
 gb|OIY49339.1| hypothetical protein BJK31_06010 [Escherichia coli]
 gb|OIY51258.1| hypothetical protein BJK27_12590 [Escherichia coli]
 gb|OIY60548.1| hypothetical protein BJK36_03290 [Escherichia coli]
 gb|OIY64774.1| hypothetical protein BJK24_12035 [Escherichia coli]
 gb|OIY71024.1| hypothetical protein BJK35_07690 [Escherichia coli]
 gb|OIY72691.1| hypothetical protein BJK39_07745 [Escherichia coli]
 gb|OIY77359.1| hypothetical protein BJK25_10870 [Escherichia coli]
 gb|OIY82728.1| hypothetical protein BJK44_19005 [Escherichia coli]
 gb|OIY87741.1| hypothetical protein BJK30_09380 [Escherichia coli]
 gb|OIY92365.1| hypothetical protein BJK32_10555 [Escherichia coli]
 gb|OIY94140.1| hypothetical protein BJK33_10700 [Escherichia coli]
 gb|OIZ02655.1| hypothetical protein BJK41_04925 [Escherichia coli]
 gb|OIZ06804.1| hypothetical protein BJK40_06560 [Escherichia coli]
 gb|OIZ11767.1| hypothetical protein BJK43_18000 [Escherichia coli]
 gb|OIZ18139.1| hypothetical protein BJK23_04170 [Escherichia coli]
 gb|OIZ19051.1| hypothetical protein BJK37_11565 [Escherichia coli]
 gb|OIZ28772.1| hypothetical protein BJK42_03870 [Escherichia coli]
 gb|OIZ73864.1| hypothetical protein BM756_07710 [Escherichia coli]
 gb|OIZ81992.1| hypothetical protein BM751_16465 [Escherichia coli]
 gb|OIZ90531.1| hypothetical protein BMW25_03870 [Escherichia coli]
 gb|OIZ91567.1| hypothetical protein BMS05_20350 [Escherichia coli]
 gb|OJF21704.1| hypothetical protein AUR51_18845 [Escherichia coli]
 gb|OJF25616.1| hypothetical protein AV889_18735 [Escherichia coli]
 gb|OJF27596.1| hypothetical protein AP219_18775 [Escherichia coli]
 gb|OJF37456.1| hypothetical protein AP220_18865 [Escherichia coli]
 gb|OJF38921.1| hypothetical protein AUR53_18865 [Escherichia coli]
 gb|OJF47775.1| hypothetical protein AP221_18870 [Escherichia coli]
 gb|OJF54093.1| hypothetical protein AUR52_19905 [Escherichia coli]
 gb|OJF55124.1| hypothetical protein AP222_18675 [Escherichia coli]
 gb|OJF63799.1| hypothetical protein AUR50_18605 [Escherichia coli]
 gb|OJF88034.1| hypothetical protein AQF51_04375 [Escherichia coli]
 emb|SHD59710.1| conserved hypothetical protein [Escherichia coli]
 gb|APE90419.1| Inner membrane protein YqjK [Escherichia coli]
 gb|API00083.1| hypothetical protein BFL20_21680 [Escherichia coli]
 gb|API05760.1| hypothetical protein BFL22_21795 [Escherichia coli]
 gb|API11313.1| hypothetical protein BFL24_21505 [Escherichia coli]
 gb|API16913.1| hypothetical protein BFL21_21480 [Escherichia coli]
 gb|API22561.1| hypothetical protein BFL23_22200 [Escherichia coli]
 gb|API28050.1| hypothetical protein BFL18_21265 [Escherichia coli]
 gb|API33715.1| hypothetical protein BFL16_22275 [Escherichia coli]
 gb|API39210.1| hypothetical protein BFL17_21215 [Escherichia coli]
 gb|API49040.1| hypothetical protein BSZ13_21190 [Escherichia coli]
 gb|OJK15630.1| hypothetical protein BK236_21690 [Escherichia coli]
 gb|OJK15985.1| hypothetical protein BK237_10960 [Escherichia coli]
 gb|OJK16724.1| hypothetical protein BK238_11115 [Escherichia coli]
 gb|OJK29308.1| hypothetical protein BK239_02990 [Escherichia coli]
 gb|OJK32984.1| hypothetical protein BK240_22160 [Escherichia coli]
 gb|OJK37877.1| hypothetical protein BK241_08345 [Escherichia coli]
 gb|OJK39198.1| hypothetical protein BK242_13920 [Escherichia coli]
 gb|OJK50488.1| hypothetical protein BK243_16515 [Escherichia coli]
 gb|OJK52863.1| hypothetical protein BK245_03805 [Escherichia coli]
 gb|OJK59764.1| hypothetical protein BK246_21910 [Escherichia coli]
 gb|OJK61368.1| hypothetical protein BK244_05835 [Escherichia coli]
 gb|OJK66674.1| hypothetical protein BK247_22560 [Escherichia coli]
 gb|OJK82867.1| hypothetical protein BK249_02805 [Escherichia coli]
 gb|OJK86381.1| hypothetical protein BK250_07280 [Escherichia coli]
 gb|OJK95623.1| hypothetical protein BK251_12755 [Escherichia coli]
 gb|OJL05475.1| hypothetical protein BK254_09885 [Escherichia coli]
 gb|OJL08269.1| hypothetical protein BK253_08170 [Escherichia coli]
 gb|OJL09465.1| hypothetical protein BK255_12130 [Escherichia coli]
 gb|OJL23183.1| hypothetical protein BK258_09185 [Escherichia coli]
 gb|OJL35853.1| hypothetical protein BK259_10080 [Escherichia coli]
 gb|OJL36059.1| hypothetical protein BK260_08935 [Escherichia coli]
 gb|OJL40418.1| hypothetical protein BK263_21170 [Escherichia coli]
 gb|OJL50109.1| hypothetical protein BK262_22600 [Escherichia coli]
 gb|OJL50977.1| hypothetical protein BK264_02770 [Escherichia coli]
 gb|OJL59303.1| hypothetical protein BK261_01380 [Escherichia coli]
 gb|OJL69035.1| hypothetical protein BK267_05390 [Escherichia coli]
 gb|OJL74767.1| hypothetical protein BK269_08595 [Escherichia coli]
 gb|OJL79439.1| hypothetical protein BK266_22285 [Escherichia coli]
 gb|OJL89481.1| hypothetical protein BK270_11030 [Escherichia coli]
 gb|OJL98177.1| hypothetical protein BK272_03275 [Escherichia coli]
 gb|OJM06866.1| hypothetical protein BK274_11610 [Escherichia coli]
 gb|OJM07142.1| hypothetical protein BK273_10145 [Escherichia coli]
 gb|OJM15427.1| hypothetical protein BK276_16215 [Escherichia coli]
 gb|OJM25074.1| hypothetical protein BK277_04315 [Escherichia coli]
 gb|OJM25263.1| hypothetical protein BK275_00500 [Escherichia coli]
 gb|OJM31879.1| hypothetical protein BK279_16830 [Escherichia coli]
 gb|OJM36402.1| hypothetical protein BK280_10265 [Escherichia coli]
 gb|OJM52087.1| hypothetical protein BK281_01890 [Escherichia coli]
 gb|OJM52981.1| hypothetical protein BK282_03040 [Escherichia coli]
 gb|OJM54532.1| hypothetical protein BK283_16225 [Escherichia coli]
 gb|OJM65416.1| hypothetical protein BK285_02690 [Escherichia coli]
 gb|OJM72112.1| hypothetical protein BK286_09295 [Escherichia coli]
 gb|OJM80023.1| hypothetical protein BK288_08300 [Escherichia coli]
 gb|OJM90514.1| hypothetical protein BK291_12785 [Escherichia coli]
 gb|OJM93213.1| hypothetical protein BK289_02415 [Escherichia coli]
 gb|OJM95846.1| hypothetical protein BK292_10675 [Escherichia coli]
 gb|OJN07741.1| hypothetical protein BK295_15310 [Escherichia coli]
 gb|OJN13232.1| hypothetical protein BK294_01585 [Escherichia coli]
 gb|OJN16633.1| hypothetical protein BK296_12595 [Escherichia coli]
 gb|OJN22550.1| hypothetical protein BK298_13220 [Escherichia coli]
 gb|OJN29374.1| hypothetical protein BK299_14950 [Escherichia coli]
 gb|OJN31305.1| hypothetical protein BK297_06645 [Escherichia coli]
 gb|OJN37630.1| hypothetical protein BK300_11875 [Escherichia coli]
 gb|OJN48594.1| hypothetical protein BK301_04820 [Escherichia coli]
 gb|OJN49879.1| hypothetical protein BK302_02095 [Escherichia coli]
 gb|OJN57523.1| hypothetical protein BK304_11885 [Escherichia coli]
 gb|OJN62538.1| hypothetical protein BK305_04050 [Escherichia coli]
 gb|OJN66529.1| hypothetical protein BK306_08455 [Escherichia coli]
 gb|OJN72842.1| hypothetical protein BK307_15645 [Escherichia coli]
 gb|OJN78116.1| hypothetical protein BK309_12795 [Escherichia coli]
 gb|OJN82376.1| hypothetical protein BK290_19385 [Escherichia coli]
 gb|OJN87108.1| hypothetical protein BK310_19820 [Escherichia coli]
 gb|OJN97173.1| hypothetical protein BK308_12715 [Escherichia coli]
 gb|OJN98061.1| hypothetical protein BK311_10680 [Escherichia coli]
 gb|OJO09859.1| hypothetical protein BK313_13005 [Escherichia coli]
 gb|OJO17116.1| hypothetical protein BK314_11200 [Escherichia coli]
 gb|OJO36002.1| hypothetical protein BK317_01005 [Escherichia coli]
 gb|OJO37052.1| hypothetical protein BK318_05990 [Escherichia coli]
 gb|OJO42620.1| hypothetical protein BK320_19270 [Escherichia coli]
 gb|OJO55835.1| hypothetical protein BK321_00700 [Escherichia coli]
 gb|OJO78974.1| hypothetical protein BK327_07215 [Escherichia coli]
 gb|OJO80636.1| hypothetical protein BK326_01610 [Escherichia coli]
 gb|OJP17687.1| hypothetical protein BK336_16800 [Escherichia coli]
 gb|OJP19808.1| hypothetical protein BK335_22600 [Escherichia coli]
 gb|OJP34056.1| hypothetical protein BK338_11375 [Escherichia coli]
 gb|OJP35750.1| hypothetical protein BK339_17450 [Escherichia coli]
 gb|OJP46533.1| hypothetical protein BK340_07945 [Escherichia coli]
 gb|OJP77098.1| hypothetical protein BK347_10330 [Escherichia coli]
 gb|OJP90924.1| hypothetical protein BK349_07160 [Escherichia coli]
 gb|OJP92698.1| hypothetical protein BK351_25590 [Escherichia coli]
 gb|OJQ04920.1| hypothetical protein BK350_07390 [Escherichia coli]
 gb|OJQ14588.1| hypothetical protein BK355_16510 [Escherichia coli]
 gb|OJQ15423.1| hypothetical protein BK353_01990 [Escherichia coli]
 gb|OJQ23122.1| hypothetical protein BK357_17935 [Escherichia coli]
 gb|OJQ30765.1| hypothetical protein BK358_13150 [Escherichia coli]
 gb|OJQ36109.1| hypothetical protein BK360_20515 [Escherichia coli]
 gb|OJQ39332.1| hypothetical protein BK359_03610 [Escherichia coli]
 gb|OJQ51566.1| hypothetical protein BK362_20550 [Escherichia coli]
 gb|OJQ52677.1| hypothetical protein BK361_00840 [Escherichia coli]
 gb|OJQ60948.1| hypothetical protein BK365_12580 [Escherichia coli]
 gb|OJQ66576.1| hypothetical protein BK366_21870 [Escherichia coli]
 gb|OJQ74212.1| hypothetical protein BK367_16970 [Escherichia coli]
 gb|OJQ77431.1| hypothetical protein BK368_10275 [Escherichia coli]
 gb|OJQ80662.1| hypothetical protein BK369_23810 [Escherichia coli]
 gb|OJR07514.1| hypothetical protein BK374_15825 [Escherichia coli]
 gb|OJR14066.1| hypothetical protein BK375_16850 [Escherichia coli]
 gb|OJR22909.1| hypothetical protein BK377_05300 [Escherichia coli]
 gb|OJR30653.1| hypothetical protein BK378_16815 [Escherichia coli]
 gb|OJR32849.1| hypothetical protein BK379_12050 [Escherichia coli]
 gb|OJR41151.1| hypothetical protein BK380_00680 [Escherichia coli]
 gb|OJR48671.1| hypothetical protein BK382_04660 [Escherichia coli]
 gb|OJR49333.1| hypothetical protein BK381_10740 [Escherichia coli]
 gb|OJR53912.1| hypothetical protein BK383_15530 [Escherichia coli]
 gb|OJR59941.1| hypothetical protein BK385_13360 [Escherichia coli]
 gb|OJR75536.1| hypothetical protein BK388_12790 [Escherichia coli]
 gb|OJR91486.1| hypothetical protein BK387_16855 [Escherichia coli]
 gb|OJS04083.1| hypothetical protein BK394_22155 [Escherichia coli]
 gb|OJS05205.1| hypothetical protein BK391_01830 [Escherichia coli]
 gb|OJS07149.1| hypothetical protein BK393_11215 [Escherichia coli]
 gb|OJS14351.1| hypothetical protein BK395_02135 [Escherichia coli]
 gb|OJS21608.1| hypothetical protein BK398_15410 [Escherichia coli]
 gb|OJS28127.1| hypothetical protein BK396_11645 [Escherichia coli]
 gb|OJS39977.1| hypothetical protein BK401_05035 [Escherichia coli]
 gb|OJS41367.1| hypothetical protein BK399_06320 [Escherichia coli]
 gb|OJS46568.1| hypothetical protein BK402_10380 [Escherichia coli]
 gb|OJS48095.1| hypothetical protein BK403_19690 [Escherichia coli]
 gb|OJS61678.1| hypothetical protein BK405_00820 [Escherichia coli]
 gb|OJS69540.1| hypothetical protein BK407_03340 [Escherichia coli]
 gb|OJS79816.1| hypothetical protein BK408_02835 [Escherichia coli]
 gb|OJS87777.1| hypothetical protein BK400_20505 [Escherichia coli]
 gb|OJZ26745.1| hypothetical protein BSO19_21860 [Escherichia coli]
 gb|APJ59897.1| membrane protein [Escherichia coli]
 gb|APJ64055.1| membrane protein [Escherichia coli]
 gb|APJ66892.1| membrane protein [Escherichia coli]
 gb|APJ78510.1| membrane protein [Escherichia coli]
 gb|APJ83718.1| membrane protein [Escherichia coli]
 gb|APJ89589.1| membrane protein [Escherichia coli]
 gb|APJ96791.1| membrane protein [Escherichia coli]
 gb|APK02084.1| membrane protein [Escherichia coli]
 gb|APK04901.1| membrane protein [Escherichia coli]
 gb|APK12411.1| membrane protein [Escherichia coli]
 gb|APK20793.1| membrane protein [Escherichia coli]
 gb|APK25678.1| membrane protein [Escherichia coli]
 gb|APK30535.1| membrane protein [Escherichia coli]
 gb|APK48281.1| membrane protein [Escherichia coli]
 gb|APK59625.1| membrane protein [Escherichia coli]
 gb|APK81378.1| membrane protein [Escherichia coli]
 gb|APK84818.1| membrane protein [Escherichia coli]
 gb|APK90325.1| membrane protein [Escherichia coli]
 gb|APK94044.1| membrane protein [Escherichia coli]
 gb|APK99482.1| membrane protein [Escherichia coli]
 gb|APL04834.1| membrane protein [Escherichia coli]
 gb|APL08755.1| membrane protein [Escherichia coli]
 gb|APL14617.1| membrane protein [Escherichia coli]
 gb|APL18242.1| membrane protein [Escherichia coli]
 gb|APL25627.1| membrane protein [Escherichia coli]
 gb|APL26843.1| membrane protein [Escherichia coli]
 gb|APL33191.1| membrane protein [Escherichia coli]
 gb|APL40518.1| membrane protein [Escherichia coli]
 gb|APL41276.1| membrane protein [Escherichia coli]
 gb|APL45732.1| membrane protein [Escherichia coli]
 gb|APL57108.1| membrane protein [Escherichia coli]
 gb|APL64599.1| membrane protein [Escherichia coli]
 gb|APL67845.1| membrane protein [Escherichia coli]
 gb|APL71861.1| membrane protein [Escherichia coli]
 gb|APL75807.1| membrane protein [Escherichia coli]
 gb|APL79409.1| membrane protein [Escherichia coli]
 gb|APL85154.1| membrane protein [Escherichia coli]
 gb|APL88788.1| membrane protein [Escherichia coli]
 gb|APL51987.1| membrane protein [Escherichia coli]
 gb|OKA62375.1| hypothetical protein BHL56_22470 [Escherichia coli]
 gb|OKB70665.1| hypothetical protein BMT49_26020 [Escherichia coli]
 gb|OKB73687.1| hypothetical protein BMT50_13295 [Escherichia coli]
 gb|OKB84294.1| hypothetical protein BMT52_05000 [Escherichia coli]
 gb|OKB91382.1| hypothetical protein BMT53_18630 [Escherichia coli]
 gb|OKB94203.1| hypothetical protein BMT51_06705 [Escherichia coli]
 gb|OKL97189.1| hypothetical protein AM427_003318 [Escherichia coli]
 gb|OKO60094.1| hypothetical protein BSF34_17295 [Escherichia coli]
 gb|OKS97673.1| hypothetical protein ACN56_03565 [Escherichia coli]
 gb|OKT17733.1| hypothetical protein ACN61_07120 [Escherichia coli]
 gb|OKT35589.1| hypothetical protein ACN62_04295 [Escherichia coli]
 gb|OKT49923.1| hypothetical protein ACN65_07615 [Escherichia coli]
 gb|OKT58590.1| hypothetical protein ACN73_17790 [Escherichia coli]
 gb|OKT63096.1| hypothetical protein ACN71_25685 [Escherichia coli]
 gb|OKT73579.1| hypothetical protein ACN68_05060 [Escherichia coli]
 gb|OKT76196.1| hypothetical protein ACN67_08590 [Escherichia coli]
 gb|OKT84215.1| hypothetical protein ACN69_11550 [Escherichia coli]
 gb|OKU03536.1| hypothetical protein ACN72_02510 [Escherichia coli]
 gb|OKU13233.1| hypothetical protein ACN77_10375 [Escherichia coli]
 gb|OKU17337.1| hypothetical protein ACN81_21675 [Escherichia coli]
 gb|OKU20156.1| hypothetical protein ACN76_14590 [Escherichia coli]
 gb|OKU28023.1| hypothetical protein ACN78_09705 [Escherichia coli]
 gb|OKU35029.1| hypothetical protein ACN79_19930 [Escherichia coli]
 gb|OKU39065.1| hypothetical protein ACN84_11155 [Escherichia coli]
 gb|OKU42904.1| hypothetical protein ACN83_09270 [Escherichia coli]
 gb|OKU49888.1| hypothetical protein ACN86_14450 [Escherichia coli]
 gb|OKU54982.1| hypothetical protein ACN82_11350 [Escherichia coli]
 gb|OKU65721.1| hypothetical protein AWP45_26030 [Escherichia coli]
 gb|OKU65914.1| hypothetical protein ACN85_05235 [Escherichia coli]
 gb|OKU78753.1| hypothetical protein AWP48_09490 [Escherichia coli]
 gb|OKU86601.1| hypothetical protein AWP50_10520 [Escherichia coli]
 gb|OKU89588.1| hypothetical protein AWP46_26240 [Escherichia coli]
 gb|OKU93264.1| hypothetical protein ACN87_11635 [Escherichia coli]
 gb|OKV00519.1| hypothetical protein AWP53_12455 [Escherichia coli]
 gb|OKV06874.1| hypothetical protein AWP47_20715 [Escherichia coli]
 gb|OKV09154.1| hypothetical protein AWP51_26490 [Escherichia coli]
 gb|OKV19693.1| hypothetical protein AWP54_25795 [Escherichia coli]
 gb|OKV27366.1| hypothetical protein AWP49_19885 [Escherichia coli]
 gb|OKV33631.1| hypothetical protein AWP56_25180 [Escherichia coli]
 gb|OKV36670.1| hypothetical protein AWP55_06155 [Escherichia coli]
 gb|OKV44961.1| hypothetical protein AWP59_18055 [Escherichia coli]
 gb|OKV56788.1| hypothetical protein AWP62_02680 [Escherichia coli]
 gb|OKV58550.1| hypothetical protein AWP61_26295 [Escherichia coli]
 gb|OKV67346.1| hypothetical protein AWP63_06820 [Escherichia coli]
 gb|OKV71420.1| hypothetical protein AWP60_25925 [Escherichia coli]
 gb|OKV84824.1| hypothetical protein AWP66_12405 [Escherichia coli]
 gb|OKV90220.1| hypothetical protein AWP67_11050 [Escherichia coli]
 gb|OKV98873.1| hypothetical protein AWP69_26455 [Escherichia coli]
 gb|OKW12155.1| hypothetical protein AWP75_25690 [Escherichia coli]
 gb|OKW21244.1| hypothetical protein AWP70_11380 [Escherichia coli]
 gb|OKW22889.1| hypothetical protein AWP72_03100 [Escherichia coli]
 gb|OKW29829.1| hypothetical protein AWP71_16470 [Escherichia coli]
 gb|OKW30961.1| hypothetical protein AWP74_15400 [Escherichia coli]
 gb|OKW36157.1| hypothetical protein AWP77_18035 [Escherichia coli]
 gb|OKW46058.1| hypothetical protein AWP79_16560 [Escherichia coli]
 gb|OKW47352.1| hypothetical protein AWP78_11490 [Escherichia coli]
 gb|OKW52236.1| hypothetical protein AWP76_19520 [Escherichia coli]
 gb|OKW59055.1| hypothetical protein AWP83_18680 [Escherichia coli]
 gb|OKW69010.1| hypothetical protein AWP73_10370 [Escherichia coli]
 gb|OKW69404.1| hypothetical protein AWP82_09235 [Escherichia coli]
 gb|OKW73707.1| hypothetical protein AWP84_13615 [Escherichia coli]
 gb|OKW77363.1| hypothetical protein AWP85_25055 [Escherichia coli]
 gb|OKW85272.1| hypothetical protein AWP81_08460 [Escherichia coli]
 gb|OKW89536.1| hypothetical protein AWP88_19850 [Escherichia coli]
 gb|OKW98654.1| hypothetical protein AWP87_10875 [Escherichia coli]
 gb|OKX04483.1| hypothetical protein AWP80_06955 [Escherichia coli]
 gb|OKX04735.1| hypothetical protein AWP89_18945 [Escherichia coli]
 gb|OKX23487.1| hypothetical protein AWP90_17030 [Escherichia coli]
 gb|OKX27968.1| hypothetical protein AWP96_05950 [Escherichia coli]
 gb|OKX31908.1| hypothetical protein AWQ00_27085 [Escherichia coli]
 gb|OKX51206.1| hypothetical protein AWP97_13895 [Escherichia coli]
 gb|OKX57286.1| hypothetical protein AWP99_05380 [Escherichia coli]
 gb|OKX62153.1| hypothetical protein AWP95_26735 [Escherichia coli]
 gb|OKX66584.1| hypothetical protein AWP98_13880 [Escherichia coli]
 gb|OLN76883.1| membrane protein [Escherichia coli]
 gb|APT60854.1| hypothetical protein BUE82_02145 [Escherichia coli]
 gb|OLS72721.1| hypothetical protein BJD19_14755 [Escherichia coli]
 gb|OLS74022.1| hypothetical protein BJG04_13575 [Escherichia coli]
 gb|OLS75257.1| hypothetical protein BJG07_10140 [Escherichia coli]
 gb|OLS88834.1| hypothetical protein BJG06_09130 [Escherichia coli]
 gb|OLS92252.1| hypothetical protein BJG05_09535 [Escherichia coli]
 gb|OLT03084.1| hypothetical protein BJG08_08070 [Escherichia coli]
 gb|OLY57833.1| hypothetical protein BM748_004700 [Escherichia coli]
 gb|OLY87725.1| hypothetical protein A8O33_07045 [Escherichia coli O157:H43]
 gb|OMI42313.1| membrane protein [Escherichia coli N37058PS]
 gb|OMI53065.1| membrane protein [Escherichia coli N37122PS]
 gb|OMI57057.1| membrane protein [Escherichia coli N40607]
 gb|OMI63849.1| membrane protein [Escherichia coli N37139PS]
 gb|OMI64074.1| membrane protein [Escherichia coli N36410PS]
 gb|OMI70695.1| membrane protein [Escherichia coli N36254PS]
 emb|SIX88118.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX54898.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD35828.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC61582.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB60960.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC78035.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY14332.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ19126.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY06372.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH76225.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD21002.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB72443.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC72474.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC90159.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX98445.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB42492.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC20595.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC78045.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC53485.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC11994.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX85658.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC44944.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB61959.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX69053.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI72557.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY01378.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH90443.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB13816.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI22544.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB61762.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH77551.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX63014.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH78522.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB62061.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB55976.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB84432.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB90981.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB75240.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC31527.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI33888.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC82052.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB88138.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI34821.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX77489.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC22380.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ16654.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX24156.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX85053.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX58056.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX67170.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX25975.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI95892.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI50492.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX62848.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA78541.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA63387.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ42091.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD50738.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY13555.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA10260.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG72641.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI17486.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG04169.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI21946.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY07389.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB59446.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH80833.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI41539.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH42000.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX16042.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB37242.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG82307.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI24247.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC89589.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC59025.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC21725.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG65463.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA09592.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH32751.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH20121.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ18555.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ84199.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA08198.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX57548.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG41606.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA20297.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ50518.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA04638.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG88206.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH43728.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ14744.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ47826.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK33099.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA33825.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB90528.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ12149.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB59911.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF53595.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY16497.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX54699.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ70881.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA20811.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH86093.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ15083.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX74308.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA03827.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY03779.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI33284.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ13848.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK39485.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX59712.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB24793.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH51562.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ51388.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH25021.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK65606.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY29607.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX59774.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI81534.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA30209.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK36964.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK59556.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ10121.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX85386.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ55622.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ20791.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX63085.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI59791.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI53842.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI22587.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX53160.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ45457.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ02058.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI30349.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY17125.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG47880.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY92932.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB73525.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ21850.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB69888.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY33414.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC68128.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ03310.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI59209.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH63626.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ48995.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX54666.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK29719.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI66066.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX77297.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI87068.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ91003.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA05417.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ65674.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX57864.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX94357.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI69552.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI62630.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB73800.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ45767.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI86007.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH12100.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG53417.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI97159.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB20007.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB42105.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX44501.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ24861.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ85522.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY38796.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX44577.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG76599.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX25415.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI54219.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ61634.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ73288.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG79328.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH13853.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI80229.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY84483.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK02333.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH98993.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB75316.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ18702.1| Uncharacterised protein [Shigella sonnei]
 emb|SIW65090.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY37990.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE97639.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI67896.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY95862.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ37536.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK18004.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF54515.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA08477.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ55089.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB04231.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI93337.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI87293.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK25510.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY42000.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ49697.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ12885.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH22103.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA19426.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ31227.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG79327.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ90644.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI13539.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ18833.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG51165.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB29981.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB77470.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC09162.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ35854.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF28643.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI55720.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ78606.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG44949.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF72490.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD37682.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF24955.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB30119.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF50447.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG56017.1| Uncharacterised protein [Shigella sonnei]
 emb|SJA85880.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ63979.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI92436.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB96338.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG01961.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF47536.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC03609.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ74580.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG75709.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI94412.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ78438.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG38330.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG79271.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF34414.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB76310.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ65466.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX33574.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH10738.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE77734.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF24048.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF21178.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG44728.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG05255.1| Uncharacterised protein [Shigella sonnei]
 emb|SJB58768.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG75422.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK37852.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX93988.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD86806.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX31778.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC51520.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY44865.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF45419.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY33539.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE01356.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG56146.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF30300.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG25236.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG85839.1| Uncharacterised protein [Shigella sonnei]
 emb|SIY97093.1| Uncharacterised protein [Shigella sonnei]
 emb|SJI67953.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG76104.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE01982.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ31666.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD73779.1| Uncharacterised protein [Shigella sonnei]
 emb|SJH42739.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD98440.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG03832.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE87848.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE08729.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD80228.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE80879.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG92349.1| Uncharacterised protein [Shigella sonnei]
 emb|SIX65759.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG04024.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK05985.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ84317.1| Uncharacterised protein [Shigella sonnei]
 emb|SIZ07372.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG55683.1| Uncharacterised protein [Shigella sonnei]
 emb|SJJ97160.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD85949.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE23796.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD77950.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE54847.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD22041.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD38388.1| Uncharacterised protein [Shigella sonnei]
 emb|SJC75531.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD60423.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE90364.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG45361.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD52884.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE00094.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE69146.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF62714.1| Uncharacterised protein [Shigella sonnei]
 emb|SJF05976.1| Uncharacterised protein [Shigella sonnei]
 emb|SJG05590.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE31528.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE70843.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD72703.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE56617.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE09572.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE29296.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE61983.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE57249.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD68456.1| Uncharacterised protein [Shigella sonnei]
 emb|SJK26009.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE20582.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD36218.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD68116.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD39968.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE63428.1| Uncharacterised protein [Shigella sonnei]
 emb|SJD43173.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE25978.1| Uncharacterised protein [Shigella sonnei]
 emb|SJE44740.1| Uncharacterised protein [Shigella sonnei]
 gb|ONF85266.1| hypothetical protein BZL66_11030 [Escherichia coli]
 gb|ONG03248.1| hypothetical protein BWR13_23955 [Escherichia coli]
 gb|ONG30580.1| hypothetical protein BXT93_22735 [Escherichia coli]
 gb|ONG33851.1| hypothetical protein BXT95_00615 [Escherichia coli]
 gb|ONK40935.1| hypothetical protein BZ158_00390 [Escherichia coli]
 gb|ONK42973.1| hypothetical protein BZ157_01935 [Escherichia coli]
 emb|SJM04150.1| Uncharacterised protein [Shigella sonnei]
 emb|SJL96091.1| Uncharacterised protein [Shigella sonnei]
 emb|SJM03845.1| Uncharacterised protein [Shigella sonnei]
 emb|SJM04939.1| Uncharacterised protein [Shigella sonnei]
 emb|SJM04619.1| Uncharacterised protein [Shigella sonnei]
 emb|SJM03640.1| Uncharacterised protein [Shigella sonnei]
 emb|SJM21915.1| Uncharacterised protein [Shigella sonnei]
 gb|OOC67539.1| hypothetical protein BWP13_15730 [Escherichia coli]
 gb|OOC70315.1| hypothetical protein BWP21_18280 [Escherichia coli]
 gb|OOC82959.1| hypothetical protein BWP17_06870 [Escherichia coli]
 gb|OOG31313.1| hypothetical protein ICBEC72H_13635 [Escherichia coli]
 gb|OOH59596.1| hypothetical protein BMT64_16725 [Escherichia coli]
 gb|OOH65577.1| hypothetical protein BMT65_10290 [Escherichia coli]
 gb|OOH90390.1| hypothetical protein BMT63_08085 [Escherichia coli]
 gb|OOI32287.1| hypothetical protein BMT61_17235 [Escherichia coli]
 gb|OOI33396.1| hypothetical protein BMT60_09615 [Escherichia coli]
 gb|OOI44971.1| hypothetical protein BMT62_09590 [Escherichia coli]
 gb|OOI81226.1| hypothetical protein BMT81_15160 [Escherichia coli]
 gb|OOI90017.1| hypothetical protein BMT88_07075 [Escherichia coli]
 gb|OOI99215.1| hypothetical protein BMT76_01995 [Escherichia coli]
 gb|OOJ41936.1| hypothetical protein BMT79_11825 [Escherichia coli]
 gb|OOJ52417.1| hypothetical protein BMT77_01995 [Escherichia coli]
 gb|OOJ62815.1| hypothetical protein BMT84_08695 [Escherichia coli]
 gb|OOJ76562.1| hypothetical protein BMT82_03065 [Escherichia coli]
 gb|OOJ96555.1| hypothetical protein BMT78_07630 [Escherichia coli]
 gb|OOK02348.1| hypothetical protein BMT80_11575 [Escherichia coli]
 gb|OOK21699.1| hypothetical protein BMT83_10695 [Escherichia coli]
 gb|OOK29063.1| hypothetical protein BMT91_08785 [Escherichia coli]
 gb|OON45345.1| hypothetical protein BV389_22370 [Escherichia coli]
 gb|OOO83283.1| hypothetical protein AJR18_003155 [Shigella boydii]
 gb|OOO84645.1| hypothetical protein AJR17_002010 [Shigella boydii]
 gb|OOO86228.1| hypothetical protein AJR32_002580 [Shigella sonnei]
 gb|OOO89395.1| hypothetical protein AJR19_014935 [Shigella dysenteriae]
 gb|OOO89870.1| hypothetical protein AJR20_014560 [Shigella dysenteriae]
 gb|OOO97139.1| hypothetical protein AJR21_009435 [Shigella dysenteriae]
 gb|OOP01419.1| hypothetical protein AJR22_015900 [Shigella flexneri]
 gb|OOP05032.1| hypothetical protein AJR23_010325 [Shigella flexneri]
 gb|OOP09848.1| hypothetical protein AJR24_010195 [Shigella flexneri]
 gb|OOP13471.1| hypothetical protein AJR26_017435 [Shigella flexneri]
 gb|OOP13651.1| hypothetical protein AJR27_023095 [Shigella flexneri]
 gb|OOP30735.1| hypothetical protein AJR29_005605 [Shigella flexneri]
 gb|OOP36587.1| hypothetical protein AJR31_002715 [Shigella sonnei]
 gb|OOP37485.1| hypothetical protein AJR30_021620 [Shigella flexneri]
 gb|AQV18906.1| hypothetical protein BE957_06855 [Escherichia coli]
 gb|AQV40816.1| hypothetical protein BE959_11945 [Escherichia coli]
 gb|AQV54192.1| hypothetical protein BE949_24865 [Escherichia coli]
 gb|AQV77328.1| hypothetical protein BE962_02990 [Escherichia coli]
 gb|OOW12257.1| hypothetical protein B1732_22905 [Escherichia coli]
 gb|OOW24093.1| hypothetical protein B1733_07950 [Escherichia coli]
 gb|AQW74798.1| hypothetical protein B2H83_19500 [Escherichia coli M8]
 gb|AQX98395.1| hypothetical protein B0908_17955 [Escherichia coli NU14]
 gb|OPH64155.1| hypothetical protein B1763_08070 [Escherichia coli O157:H7]
 gb|OPH69638.1| hypothetical protein B1764_08605 [Escherichia coli O157:H7]
 gb|OPH72836.1| hypothetical protein B1765_14740 [Escherichia coli O157:H7]
 gb|OPI27897.1| hypothetical protein BFQ20_08230 [Escherichia coli]
 gb|OPI32623.1| hypothetical protein BFQ16_10770 [Escherichia coli]
 gb|OPI38213.1| hypothetical protein BFQ13_12345 [Escherichia coli]
 gb|OPI44177.1| hypothetical protein BFQ11_05155 [Escherichia coli]
 gb|OPI47731.1| hypothetical protein BFQ10_09755 [Escherichia coli]
 gb|OPI57497.1| hypothetical protein BFQ23_08545 [Escherichia coli]
 gb|OPI57950.1| hypothetical protein BFQ07_11955 [Escherichia coli]
 gb|OPI63145.1| hypothetical protein BFQ27_16145 [Escherichia coli]
 gb|OPI69450.1| hypothetical protein BFQ26_08635 [Escherichia coli]
 gb|OPI78380.1| hypothetical protein BFQ22_12615 [Escherichia coli]
 gb|OPI80548.1| hypothetical protein BFQ19_00845 [Escherichia coli]
 gb|OPI90277.1| hypothetical protein BFQ12_07360 [Escherichia coli]
 gb|OPI90612.1| hypothetical protein BFQ08_06310 [Escherichia coli]
 gb|OPI94122.1| hypothetical protein BFQ09_00845 [Escherichia coli]
 gb|OPJ05896.1| hypothetical protein BFQ06_03020 [Escherichia coli]
 gb|OPJ07157.1| hypothetical protein BFQ15_02830 [Escherichia coli]
 gb|OPJ12366.1| hypothetical protein BFQ17_00845 [Escherichia coli]
 gb|OPJ14500.1| hypothetical protein BFQ24_19530 [Escherichia coli]
 gb|OPJ19185.1| hypothetical protein BFQ25_14020 [Escherichia coli]
 gb|OPJ25618.1| hypothetical protein BFQ21_03295 [Escherichia coli]
 gb|OPJ30281.1| hypothetical protein BFQ18_09795 [Escherichia coli]
 gb|OPJ35320.1| hypothetical protein BFQ14_05515 [Escherichia coli]
 gb|OPJ39137.1| hypothetical protein BFX88_07880 [Escherichia coli]
 gb|OPJ45813.1| hypothetical protein BFX87_06160 [Escherichia coli]
 gb|OPJ51952.1| hypothetical protein BFX89_02845 [Escherichia coli]
 gb|AQZ75703.1| hypothetical protein Eco28_00660 [Escherichia coli]
 gb|AQZ84673.1| hypothetical protein EC725_04105 [Escherichia coli]
 gb|ARA00787.1| hypothetical protein EC780_04110 [Escherichia coli]
 gb|ARA18559.1| hypothetical protein AM365_17420 [Escherichia coli]
 gb|ARA30882.1| hypothetical protein AM448_07240 [Escherichia coli]
 gb|ARA37701.1| hypothetical protein AM440_19005 [Escherichia coli]
 gb|OQK69869.1| hypothetical protein BWR58_17700 [Shigella sonnei]
 gb|ARD52898.1| hypothetical protein BHT24_17125 [Escherichia coli]
 gb|ARD78420.1| hypothetical protein AYL54_12200 [Escherichia coli]
 gb|ARD82290.1| hypothetical protein AYR48_12195 [Escherichia coli]
 gb|ORD05306.1| hypothetical protein A4T55_15830 [Escherichia coli]
 gb|ORD13016.1| hypothetical protein A4T37_17470 [Escherichia coli]
 gb|ORD16217.1| hypothetical protein A4T36_01320 [Escherichia coli]
 gb|ORD20922.1| hypothetical protein A4T38_19130 [Escherichia coli]
 gb|ORD59924.1| hypothetical protein A4T50_09605 [Escherichia coli]
 gb|ORD68584.1| hypothetical protein A4T53_16095 [Escherichia coli]
 gb|ORD72369.1| hypothetical protein A4T52_08450 [Escherichia coli]
 gb|ORD84857.1| hypothetical protein A4T54_06515 [Escherichia coli]
 gb|ARH98727.1| putative uncharacterized protein YqjK [Escherichia coli]
 gb|ORJ75015.1| hypothetical protein BHS81_18735 [Escherichia coli]
 gb|ORR88182.1| hypothetical protein BIQ82_16805 [Escherichia coli]
 gb|ORR92675.1| hypothetical protein BGP66_16550 [Escherichia coli]
 gb|ORS03149.1| hypothetical protein BGP65_16560 [Escherichia coli]
 gb|ORS04743.1| hypothetical protein BGP64_16710 [Escherichia coli]
 gb|ORS07368.1| hypothetical protein BGP63_16565 [Escherichia coli]
 gb|ORS15823.1| hypothetical protein BGP62_16560 [Escherichia coli]
 gb|ORS19116.1| hypothetical protein BGP61_16550 [Escherichia coli]
 gb|ORS20691.1| hypothetical protein BGP60_16525 [Escherichia coli]
 gb|ORS30227.1| hypothetical protein BGP59_16525 [Escherichia coli]
 gb|ORS32895.1| hypothetical protein BGP58_16665 [Escherichia coli]
 gb|ORS33804.1| hypothetical protein BGP57_16510 [Escherichia coli]
 gb|ORS48862.1| hypothetical protein BIQ91_20525 [Escherichia coli]
 gb|ORS50089.1| hypothetical protein BIQ90_04555 [Escherichia coli]
 gb|ORS53342.1| hypothetical protein BIQ89_02250 [Escherichia coli]
 gb|ORS62976.1| hypothetical protein BIQ88_05840 [Escherichia coli]
 gb|ORS68261.1| hypothetical protein BHS94_17885 [Escherichia coli]
 gb|ORS74011.1| hypothetical protein BHS93_17890 [Escherichia coli]
 gb|ORT28298.1| hypothetical protein BIQ81_16345 [Escherichia coli]
 gb|ORT43038.1| hypothetical protein BIQ85_17520 [Escherichia coli]
 emb|SMB23057.1| Inner membrane protein YqjK [Escherichia coli]
 emb|SMB23056.1| Inner membrane protein YqjK [Escherichia coli]
 gb|OSB86046.1| hypothetical protein B7482_19620 [Escherichia coli]
 gb|OSC04664.1| hypothetical protein B8A27_13190 [Escherichia coli]
 gb|OSC16351.1| hypothetical protein B7980_23500 [Escherichia coli]
 gb|ARJ94712.1| hypothetical protein BCD20_03665 [Escherichia coli]
 gb|OSK02855.1| hypothetical protein L082_14919 [Escherichia coli SHECO001]
 gb|OSK26069.1| putative inner membrane protein [Escherichia coli B574]
 gb|OSK36059.1| putative inner membrane protein [Escherichia coli E267]
 gb|OSK41733.1| putative inner membrane protein [Escherichia coli B108]
 gb|OSK64473.1| putative inner membrane protein [Escherichia coli B921]
 gb|OSK65448.1| putative inner membrane protein [Escherichia coli E1114]
 gb|OSK72707.1| putative inner membrane protein [Escherichia coli H223]
 gb|OSK83052.1| putative inner membrane protein [Escherichia coli H378]
 gb|OSL04848.1| putative inner membrane protein [Escherichia coli H296]
 gb|OSL11231.1| putative inner membrane protein [Escherichia coli H305]
 gb|OSL69331.1| putative inner membrane protein [Escherichia coli TA054]
 gb|OSL69822.1| putative inner membrane protein [Escherichia coli TA008]
 gb|OSL76534.1| putative inner membrane protein [Escherichia coli TA014]
 gb|OSL89307.1| putative inner membrane protein [Escherichia coli E704]
 gb|OSL89523.1| putative inner membrane protein [Escherichia coli T426]
 gb|OSM86079.1| hypothetical protein L317_11763 [Escherichia coli SHECO003]
 gb|OSM92159.1| hypothetical protein L316_07658 [Escherichia coli SHECO002]
 gb|ARM78247.1| hypothetical protein B9W17_05750 [Escherichia coli]
 gb|OTB34448.1| hypothetical protein AW057_12265 [Escherichia coli]
 gb|OTB38818.1| hypothetical protein AW059_15640 [Escherichia coli]
 gb|OTB42839.1| hypothetical protein AW060_20970 [Escherichia coli]
 gb|OTB50725.1| hypothetical protein AW058_10830 [Escherichia coli]
 gb|OTB65662.1| hypothetical protein AW065_08795 [Escherichia coli]
 gb|OTB78725.1| hypothetical protein AW064_02840 [Escherichia coli]
 gb|OTB83988.1| hypothetical protein AW068_00630 [Escherichia coli]
 gb|OTB93220.1| hypothetical protein AW070_03850 [Escherichia coli]
 gb|OTB97037.1| hypothetical protein AW066_12935 [Escherichia coli]
 gb|OTC04070.1| hypothetical protein AW069_07385 [Escherichia coli]
 gb|OTC12019.1| hypothetical protein AW071_17985 [Escherichia coli]
 gb|OTC14909.1| hypothetical protein AW074_11155 [Escherichia coli]
 gb|OTC23164.1| hypothetical protein AW073_09545 [Escherichia coli]
 gb|OTC35245.1| hypothetical protein AW076_07710 [Escherichia coli]
 gb|OTC39232.1| hypothetical protein AW075_10785 [Escherichia coli]
 gb|OTC43415.1| hypothetical protein AW079_11160 [Escherichia coli]
 gb|OTC51577.1| hypothetical protein AW078_10715 [Escherichia coli]
 gb|OTC60503.1| hypothetical protein AW081_04800 [Escherichia coli]
 gb|OTC65321.1| hypothetical protein AW082_09825 [Escherichia coli]
 gb|OTC71918.1| hypothetical protein AW083_09155 [Escherichia coli]
 gb|OTC78023.1| hypothetical protein AW084_02310 [Escherichia coli]
 gb|OTC81789.1| hypothetical protein AW085_07755 [Escherichia coli]
 gb|OTC86611.1| hypothetical protein AW086_15890 [Escherichia coli]
 gb|OTC92164.1| hypothetical protein AW088_06760 [Escherichia coli]
 gb|OTD00282.1| hypothetical protein AW087_03180 [Escherichia coli]
 gb|OTD02946.1| hypothetical protein AW089_10260 [Escherichia coli]
 gb|OTD07343.1| hypothetical protein AW090_15680 [Escherichia coli]
 gb|OTD21313.1| hypothetical protein AW092_04570 [Escherichia coli]
 gb|OTD22765.1| hypothetical protein AW094_21550 [Escherichia coli]
 gb|OTD39781.1| hypothetical protein AW095_01465 [Escherichia coli]
 gb|OTD42453.1| hypothetical protein AW097_02580 [Escherichia coli]
 gb|OTD43893.1| hypothetical protein AW096_09165 [Escherichia coli]
 gb|OTD46164.1| hypothetical protein AW100_26180 [Escherichia coli]
 gb|OTD51688.1| hypothetical protein AW098_04015 [Escherichia coli]
 gb|OTD58891.1| hypothetical protein AW099_14160 [Escherichia coli]
 gb|OTD71782.1| hypothetical protein AW102_03930 [Escherichia coli]
 gb|OTD74153.1| hypothetical protein AW103_13800 [Escherichia coli]
 gb|OTD82126.1| hypothetical protein AW104_13230 [Escherichia coli]
 gb|OTD84665.1| hypothetical protein AW105_06685 [Escherichia coli]
 gb|OTE01685.1| hypothetical protein AW106_06280 [Escherichia coli]
 gb|OTE08592.1| hypothetical protein AW109_12925 [Escherichia coli]
 gb|OTE10969.1| hypothetical protein AW110_09450 [Escherichia coli]
 gb|OTE16588.1| hypothetical protein AW112_14265 [Escherichia coli]
 gb|OTE25155.1| hypothetical protein AW111_06045 [Escherichia coli]
 gb|OTE28280.1| hypothetical protein AW113_09805 [Escherichia coli]
 gb|OTE40018.1| hypothetical protein AW114_04495 [Escherichia coli]
 gb|OTE45122.1| hypothetical protein AW117_04495 [Escherichia coli]
 gb|OTE53914.1| hypothetical protein AW119_02555 [Escherichia coli]
 gb|OTE56334.1| hypothetical protein AW115_01675 [Escherichia coli]
 gb|OTE56987.1| hypothetical protein AW118_23025 [Escherichia coli]
 gb|OTE70690.1| hypothetical protein AW120_08775 [Escherichia coli]
 gb|OTE75718.1| hypothetical protein AW122_13835 [Escherichia coli]
 gb|OTE87894.1| hypothetical protein B1K92_00420 [Escherichia coli]
 gb|OTE93977.1| hypothetical protein B1K96_06160 [Escherichia coli]
 gb|ARR40694.1| hypothetical protein B9127_14300 [Shigella sonnei]
 gb|OTU97121.1| hypothetical protein BA733_03800 [Escherichia coli]
 gb|OTV02825.1| hypothetical protein BA734_05280 [Escherichia coli]
 gb|OTV17107.1| hypothetical protein BA737_04560 [Escherichia coli]
 gb|OTV17949.1| hypothetical protein BA738_04545 [Escherichia coli]
 gb|OTV33541.1| hypothetical protein BA731_09775 [Escherichia coli]
 gb|OTV35459.1| hypothetical protein BA732_10330 [Escherichia coli]
 gb|OUD18851.1| hypothetical protein BVA22_00760 [Escherichia coli M4]
 gb|ARS05265.1| hypothetical protein BZ172_07525 [Shigella sonnei]
 gb|OUF64241.1| hypothetical protein AZZ87_001490 [Escherichia coli]
 gb|OUF70545.1| hypothetical protein AZZ88_001685 [Escherichia coli]
 gb|OUF95237.1| hypothetical protein G97194_002140 [Escherichia coli]
 gb|OUG05052.1| hypothetical protein AZ041_003100 [Escherichia coli]
 gb|OUG11590.1| hypothetical protein AZ048_001233 [Escherichia coli]
 gb|OUG13895.1| hypothetical protein AZ049_000995 [Escherichia coli]
 gb|OUG33389.1| hypothetical protein AZZ83_001383 [Escherichia coli]
 gb|OUJ61913.1| hypothetical protein BZK32_13100 [Escherichia coli]
 gb|OUK50394.1| hypothetical protein BZL31_14755 [Escherichia coli]
 gb|OUK72226.1| hypothetical protein BZL34_03670 [Escherichia coli]
 gb|OUL15054.1| hypothetical protein B0698_07570 [Escherichia coli]
 gb|ART18460.1| hypothetical protein EC95JB1_02482 [Escherichia coli]
 gb|ART26241.1| hypothetical protein EC95NR1_02481 [Escherichia coli]
 gb|OUR45691.1| hypothetical protein AZ025_001679 [Escherichia coli]
 gb|ARV29144.1| hypothetical protein BS635_04510 [Escherichia coli]
 gb|ARV34016.1| hypothetical protein BUQ71_05075 [Escherichia coli]
 gb|ARV48413.1| hypothetical protein BZY74_04540 [Escherichia coli]
 gb|ARV54905.1| hypothetical protein BZY78_13475 [Escherichia coli]
 gb|OUZ59267.1| hypothetical protein CBL21_18530 [Shigella flexneri]
 gb|OUZ66533.1| hypothetical protein CBL19_13065 [Shigella sonnei]
 gb|OUZ69698.1| hypothetical protein CBL20_21440 [Shigella flexneri]
 gb|OUZ79822.1| hypothetical protein CBW45_16885 [Shigella flexneri]
 gb|OUZ84590.1| hypothetical protein CBL22_16890 [Shigella flexneri]
 gb|OUZ92825.1| hypothetical protein CBL17_15400 [Shigella sonnei]
 gb|OUZ97121.1| hypothetical protein CBL23_12055 [Shigella sonnei]
 gb|OVA44625.1| membrane protein [Escherichia coli]
 gb|OVA46900.1| membrane protein [Escherichia coli]
 gb|OVA52882.1| membrane protein [Escherichia coli]
 gb|OVA56717.1| membrane protein [Escherichia coli]
 gb|OVA64497.1| membrane protein [Escherichia coli]
 gb|OVA67101.1| membrane protein [Escherichia coli]
 gb|OVA71330.1| membrane protein [Escherichia coli]
 gb|OVA78112.1| membrane protein [Escherichia coli]
 gb|OVA82134.1| membrane protein [Escherichia coli]
 gb|OVA91134.1| membrane protein [Escherichia coli]
 gb|OVA92254.1| membrane protein [Escherichia coli]
 gb|OVA96289.1| membrane protein [Escherichia coli]
 gb|OVB08721.1| membrane protein [Escherichia coli]
 gb|OVB14842.1| membrane protein [Escherichia coli]
 gb|OVB15425.1| membrane protein [Escherichia coli]
 gb|OVB22934.1| membrane protein [Escherichia coli]
 gb|OVB28410.1| membrane protein [Escherichia coli]
 gb|OVB30141.1| membrane protein [Escherichia coli]
 gb|OVB36521.1| membrane protein [Escherichia coli]
 gb|OVB45624.1| membrane protein [Escherichia coli]
 gb|OVB50953.1| membrane protein [Escherichia coli]
 gb|OVB55703.1| membrane protein [Escherichia coli]
 gb|OVB63055.1| membrane protein [Escherichia coli]
 gb|OVB64041.1| membrane protein [Escherichia coli]
 gb|OVB72700.1| membrane protein [Escherichia coli]
 gb|OVB74349.1| membrane protein [Escherichia coli]
 gb|OVB81809.1| membrane protein [Escherichia coli]
 gb|OVB85573.1| membrane protein [Escherichia coli]
 gb|OVB92142.1| membrane protein [Escherichia coli]
 gb|OVB98367.1| membrane protein [Escherichia coli]
 gb|OVC04091.1| membrane protein [Escherichia coli]
 gb|OVC11500.1| membrane protein [Escherichia coli]
 gb|OVC14076.1| membrane protein [Escherichia coli]
 gb|OVC19983.1| membrane protein [Escherichia coli]
 gb|OVC24743.1| membrane protein [Escherichia coli]
 gb|OVC31275.1| membrane protein [Escherichia coli]
 gb|OVC35005.1| membrane protein [Escherichia coli]
 gb|OVC42668.1| membrane protein [Escherichia coli]
 gb|OVC44445.1| membrane protein [Escherichia coli]
 gb|OVC51465.1| membrane protein [Escherichia coli]
 gb|OVC59301.1| membrane protein [Escherichia coli]
 gb|OVC61377.1| membrane protein [Escherichia coli]
 gb|OVC70052.1| membrane protein [Escherichia coli]
 gb|OVC72478.1| membrane protein [Escherichia coli]
 gb|OVC77928.1| membrane protein [Escherichia coli]
 gb|OVC83384.1| membrane protein [Escherichia coli]
 gb|OVC95177.1| membrane protein [Escherichia coli]
 gb|OVC96265.1| membrane protein [Escherichia coli]
 gb|OVD01750.1| membrane protein [Escherichia coli]
 gb|OVD07471.1| membrane protein [Escherichia coli]
 gb|OVD11578.1| membrane protein [Escherichia coli]
 gb|OVD14852.1| membrane protein [Escherichia coli]
 gb|OVD24500.1| membrane protein [Escherichia coli]
 gb|OVD26395.1| membrane protein [Escherichia coli]
 gb|OVD33826.1| membrane protein [Escherichia coli]
 gb|OVD39200.1| membrane protein [Escherichia coli]
 gb|OVD40427.1| membrane protein [Escherichia coli]
 gb|OVD48549.1| membrane protein [Escherichia coli]
 gb|OVD54528.1| membrane protein [Escherichia coli]
 gb|OVD60761.1| membrane protein [Escherichia coli]
 gb|OVD65486.1| membrane protein [Escherichia coli]
 gb|OVD67883.1| membrane protein [Escherichia coli]
 gb|OVD75087.1| membrane protein [Escherichia coli]
 gb|OVD80369.1| membrane protein [Escherichia coli]
 gb|OVD81585.1| membrane protein [Escherichia coli]
 gb|OVD91084.1| membrane protein [Escherichia coli]
 gb|OVE06835.1| membrane protein [Escherichia coli]
 gb|OVE07486.1| membrane protein [Escherichia coli]
 gb|OVE21660.1| membrane protein [Escherichia coli]
 gb|OVE29282.1| membrane protein [Escherichia coli]
 gb|OVE33590.1| membrane protein [Escherichia coli]
 gb|ARW91163.1| hypothetical protein AM366_05745 [Escherichia coli]
 gb|ARX54979.1| hypothetical protein AM375_06870 [Escherichia coli]
 gb|OVG49055.1| hypothetical protein B5L80_11275 [Escherichia coli]
 gb|OWB94623.1| hypothetical protein A8M80_11645 [Escherichia coli]
 gb|OWC01407.1| hypothetical protein A8M82_15040 [Escherichia coli]
 gb|OWC07029.1| hypothetical protein A8G17_21460 [Escherichia coli]
 gb|OWC08027.1| hypothetical protein A8M81_07230 [Escherichia coli]
 gb|OWC12197.1| hypothetical protein A8G06_14545 [Escherichia coli]
 gb|OWC12264.1| hypothetical protein A8G20_12345 [Escherichia coli]
 gb|OWC22786.1| hypothetical protein A8G14_13815 [Escherichia coli]
 gb|OWC29793.1| hypothetical protein A8G19_08110 [Escherichia coli]
 gb|OWC31551.1| hypothetical protein A8G09_16720 [Escherichia coli]
 gb|OWC36276.1| hypothetical protein A8F96_02525 [Escherichia coli]
 gb|OWC44861.1| hypothetical protein A8F92_00100 [Escherichia coli]
 gb|OWC45080.1| hypothetical protein A8G02_23330 [Escherichia coli]
 gb|OWC49402.1| hypothetical protein A8F91_01245 [Escherichia coli]
 gb|OWC52364.1| hypothetical protein A8F90_14760 [Escherichia coli]
 gb|OWC65105.1| hypothetical protein A8F93_09270 [Escherichia coli]
 gb|OWC70993.1| hypothetical protein A8F87_01640 [Escherichia coli]
 gb|OWC74197.1| hypothetical protein A8F85_03605 [Escherichia coli]
 gb|OWD01422.1| hypothetical protein A8F80_01760 [Escherichia coli]
 gb|OWD03402.1| hypothetical protein A8F81_09840 [Escherichia coli]
 gb|OWD08357.1| hypothetical protein A8C74_19130 [Escherichia coli]
 gb|OWD66508.1| hypothetical protein A8C65_17185 [Escherichia coli]
 gb|OWD91904.1| hypothetical protein A8M39_00280 [Escherichia coli]
 gb|OWE01447.1| hypothetical protein A8M47_07390 [Escherichia coli]
 gb|OWE22814.1| hypothetical protein A8M46_14335 [Escherichia coli]
 gb|OWE25937.1| hypothetical protein A8M52_09340 [Escherichia coli]
 gb|OWE34468.1| hypothetical protein A8M45_05065 [Escherichia coli]
 gb|OWE34651.1| hypothetical protein A8M42_09610 [Escherichia coli]
 gb|OWE37721.1| hypothetical protein A8G07_14555 [Escherichia coli]
 gb|OWE45480.1| hypothetical protein A8M67_19875 [Escherichia coli]
 gb|OWE54513.1| hypothetical protein A8M66_00085 [Escherichia coli]
 gb|OWE60551.1| hypothetical protein A8M63_01045 [Escherichia coli]
 gb|OWE68967.1| hypothetical protein A8M73_00905 [Escherichia coli]
 gb|OWE71662.1| hypothetical protein A8M68_15530 [Escherichia coli]
 gb|OWE89901.1| hypothetical protein A8M75_06585 [Escherichia coli]
 gb|OWE96892.1| hypothetical protein A8M70_02225 [Escherichia coli]
 gb|OWF05824.1| hypothetical protein A8M62_13975 [Escherichia coli]
 gb|OWF13670.1| hypothetical protein A8M78_21440 [Escherichia coli]
 gb|OWF14527.1| hypothetical protein A8M71_16930 [Escherichia coli]
 gb|OWF25424.1| hypothetical protein A8M76_11090 [Escherichia coli]
 gb|OWF31073.1| hypothetical protein A9X62_28745 [Escherichia coli]
 gb|OWG46032.1| hypothetical protein CCE24_07545 [Escherichia coli]
 gb|OWG50368.1| hypothetical protein CCE11_06355 [Escherichia coli]
 gb|OWG62455.1| hypothetical protein CCE08_01875 [Escherichia coli]
 gb|OWG66859.1| hypothetical protein CCE16_01430 [Escherichia coli]
 gb|OWG67805.1| hypothetical protein CCE21_11345 [Escherichia coli]
 gb|OWG77749.1| hypothetical protein CCE19_02995 [Escherichia coli]
 gb|OWG82267.1| hypothetical protein CCE18_11340 [Escherichia coli]
 gb|OWG83122.1| hypothetical protein CCE25_02800 [Escherichia coli]
 gb|OWG92443.1| hypothetical protein CCE23_01430 [Escherichia coli]
 gb|OWG94452.1| hypothetical protein CCE26_02835 [Escherichia coli]
 gb|OWG99477.1| hypothetical protein CCE15_07540 [Escherichia coli]
 gb|OWH17927.1| hypothetical protein CCE22_07545 [Escherichia coli]
 gb|OWH22121.1| hypothetical protein CCE14_07015 [Escherichia coli]
 gb|OWH27503.1| hypothetical protein CCE09_06720 [Escherichia coli]
 gb|ASA59076.1| hypothetical protein CDH88_03900 [Escherichia coli]
 gb|ASA64184.1| hypothetical protein CDH89_03390 [Escherichia coli]
 gb|OWP95495.1| hypothetical protein B7455_14345 [Escherichia coli]
 gb|OWR38824.1| hypothetical protein BSQ42_09495 [Escherichia coli]
 gb|OWS80379.1| hypothetical protein B7C52_11690 [Escherichia coli]
 gb|OWS86963.1| hypothetical protein B7C53_03080 [Escherichia coli]
 gb|ASE48620.1| hypothetical protein CEP72_16725 [Escherichia coli O157]
 gb|ASG48136.1| hypothetical protein CES94_03560 [Escherichia coli]
 gb|OWW47799.1| hypothetical protein CCS19_23840 [Escherichia coli]
 gb|OWW55397.1| hypothetical protein CCS08_10920 [Escherichia coli]
 gb|OWY57261.1| hypothetical protein CA947_02335 [Escherichia coli]
 gb|ASI14945.1| hypothetical protein CE141_03530 [Escherichia coli]
 gb|ASJ29141.1| membrane protein [Escherichia coli]
 gb|ASJ45040.1| hypothetical protein A0U97_20815 [Escherichia coli]
 gb|ASL30229.1| hypothetical protein CEJ55_05915 [Escherichia coli]
 gb|ASL57443.1| Inner membrane protein YqjK [Escherichia coli]
 gb|OXJ45838.1| hypothetical protein CDL30_13985 [Escherichia coli]
 gb|OXJ52728.1| hypothetical protein CDL34_03735 [Escherichia coli]
 gb|OXJ55291.1| hypothetical protein CDL53_14390 [Escherichia coli]
 gb|OXJ56681.1| hypothetical protein CDL52_22075 [Escherichia coli]
 gb|OXJ64733.1| hypothetical protein CDL51_17935 [Escherichia coli]
 gb|OXJ75748.1| hypothetical protein CDL50_09240 [Escherichia coli]
 gb|OXJ82742.1| hypothetical protein CDL49_07410 [Escherichia coli]
 gb|OXJ86622.1| hypothetical protein CDL48_05960 [Escherichia coli]
 gb|OXJ91799.1| hypothetical protein CDL29_06050 [Escherichia coli]
 gb|OXK21927.1| hypothetical protein CDL42_08200 [Escherichia coli]
 gb|OXK30825.1| hypothetical protein CDL33_01460 [Escherichia coli]
 gb|OXK32549.1| hypothetical protein CDL40_25660 [Escherichia coli]
 gb|OXK32834.1| hypothetical protein CDL41_04555 [Escherichia coli]
 gb|OXK52161.1| hypothetical protein CDL37_11765 [Escherichia coli]
 gb|OXK68134.1| hypothetical protein CD801_17660 [Escherichia coli]
 gb|OXK82725.1| hypothetical protein CD804_13755 [Escherichia coli]
 gb|OXK90708.1| hypothetical protein CD821_03235 [Escherichia coli]
 gb|OXK99274.1| hypothetical protein CD803_05385 [Escherichia coli]
 gb|OXL04629.1| hypothetical protein CD806_00920 [Escherichia coli]
 gb|ASN32381.1| hypothetical protein B9130_23235 [Shigella sonnei]
 gb|ASN35268.1| hypothetical protein B9129_13720 [Shigella sonnei]
 gb|ASN41746.1| hypothetical protein B9128_03600 [Shigella sonnei]
 gb|OXL50588.1| hypothetical protein CD786_02585 [Escherichia coli]
 gb|OXL57830.1| membrane protein [Escherichia coli]
 gb|ASO77491.1| hypothetical protein AKN40_0664 [Escherichia coli]
 gb|ASO85016.1| hypothetical protein AKN41_3419 [Escherichia coli]
 gb|ASO94564.1| hypothetical protein AKO64_3438 [Escherichia coli]
 gb|OXV20106.1| hypothetical protein CDL28_11885 [Escherichia coli]
 gb|OXV40047.1| hypothetical protein CDL58_21870 [Escherichia coli]
 gb|OXV44038.1| hypothetical protein CDL56_05175 [Escherichia coli]
 gb|OXW55564.1| hypothetical protein CG423_21950 [Shigella flexneri]
 gb|OXW65945.1| hypothetical protein CG417_12810 [Shigella sonnei]
 gb|OXW80219.1| hypothetical protein CG420_12430 [Shigella sonnei]
 gb|OXW83182.1| hypothetical protein CG416_22300 [Shigella flexneri]
 gb|OXW89282.1| hypothetical protein CG424_17010 [Shigella boydii]
 gb|OXW99275.1| hypothetical protein CG413_12190 [Shigella sonnei]
 gb|OXX03958.1| hypothetical protein CG414_12315 [Shigella sonnei]
 gb|OXX08053.1| hypothetical protein CG421_12005 [Shigella sonnei]
 gb|OXX16763.1| hypothetical protein CG426_13105 [Shigella sonnei]
 gb|OXZ49844.1| hypothetical protein RW70_02903 [Escherichia coli]
 gb|OXZ64928.1| hypothetical protein RW67_01545 [Escherichia coli]
 gb|OXZ76627.1| hypothetical protein RW68_02390 [Escherichia coli]
 gb|OXZ84990.1| hypothetical protein RW79_02797 [Escherichia coli]
 gb|OXZ97340.1| hypothetical protein RW73_02869 [Escherichia coli]
 gb|OYA02957.1| hypothetical protein RW80_01905 [Escherichia coli]
 gb|OYA13114.1| hypothetical protein RW81_02663 [Escherichia coli]
 gb|OYA25789.1| hypothetical protein RW82_03276 [Escherichia coli]
 gb|OYA33572.1| hypothetical protein RW88_00576 [Escherichia coli]
 gb|OYA33940.1| hypothetical protein RW83_01933 [Escherichia coli]
 gb|OYA39496.1| hypothetical protein RW91_02240 [Escherichia coli]
 gb|OYA42613.1| hypothetical protein RW89_03238 [Escherichia coli]
 gb|OYA45665.1| hypothetical protein RW93_07238 [Escherichia coli]
 gb|OYA53146.1| hypothetical protein RW84_03207 [Escherichia coli]
 gb|OYA56270.1| hypothetical protein RW94_02796 [Escherichia coli]
 gb|OYA67012.1| hypothetical protein RW87_03072 [Escherichia coli]
 gb|OYA68472.1| hypothetical protein RW92_04340 [Escherichia coli]
 gb|OYA77425.1| hypothetical protein RW90_01217 [Escherichia coli]
 gb|OYA81694.1| hypothetical protein RW95_02934 [Escherichia coli]
 gb|OYA86153.1| hypothetical protein RW97_02979 [Escherichia coli]
 gb|OYB00967.1| hypothetical protein RW96_00628 [Escherichia coli]
 gb|OYB07856.1| hypothetical protein RW98_03185 [Escherichia coli]
 gb|OYB15583.1| hypothetical protein RX07_01614 [Escherichia coli]
 gb|OYB31633.1| hypothetical protein RX08_03688 [Escherichia coli]
 gb|OYB39331.1| hypothetical protein RX12_15844 [Escherichia coli]
 gb|OYB52469.1| hypothetical protein RX15_02326 [Escherichia coli]
 gb|OYB57191.1| hypothetical protein RX06_00923 [Escherichia coli]
 gb|OYB65559.1| hypothetical protein RX13_02325 [Escherichia coli]
 gb|OYB68768.1| hypothetical protein RX17_01140 [Escherichia coli]
 gb|OYB78844.1| hypothetical protein RX18_02316 [Escherichia coli]
 gb|OYB85801.1| hypothetical protein RX14_02168 [Escherichia coli]
 gb|OYB88323.1| hypothetical protein RX21_03636 [Escherichia coli]
 gb|OYB93542.1| hypothetical protein RX16_07379 [Escherichia coli]
 gb|OYC05837.1| hypothetical protein RX27_01141 [Escherichia coli]
 gb|OYC06473.1| hypothetical protein RX19_00865 [Escherichia coli]
 gb|OYC09048.1| hypothetical protein RX26_01892 [Escherichia coli]
 gb|OYC16001.1| hypothetical protein RX24_01559 [Escherichia coli]
 gb|OYC16699.1| hypothetical protein RX20_02815 [Escherichia coli]
 gb|OYC21596.1| hypothetical protein RX30_02499 [Escherichia coli]
 gb|OYC47160.1| hypothetical protein RX28_01140 [Escherichia coli]
 gb|OYC51618.1| hypothetical protein RX34_00243 [Escherichia coli]
 gb|OYC57761.1| hypothetical protein RX33_02499 [Escherichia coli]
 gb|OYC62131.1| hypothetical protein RX36_01715 [Escherichia coli]
 gb|OYC66653.1| hypothetical protein RX35_04190 [Escherichia coli]
 gb|OYC75982.1| hypothetical protein RX37_02986 [Escherichia coli]
 gb|OYD31408.1| hypothetical protein CA843_007830 [Escherichia coli]
 gb|OYE53115.1| hypothetical protein CI633_11475 [Shigella sonnei]
 gb|OYE60696.1| hypothetical protein CI632_16230 [Shigella sonnei]
 gb|OYE79860.1| hypothetical protein CI631_12575 [Shigella sonnei]
 gb|OYF36486.1| hypothetical protein CI782_11730 [Shigella sonnei]
 gb|OYF67453.1| hypothetical protein CI641_15505 [Shigella sonnei]
 gb|OYF69438.1| hypothetical protein CI642_06160 [Shigella sonnei]
 gb|OYF97834.1| hypothetical protein CI640_01545 [Shigella sonnei]
 gb|OYG17845.1| hypothetical protein CI650_08470 [Shigella sonnei]
 gb|OYG63054.1| hypothetical protein CI733_07950 [Escherichia coli]
 gb|OYG69419.1| hypothetical protein CI730_01445 [Shigella sonnei]
 gb|OYG77460.1| hypothetical protein CI728_10040 [Shigella sonnei]
 gb|OYG81500.1| hypothetical protein CI731_14445 [Shigella sonnei]
 gb|OYI08818.1| hypothetical protein CI725_09180 [Shigella sonnei]
 gb|OYI25124.1| hypothetical protein CI700_08575 [Shigella sonnei]
 gb|OYI37653.1| hypothetical protein CI695_22395 [Shigella sonnei]
 gb|OYI40536.1| hypothetical protein CI696_12110 [Shigella sonnei]
 gb|OYI57833.1| hypothetical protein CI688_08955 [Shigella sonnei]
 gb|OYI59178.1| hypothetical protein CI693_03205 [Shigella sonnei]
 gb|OYI65070.1| hypothetical protein CI691_15510 [Shigella sonnei]
 gb|OYI69909.1| hypothetical protein CI685_14935 [Shigella sonnei]
 gb|OYJ24332.1| hypothetical protein CI684_01425 [Shigella sonnei]
 gb|OYJ31794.1| hypothetical protein CI734_05400 [Shigella sonnei]
 gb|OYJ32672.1| hypothetical protein CI737_26135 [Shigella boydii]
 gb|OYJ39773.1| hypothetical protein CI736_19420 [Shigella boydii]
 gb|OYJ69198.1| hypothetical protein CI672_23700 [Escherichia coli]
 gb|OYJ76551.1| hypothetical protein CI671_08735 [Shigella sonnei]
 gb|OYK16930.1| hypothetical protein CI722_26075 [Shigella sonnei]
 gb|OYK25166.1| hypothetical protein CI723_15150 [Shigella sonnei]
 gb|OYK36086.1| hypothetical protein CI658_00930 [Shigella sonnei]
 gb|OYK42446.1| hypothetical protein CI716_19960 [Escherichia coli]
 gb|OYK54525.1| hypothetical protein CI714_11690 [Shigella sonnei]
 gb|OYK62758.1| hypothetical protein CI713_04315 [Shigella sonnei]
 gb|OYK63758.1| hypothetical protein CI712_22425 [Shigella sonnei]
 gb|OYK73741.1| hypothetical protein CI719_17750 [Shigella boydii]
 gb|OYL19579.1| hypothetical protein CI715_12390 [Shigella sonnei]
 gb|OYL22319.1| hypothetical protein CI768_24425 [Shigella sonnei]
 gb|OYL31292.1| hypothetical protein CI769_11720 [Shigella sonnei]
 gb|OYL40113.1| hypothetical protein CI771_04220 [Escherichia coli]
 gb|OYL44915.1| hypothetical protein CI770_04830 [Shigella sonnei]
 gb|OYL58712.1| hypothetical protein CI766_08715 [Shigella sonnei]
 gb|OYL68878.1| hypothetical protein CI764_23915 [Escherichia coli]
 gb|OYL83789.1| hypothetical protein CI759_26965 [Shigella sonnei]
 gb|OYN46812.1| hypothetical protein BTN40_11120 [Escherichia coli]
 gb|OYN70152.1| hypothetical protein CGZ73_12035 [Escherichia coli]
 gb|AST64460.1| hypothetical protein RM34_14810 [Escherichia coli]
 gb|OYQ53910.1| hypothetical protein CI670_19375 [Shigella sonnei]
 gb|OZC24437.1| hypothetical protein AYO35_24845 [Escherichia coli]
 gb|OZG34488.1| hypothetical protein CHH35_10350 [Escherichia coli O157:H7]
 gb|OZM88350.1| hypothetical protein CF005_03675 [Escherichia coli]
 gb|OZM91338.1| hypothetical protein CF006_15350 [Escherichia coli]
 gb|OZN03097.1| hypothetical protein CF018_07225 [Escherichia coli]
 gb|OZN07601.1| hypothetical protein CFY88_09270 [Escherichia coli]
 gb|OZO52251.1| hypothetical protein CG706_21820 [Escherichia coli]
 gb|OZO56602.1| hypothetical protein CG693_23640 [Escherichia coli]
 gb|OZO61448.1| hypothetical protein CG691_23980 [Escherichia coli]
 gb|OZO66397.1| hypothetical protein CG705_24480 [Escherichia coli]
 gb|OZO71432.1| hypothetical protein CG695_24130 [Escherichia coli]
 gb|OZO76318.1| hypothetical protein CG704_24490 [Escherichia coli]
 gb|OZO81388.1| hypothetical protein CG700_24760 [Escherichia coli]
 gb|OZO86361.1| hypothetical protein CG698_23815 [Escherichia coli]
 gb|OZO91146.1| hypothetical protein CG703_23830 [Escherichia coli]
 gb|OZO95932.1| hypothetical protein CG696_23760 [Escherichia coli]
 gb|OZP00580.1| hypothetical protein CG702_24785 [Escherichia coli]
 gb|OZP07540.1| hypothetical protein CG692_14060 [Escherichia coli]
 gb|OZP10503.1| hypothetical protein CG699_24830 [Escherichia coli]
 gb|OZP15585.1| hypothetical protein CG690_24255 [Escherichia coli]
 gb|OZP20426.1| hypothetical protein CG697_24820 [Escherichia coli]
 gb|OZR99216.1| hypothetical protein CIG25_05300 [Escherichia coli]
 gb|PAB75932.1| hypothetical protein CDH53_21040 [Escherichia coli]
 gb|PAC20506.1| hypothetical protein CDH62_14450 [Escherichia coli]
 gb|PAL29580.1| hypothetical protein CEJ54_22400 [Escherichia coli]
 gb|PAL34418.1| hypothetical protein CEJ53_17355 [Escherichia coli]
 gb|PAL38059.1| hypothetical protein CEJ52_08880 [Escherichia coli]
 gb|PAL42374.1| hypothetical protein CEJ51_08435 [Escherichia coli]
 gb|PAL55874.1| hypothetical protein CEJ50_08545 [Escherichia coli]
 gb|PAQ59301.1| hypothetical protein BIZ41_22990 [Escherichia coli]
 gb|PAQ74326.1| hypothetical protein BIU78_10710 [Escherichia coli]
 gb|PAQ81146.1| hypothetical protein BIU76_17865 [Escherichia coli]
 gb|PAQ98177.1| hypothetical protein BIU73_01830 [Escherichia coli]
 gb|PAS51124.1| hypothetical protein CDN93_19690 [Escherichia coli]
 gb|PAS56374.1| hypothetical protein CDN90_19630 [Escherichia coli]
 gb|PAS61243.1| hypothetical protein CDN91_19365 [Escherichia coli]
 gb|PAS73257.1| hypothetical protein CDN94_19275 [Escherichia coli]
 gb|PAS80697.1| hypothetical protein CDN92_19900 [Escherichia coli]
 emb|CTP96040.1| Inner membrane protein YqjK [Escherichia coli]
 gb|ASW61371.1| hypothetical protein PA45B_3075 [Escherichia coli]
 gb|PAT77519.1| hypothetical protein BTP99_21500 [Escherichia coli]
 gb|PAT88969.1| hypothetical protein BTQ00_05285 [Escherichia coli]
 gb|PAT89502.1| hypothetical protein BTP98_06040 [Escherichia coli]
 gb|PAT97116.1| hypothetical protein BTQ02_21380 [Escherichia coli]
 gb|PAU00296.1| hypothetical protein BTQ03_23325 [Escherichia coli]
 gb|PAU02010.1| hypothetical protein BTQ01_01860 [Escherichia coli]
 gb|PAU12119.1| hypothetical protein BTQ06_26365 [Escherichia coli]
 gb|PAU17675.1| hypothetical protein BTQ04_03630 [Escherichia coli]
 gb|PAU21682.1| hypothetical protein BTQ05_01815 [Escherichia coli]
 gb|PAU28747.1| hypothetical protein BTQ07_10320 [Escherichia coli]
 gb|PAU32401.1| hypothetical protein BTQ08_15800 [Escherichia coli]
 gb|PAX44947.1| hypothetical protein CI257_04360 [Escherichia coli]
 gb|PAX49269.1| hypothetical protein A7H93_06725 [Escherichia coli]
 gb|PAX57395.1| hypothetical protein A8106_07365 [Escherichia coli]
 gb|ASZ43089.1| hypothetical protein CLD27_17860 [Escherichia coli]
 gb|PAY67614.1| hypothetical protein CEG96_22180 [Shigella flexneri]
 gb|PAY70951.1| hypothetical protein CEH00_17145 [Shigella boydii]
 gb|PAY79901.1| hypothetical protein CEG98_01720 [Shigella flexneri]
 gb|PAY83769.1| hypothetical protein CEG94_18675 [Shigella boydii]
 gb|PAY84004.1| hypothetical protein CEG97_20235 [Shigella flexneri]
 gb|PAY93305.1| hypothetical protein CEG95_01210 [Shigella flexneri]
 gb|PAZ26981.1| hypothetical protein APU33_03805 [Escherichia coli]
 gb|PAZ32161.1| hypothetical protein APU34_03190 [Escherichia coli]
 gb|PAZ34271.1| hypothetical protein APU35_20615 [Escherichia coli]
 gb|PAZ36791.1| hypothetical protein APU36_20670 [Escherichia coli]
 gb|PAZ47645.1| hypothetical protein APX81_03100 [Escherichia coli]
 gb|PAZ49929.1| hypothetical protein APX82_18645 [Escherichia coli]
 gb|PAZ58095.1| hypothetical protein APX83_14070 [Escherichia coli]
 gb|PAZ58911.1| hypothetical protein APX84_09050 [Escherichia coli]
 gb|PAZ61897.1| hypothetical protein APX87_19520 [Escherichia coli]
 gb|PAZ70577.1| hypothetical protein APX88_12500 [Escherichia coli]
 gb|PAZ73930.1| hypothetical protein APU31_22545 [Escherichia coli]
 gb|PAZ79484.1| hypothetical protein APU32_20390 [Escherichia coli]
 gb|PAZ86729.1| hypothetical protein APX79_05885 [Escherichia coli]
 gb|PAZ97969.1| hypothetical protein APX86_04360 [Escherichia coli]
 gb|ATB10033.1| hypothetical protein CJU64_18545 [Escherichia coli]
 gb|ATB15272.1| hypothetical protein CJU63_18665 [Escherichia coli]
 gb|PBK07842.1| hypothetical protein CMR95_17705 [Escherichia coli]
 gb|PBK14758.1| hypothetical protein CMR94_07695 [Escherichia coli]
 gb|PBK16486.1| hypothetical protein CMR93_24765 [Escherichia coli]
 gb|PBK25066.1| hypothetical protein CMR92_06730 [Escherichia coli]
 gb|PBK39224.1| hypothetical protein CMR89_15575 [Escherichia coli]
 gb|ATB71632.1| hypothetical protein CNQ56_03595 [Escherichia coli]
 gb|ATB76790.1| hypothetical protein CNQ55_04070 [Escherichia coli]
 gb|ATB81544.1| hypothetical protein CNQ54_03515 [Escherichia coli]
 gb|ATB86517.1| hypothetical protein CNQ53_04455 [Escherichia coli]
 gb|ATC10967.1| hypothetical protein CNQ48_03535 [Escherichia coli]
 gb|PBN55724.1| hypothetical protein ABE95_020720 [Escherichia coli]
 gb|PBN56457.1| hypothetical protein ABE94_010930 [Escherichia coli]
 gb|PBN59604.1| hypothetical protein ABE93_016500 [Escherichia coli]
 gb|PBN74428.1| hypothetical protein ABE92_003900 [Escherichia coli]
 gb|PBN75452.1| hypothetical protein ABE91_010210 [Escherichia coli]
 gb|PBN86775.1| hypothetical protein ABE90_003730 [Escherichia coli]
 gb|PBN88935.1| hypothetical protein ABE88_020705 [Escherichia coli]
 gb|PBN89247.1| hypothetical protein ABE89_005995 [Escherichia coli]
 gb|PBO46164.1| hypothetical protein CKX42_16510 [Escherichia coli]
 gb|PBO51783.1| hypothetical protein CKX40_09285 [Escherichia coli]
 gb|PBO52053.1| hypothetical protein CKX41_07420 [Escherichia coli]
 gb|PBO59533.1| hypothetical protein CKX38_19690 [Escherichia coli]
 gb|PBO65431.1| hypothetical protein CKX39_04585 [Escherichia coli]
 gb|PBO71858.1| hypothetical protein CKX37_03195 [Escherichia coli]
 gb|PBO78024.1| hypothetical protein CKX36_00910 [Escherichia coli]
 gb|PBO80904.1| hypothetical protein CKX35_00510 [Escherichia coli]
 gb|PBO90679.1| hypothetical protein CI702_20790 [Escherichia coli]
 gb|PBO96824.1| hypothetical protein CI703_01010 [Shigella sonnei]
 gb|PBP00305.1| hypothetical protein CI708_20995 [Shigella sonnei]
 gb|PBP08744.1| hypothetical protein CI707_05860 [Shigella sonnei]
 gb|PBQ37510.1| hypothetical protein COD27_12660 [Escherichia coli]
 gb|PBQ42664.1| hypothetical protein COD56_10665 [Escherichia coli]
 gb|PBQ45599.1| hypothetical protein COD55_22310 [Escherichia coli]
 gb|PBQ59050.1| hypothetical protein COD51_03590 [Escherichia coli]
 gb|PBQ63144.1| hypothetical protein COD50_10305 [Escherichia coli]
 gb|PBQ66710.1| hypothetical protein COD48_18735 [Escherichia coli]
 gb|PBQ79815.1| hypothetical protein COD42_03230 [Escherichia coli]
 gb|PBQ84748.1| hypothetical protein COD41_05135 [Escherichia coli]
 gb|PBQ89874.1| hypothetical protein COD40_05115 [Escherichia coli]
 gb|PBQ92876.1| hypothetical protein COD37_16440 [Escherichia coli]
 gb|PBQ99266.1| hypothetical protein COD34_12550 [Escherichia coli]
 gb|PBR03846.1| hypothetical protein COD32_10415 [Escherichia coli]
 gb|PBR12237.1| hypothetical protein COD30_06165 [Escherichia coli]
 gb|PBR25370.1| hypothetical protein COD58_09515 [Escherichia coli]
 gb|PBR30854.1| hypothetical protein COD57_09500 [Escherichia coli]
 gb|PBR36729.1| hypothetical protein COD54_06725 [Escherichia coli]
 gb|PBR42033.1| hypothetical protein COD53_08980 [Escherichia coli]
 gb|PBR45291.1| hypothetical protein COD49_18770 [Escherichia coli]
 gb|PBR51771.1| hypothetical protein COD46_14125 [Escherichia coli]
 gb|PBR58967.1| hypothetical protein COD45_00930 [Escherichia coli]
 gb|PBR63659.1| hypothetical protein COD44_02610 [Escherichia coli]
 gb|PBR68472.1| hypothetical protein COD39_02700 [Escherichia coli]
 gb|PBR69470.1| hypothetical protein COD38_26390 [Escherichia coli]
 gb|PBR78355.1| hypothetical protein COD36_06075 [Escherichia coli]
 gb|PBR83415.1| hypothetical protein COD26_10685 [Escherichia coli]
 gb|PBR89223.1| hypothetical protein COD25_10275 [Escherichia coli]
 gb|PBR95799.1| hypothetical protein COD47_00115 [Escherichia coli]
 gb|PBR98700.1| hypothetical protein COD35_15885 [Escherichia coli]
 gb|PBS04123.1| hypothetical protein COD33_09570 [Escherichia coli]
 gb|PBS10098.1| hypothetical protein COD31_05075 [Escherichia coli]
 gb|PBS22424.1| hypothetical protein A7H83_17975 [Escherichia coli]
 gb|PBS27314.1| hypothetical protein A7H85_17970 [Escherichia coli]
 gb|PBS32235.1| hypothetical protein A7H86_18080 [Escherichia coli]
 gb|PBS40016.1| hypothetical protein A7H87_02065 [Escherichia coli]
 gb|PBS45171.1| hypothetical protein A7H88_03130 [Escherichia coli]
 gb|PBS49996.1| hypothetical protein A7H89_01405 [Escherichia coli]
 gb|PBS52515.1| hypothetical protein A7H98_14215 [Escherichia coli]
 gb|PBS57016.1| hypothetical protein A7H90_17370 [Escherichia coli]
 gb|PBS62351.1| hypothetical protein A7H91_13670 [Escherichia coli]
 gb|PBS68691.1| hypothetical protein A8104_01900 [Escherichia coli]
 gb|PBS69887.1| hypothetical protein A7H92_20405 [Escherichia coli]
 gb|PBS74252.1| hypothetical protein A8107_21710 [Escherichia coli]
 gb|PBS80706.1| hypothetical protein A8108_16660 [Escherichia coli]
 gb|PBS85395.1| hypothetical protein A8109_14250 [Escherichia coli]
 gb|PBS89884.1| hypothetical protein A8112_17615 [Escherichia coli]
 gb|PBS95189.1| hypothetical protein A8114_15685 [Escherichia coli]
 gb|PBT29126.1| hypothetical protein A9815_17145 [Escherichia coli]
 gb|PBT39976.1| hypothetical protein A9819_17840 [Escherichia coli]
 gb|PBT56370.1| hypothetical protein BBJ13_16520 [Escherichia coli]
 gb|PBT99151.1| hypothetical protein BBJ21_17070 [Escherichia coli]
 gb|PBU03780.1| hypothetical protein BBJ22_17170 [Escherichia coli]
 gb|PBU11125.1| hypothetical protein BBJ23_07685 [Escherichia coli]
 gb|PBU13017.1| hypothetical protein BBJ24_17040 [Escherichia coli]
 gb|PBU21286.1| hypothetical protein BBJ25_01105 [Escherichia coli]
 gb|PBU23113.1| hypothetical protein BB539_16575 [Escherichia coli]
 gb|PBU27787.1| hypothetical protein BB546_17420 [Escherichia coli]
 gb|PBU48143.1| hypothetical protein BB541_16495 [Escherichia coli]
 gb|PBU54598.1| hypothetical protein BB542_05655 [Escherichia coli]
 gb|PBU57198.1| hypothetical protein BB543_16985 [Escherichia coli]
 gb|PBU62447.1| hypothetical protein BB553_18205 [Escherichia coli]
 gb|PBU70139.1| hypothetical protein BB540_06265 [Escherichia coli]
 gb|PBU92319.1| hypothetical protein BB550_16535 [Escherichia coli]
 gb|PCD49800.1| hypothetical protein A6V22_10495 [Escherichia coli]
 gb|PCD54148.1| hypothetical protein A6V15_13820 [Escherichia coli]
 gb|PCG23200.1| hypothetical protein CO992_14555 [Escherichia coli]
 gb|PCG28956.1| hypothetical protein CO989_13790 [Escherichia coli]
 gb|PCG33387.1| hypothetical protein CO988_16135 [Escherichia coli]
 gb|PCG38978.1| hypothetical protein CO987_12735 [Escherichia coli]
 gb|PCG43811.1| hypothetical protein CO986_14190 [Escherichia coli]
 gb|PCG49253.1| hypothetical protein CO991_13840 [Escherichia coli]
 gb|PCG54576.1| hypothetical protein CO990_14295 [Escherichia coli]
 gb|ATG63663.1| hypothetical protein AWA97_21860 [Escherichia coli O104:H21 str.
            CFSAN002236]
 gb|PCM37076.1| hypothetical protein B1028_15885 [Escherichia coli]
 gb|PCO34302.1| hypothetical protein CP993_00120 [Escherichia coli]
 gb|PCO78373.1| hypothetical protein CQA04_05305 [Escherichia coli]
 gb|PCO83707.1| hypothetical protein CP990_04545 [Escherichia coli]
 gb|PCP05065.1| hypothetical protein CQA10_01475 [Escherichia coli]
 gb|PCQ84203.1| hypothetical protein CQA56_09695 [Escherichia coli]
 gb|PCQ95240.1| hypothetical protein CQA46_04080 [Escherichia coli]
 gb|PCS28723.1| hypothetical protein BMR34_25310 [Escherichia coli]
 gb|PCS33817.1| hypothetical protein BMR36_23970 [Escherichia coli]
 gb|PCS40710.1| hypothetical protein BMR38_14140 [Escherichia coli]
 gb|PCS56362.1| hypothetical protein BMR43_13920 [Escherichia coli]
 gb|PCS63380.1| hypothetical protein BMR44_01845 [Escherichia coli]
 gb|PCS64401.1| hypothetical protein BMR45_23265 [Escherichia coli]
 gb|PCS74102.1| hypothetical protein BMR47_26030 [Escherichia coli]
 gb|PCS87134.1| hypothetical protein BMR50_10855 [Escherichia coli]
 gb|PCS91981.1| hypothetical protein BMR53_11175 [Escherichia coli]
 gb|PCT00880.1| hypothetical protein BMR65_17040 [Escherichia coli]
 gb|PCT24011.1| hypothetical protein BMR57_02840 [Escherichia coli]
 gb|PCT24951.1| hypothetical protein BMR62_26575 [Escherichia coli]
 gb|PCT37141.1| hypothetical protein BMR64_19260 [Escherichia coli]
 gb|ATH69315.1| hypothetical protein B7485_17580 [Shigella flexneri 1c]
 gb|ATH87013.1| hypothetical protein AT852_02235 [Shigella sonnei]
 gb|PDM44207.1| hypothetical protein CPT07_13900 [Escherichia coli]
 gb|PDN01624.1| hypothetical protein AWE17_18035 [Escherichia coli]
 gb|PDN91722.1| hypothetical protein CJU67_17425 [Escherichia coli]
 gb|PDN98847.1| hypothetical protein CJU68_18230 [Escherichia coli]
 gb|PDO11942.1| hypothetical protein AWE19_27155 [Escherichia coli]
 gb|PDO21571.1| hypothetical protein AWE23_01600 [Escherichia coli]
 gb|PDO26813.1| hypothetical protein AWE24_01320 [Escherichia coli]
 gb|PDO28440.1| hypothetical protein AWE26_16865 [Escherichia coli]
 gb|PDO35410.1| hypothetical protein AWE20_07045 [Escherichia coli]
 gb|PDO37582.1| hypothetical protein AWE22_21365 [Escherichia coli]
 gb|PDO41508.1| hypothetical protein AWE25_23665 [Escherichia coli]
 gb|PDO47039.1| hypothetical protein AWE27_22535 [Escherichia coli]
 gb|PDO52629.1| hypothetical protein AWE29_18375 [Escherichia coli]
 gb|PDO57243.1| hypothetical protein AWE18_19685 [Escherichia coli]
 gb|PDO65489.1| hypothetical protein AWE21_02250 [Escherichia coli]
 gb|PDO67447.1| hypothetical protein AWE28_17095 [Escherichia coli]
 gb|PDS08292.1| hypothetical protein CMR88_19150 [Escherichia coli]
 gb|PDS21146.1| hypothetical protein CMR87_02740 [Escherichia coli]
 gb|PDT96497.1| hypothetical protein A6V21_07700 [Escherichia coli]
 gb|PDU02557.1| hypothetical protein A6V20_02960 [Escherichia coli]
 gb|PDU05150.1| hypothetical protein A6V19_18295 [Escherichia coli]
 gb|PDU12936.1| hypothetical protein A6V18_06595 [Escherichia coli]
 gb|PDU14377.1| hypothetical protein A6V17_23430 [Escherichia coli]
 gb|PDU23618.1| hypothetical protein A6V16_03640 [Escherichia coli]
 gb|PDU28777.1| hypothetical protein A6V14_05880 [Escherichia coli]
 gb|PDU34051.1| hypothetical protein A6V13_07310 [Escherichia coli]
 gb|PDU39830.1| hypothetical protein A6V12_05650 [Escherichia coli]
 gb|PDU46844.1| hypothetical protein A6V11_00145 [Escherichia coli]
 gb|PDU52447.1| hypothetical protein A6V10_02675 [Escherichia coli]
 gb|PDU58748.1| hypothetical protein A6V09_01320 [Escherichia coli]
 gb|PDU62954.1| hypothetical protein A6V08_08195 [Escherichia coli]
 gb|PDU68609.1| hypothetical protein A6V07_06310 [Escherichia coli]
 gb|PDU74048.1| hypothetical protein A6V06_05275 [Escherichia coli]
 gb|PDU79765.1| hypothetical protein A6V05_05645 [Escherichia coli]
 gb|PDU85487.1| hypothetical protein A6V04_05700 [Escherichia coli]
 gb|PDU91442.1| hypothetical protein A6V03_02060 [Escherichia coli]
 gb|PDU97767.1| hypothetical protein A6V02_00145 [Escherichia coli]
 gb|PDV03377.1| hypothetical protein A6V00_00560 [Escherichia coli]
 gb|PDV07279.1| hypothetical protein BER16_08300 [Escherichia coli]
 gb|PDV12040.1| hypothetical protein BER15_12550 [Escherichia coli]
 gb|PDV17149.1| hypothetical protein BER11_12670 [Escherichia coli]
 gb|PDV21875.1| hypothetical protein BER05_18735 [Escherichia coli]
 gb|PDV29606.1| hypothetical protein BER19_06295 [Escherichia coli]
 gb|PDV33647.1| hypothetical protein BER18_15000 [Escherichia coli]
 gb|PDV40260.1| hypothetical protein BER17_08275 [Escherichia coli]
 gb|PDV45316.1| hypothetical protein BER14_08685 [Escherichia coli]
 gb|PDV51048.1| hypothetical protein BER13_07385 [Escherichia coli]
 gb|PDV60373.1| hypothetical protein BER10_01315 [Escherichia coli]
 gb|PDV66805.1| hypothetical protein BER09_07735 [Escherichia coli]
 gb|PDV70611.1| hypothetical protein BER08_14405 [Escherichia coli]
 gb|PDV78703.1| hypothetical protein BER07_01055 [Escherichia coli]
 gb|PDV81229.1| hypothetical protein BER06_17080 [Escherichia coli]
 gb|PDV96206.1| hypothetical protein A6V01_00145 [Escherichia coli]
 gb|PEG24118.1| hypothetical protein BSR05_03870 [Escherichia coli]
 gb|PEH63169.1| hypothetical protein CRM85_23435 [Escherichia coli]
 gb|PEH93728.1| hypothetical protein CRM80_13525 [Escherichia coli]
 gb|PEI18516.1| hypothetical protein CRM84_13775 [Escherichia coli]
 gb|PGF77091.1| hypothetical protein BMR21_23845 [Escherichia coli]
 gb|PGF97055.1| hypothetical protein BMR26_15910 [Escherichia coli]
 gb|PGG03984.1| hypothetical protein BMR32_06695 [Escherichia coli]
 gb|PGG06757.1| hypothetical protein BMR25_00700 [Escherichia coli]
 gb|PGG10440.1| hypothetical protein BMR31_24525 [Escherichia coli]
 gb|PGG11005.1| hypothetical protein BMR30_11660 [Escherichia coli]
 gb|PGG16390.1| hypothetical protein BMR29_05050 [Escherichia coli]
 gb|PGG25519.1| hypothetical protein BMR28_02555 [Escherichia coli]
 gb|PGG29708.1| hypothetical protein BMR27_01420 [Escherichia coli]
 gb|PGG38246.1| hypothetical protein BMT48_02600 [Escherichia coli]
 gb|PGG41932.1| hypothetical protein BMR12_02660 [Escherichia coli]
 gb|PGG42716.1| hypothetical protein BMR14_24470 [Escherichia coli]
 gb|PGG50164.1| hypothetical protein BMR16_07945 [Escherichia coli]
 gb|PGG58974.1| hypothetical protein BMR33_20865 [Escherichia coli]
 gb|PGG59265.1| hypothetical protein BMR13_00395 [Escherichia coli]
 gb|PGG63876.1| hypothetical protein BMR17_21170 [Escherichia coli]
 gb|PHG87766.1| hypothetical protein CRX50_16995 [Escherichia coli]
 gb|ATM27069.1| hypothetical protein CRN16_12400 [Escherichia coli]
 gb|PHK73499.1| hypothetical protein CQR97_01675 [Escherichia coli]
 gb|PHL28952.1| hypothetical protein BMR39_21625 [Escherichia coli]
 gb|PHL34175.1| hypothetical protein BMR35_20210 [Escherichia coli]
 gb|PHL53163.1| hypothetical protein BMR55_22310 [Escherichia coli]
 gb|PHL95352.1| hypothetical protein CQR85_12160 [Escherichia coli]
 gb|PHM02098.1| hypothetical protein BMR59_00905 [Escherichia coli]
 gb|ATO78169.1| hypothetical protein I51_19310 [Escherichia coli O91 str. RM7190]
 gb|PHU62076.1| hypothetical protein CSW73_11575 [Shigella sonnei]
 gb|PHU66455.1| hypothetical protein CSW74_12640 [Shigella sonnei]
 gb|PHU69569.1| hypothetical protein CSW72_20210 [Shigella boydii]
 gb|PHU75191.1| hypothetical protein CSW71_12060 [Shigella sonnei]
 gb|PHU79534.1| hypothetical protein CSW70_12060 [Shigella sonnei]
 gb|PHU82626.1| hypothetical protein CSW68_20295 [Shigella boydii]
 gb|PHU88138.1| hypothetical protein CSW69_12845 [Shigella sonnei]
 gb|PHU91399.1| hypothetical protein CSW67_20315 [Shigella boydii]
 gb|PHU96457.1| hypothetical protein CSW66_17295 [Shigella boydii]
 gb|ATP24890.1| hypothetical protein CQ842_15450 [Escherichia coli]
 gb|PIM09118.1| hypothetical protein CT145_08860 [Escherichia coli]
 gb|PIM14166.1| hypothetical protein CT150_08305 [Escherichia coli]
 gb|PIM25529.1| hypothetical protein CT146_02640 [Escherichia coli]
 gb|PIM28663.1| hypothetical protein CT143_11305 [Escherichia coli]
 gb|PIM33682.1| hypothetical protein CT142_07975 [Escherichia coli]
 gb|PIM42388.1| hypothetical protein CT148_15575 [Escherichia coli]
 gb|PIM48695.1| hypothetical protein CT144_08560 [Escherichia coli]
 gb|PIM64155.1| hypothetical protein CTI77_07625 [Escherichia coli]
 gb|ATV10415.1| hypothetical protein CDW44_17995 [Escherichia coli]
 gb|PIS72330.1| membrane protein [Escherichia coli O55:H7 str. USDA 5905]
 gb|ATX10692.1| hypothetical protein CU078_19410 [Escherichia coli]
 gb|PJF57787.1| hypothetical protein CVD17_10435 [Escherichia coli]
 gb|PJF62155.1| hypothetical protein CVD20_12365 [Escherichia coli]
 gb|PJF67416.1| hypothetical protein CVD22_08185 [Escherichia coli]
 gb|PJF70215.1| hypothetical protein CVD24_19060 [Escherichia coli]
 gb|PJF75835.1| hypothetical protein CVE12_13920 [Escherichia coli]
 gb|PJF81610.1| hypothetical protein CVE13_07180 [Escherichia coli]
 gb|PJF86300.1| hypothetical protein CVE14_07560 [Escherichia coli]
 gb|PJF90594.1| hypothetical protein CVE15_09035 [Escherichia coli]
 gb|PJF92608.1| hypothetical protein CVE17_23100 [Escherichia coli]
 gb|PJG01216.1| hypothetical protein CVE18_00880 [Escherichia coli]
 gb|PJG02379.1| hypothetical protein CVE19_19165 [Escherichia coli]
 gb|PJG07852.1| hypothetical protein CVE10_15860 [Escherichia coli]
 gb|PJG13623.1| hypothetical protein CVE11_09245 [Escherichia coli]
 gb|PJG17878.1| hypothetical protein CVH04_16095 [Escherichia coli]
 gb|PJG21862.1| hypothetical protein CVH06_18770 [Escherichia coli]
 gb|PJG28729.1| hypothetical protein CVH07_07395 [Escherichia coli]
 gb|PJG30859.1| hypothetical protein CVH05_25215 [Escherichia coli]
 gb|PJG74108.1| hypothetical protein CVO79_12670 [Escherichia coli]
 gb|ATY22408.1| hypothetical protein AM346_00700 [Escherichia coli]
 gb|PJH96401.1| hypothetical protein CSI02_21085 [Escherichia coli]
 gb|PJI58481.1| hypothetical protein CTU84_12855 [Escherichia coli]
 gb|PJI62680.1| hypothetical protein CTY41_15785 [Escherichia coli]
 gb|PJO18902.1| hypothetical protein CWB44_06025 [Escherichia coli]
 gb|ATX34196.1| hypothetical protein CUC42_03620 [Escherichia coli]
 gb|ATZ39734.1| hypothetical protein CWB37_20880 [Escherichia coli]
 gb|PJR32488.1| membrane protein [Escherichia coli O157:H7 str. TW14313]
 gb|PJR38343.1| membrane protein [Escherichia coli O55:H7 str. TB182A]
 gb|PJR43896.1| membrane protein [Escherichia coli O157:H7 str. EC1825]
 gb|PJW25845.1| hypothetical protein CWM40_11270 [Escherichia coli]
 gb|PJW29807.1| hypothetical protein CWM41_19905 [Escherichia coli]
 gb|PJW41043.1| hypothetical protein CWM43_13020 [Escherichia coli]
 gb|PJW49737.1| hypothetical protein CWD54_15310 [Escherichia coli]
 gb|PJW54730.1| hypothetical protein CWD55_15305 [Escherichia coli]
 gb|PJW61264.1| hypothetical protein CWD56_07020 [Escherichia coli]
 gb|PJW80527.1| hypothetical protein CWD60_10430 [Escherichia coli]
 gb|PJW86273.1| hypothetical protein CWD59_07210 [Escherichia coli]
 gb|PJW99262.1| hypothetical protein CWI54_12455 [Escherichia coli]
 gb|PJX02352.1| hypothetical protein CWI62_20965 [Escherichia coli]
 gb|ATZ33287.1| membrane protein [Escherichia coli]
 gb|PJX79906.1| hypothetical protein CWM23_16545 [Escherichia coli]
 gb|PJX87004.1| hypothetical protein CWM27_08160 [Escherichia coli]
 gb|PJX92963.1| hypothetical protein CWM26_06140 [Escherichia coli]
 gb|PJX95372.1| hypothetical protein CWM24_23320 [Escherichia coli]
 gb|PJY00940.1| hypothetical protein CWM30_22115 [Escherichia coli]
 gb|PJY06964.1| hypothetical protein CWM29_19740 [Escherichia coli]
 gb|PJY14623.1| hypothetical protein CWM25_08310 [Escherichia coli]
 gb|PJY30402.1| hypothetical protein CWM31_08335 [Escherichia coli]
 gb|PJY36530.1| hypothetical protein CWM33_01410 [Escherichia coli]
 gb|PJY41437.1| hypothetical protein CWM34_04500 [Escherichia coli]
 gb|PJY44394.1| hypothetical protein CWM35_18680 [Escherichia coli]
 gb|PJY56194.1| hypothetical protein CWM38_10945 [Escherichia coli]
 gb|PJY62740.1| hypothetical protein CWM37_06065 [Escherichia coli]
 gb|PJY90439.1| hypothetical protein CK493_18290 [Shigella sonnei]
 emb|SMZ43640.1| Inner membrane protein YqjK [Escherichia coli]
 gb|AUA40935.1| hypothetical protein CWI33_10165 [Escherichia coli]
 gb|AUA43744.1| hypothetical protein CWO47_00560 [Escherichia coli]
 gb|PKD48622.1| hypothetical protein CWS19_24200 [Escherichia coli]
 gb|PKD59292.1| hypothetical protein CW272_14475 [Escherichia coli]
 gb|PKD64174.1| hypothetical protein CW275_14145 [Escherichia coli]
 gb|PKD66215.1| hypothetical protein CW277_27065 [Escherichia coli]
 gb|PKD77514.1| hypothetical protein CW281_04075 [Escherichia coli]
 gb|PKD89469.1| hypothetical protein CW283_03435 [Escherichia coli]
 gb|PKD90521.1| hypothetical protein CWS33_07900 [Escherichia coli]
 gb|PKD94733.1| hypothetical protein CW276_17795 [Escherichia coli]
 gb|PKE01149.1| hypothetical protein CW285_24945 [Escherichia coli]
 gb|PKE09544.1| hypothetical protein CW282_22115 [Escherichia coli]
 gb|PKE80310.1| hypothetical protein CW278_05615 [Escherichia coli]
 gb|PKE84283.1| hypothetical protein CW274_13375 [Escherichia coli]
 gb|PKE90619.1| hypothetical protein CW273_02760 [Escherichia coli]
 gb|PKE91429.1| hypothetical protein CW279_29945 [Escherichia coli]
 gb|PKF01567.1| hypothetical protein CW280_07660 [Escherichia coli]
 gb|PKF09628.1| hypothetical protein CW284_05000 [Escherichia coli]
 gb|PKF10876.1| hypothetical protein CW286_24945 [Escherichia coli]
 gb|PKI94381.1| hypothetical protein CXF23_26035 [Escherichia coli]
 gb|PKJ08526.1| hypothetical protein CXF19_07735 [Escherichia coli]
 gb|PKJ12289.1| hypothetical protein CXF20_16710 [Escherichia coli]
 gb|PKJ15684.1| hypothetical protein CXF17_22545 [Escherichia coli]
 gb|PKJ21046.1| hypothetical protein CXF16_11635 [Escherichia coli]
 gb|PKJ31488.1| hypothetical protein CXF13_02635 [Escherichia coli]
 gb|PKJ34958.1| hypothetical protein CXF11_03700 [Escherichia coli]
 gb|PKJ36634.1| hypothetical protein CXF12_23195 [Escherichia coli]
 gb|PKJ43865.1| hypothetical protein CXF09_14470 [Escherichia coli]
 gb|PKJ47651.1| hypothetical protein CXF14_23700 [Escherichia coli]
 gb|PKQ95408.1| hypothetical protein CVV74_14410 [Escherichia coli]
 gb|PKR61007.1| hypothetical protein CGZ52_24485 [Escherichia coli]
 gb|PKR69645.1| hypothetical protein CW271_07690 [Escherichia coli]
 gb|PKR72623.1| hypothetical protein CW270_21185 [Escherichia coli]
 gb|AUG66264.1| hypothetical protein CXG97_18810 [Escherichia coli]
 gb|AUG95025.1| hypothetical protein MS8345_03461 [Escherichia coli]
 gb|PKZ11920.1| hypothetical protein CYJ52_13725 [Escherichia coli]
 gb|PKZ31444.1| hypothetical protein CYJ55_20140 [Escherichia coli]
 gb|PKZ49541.1| hypothetical protein CYJ54_16455 [Escherichia coli]
 gb|PLA98942.1| hypothetical protein CYR82_21260 [Escherichia coli]
 gb|PLB59057.1| hypothetical protein APX94_07910 [Escherichia coli]
 gb|PLB66799.1| hypothetical protein APY01_17465 [Escherichia coli]
 gb|PLB71688.1| hypothetical protein AZE08_18055 [Escherichia coli]
 gb|PLB79269.1| hypothetical protein APX96_01575 [Escherichia coli]
 gb|AUJ89580.1| hypothetical protein CR540_03505 [Escherichia coli]
 gb|AUJ97553.1| hypothetical protein CR539_20780 [Escherichia coli]
 gb|AUJ99560.1| hypothetical protein CR538_03545 [Escherichia coli]
 gb|PLK08157.1| hypothetical protein B7L60_10685 [Escherichia coli]
 gb|PLK13498.1| hypothetical protein B7L63_06545 [Escherichia coli]
 gb|PLR16091.1| hypothetical protein CHQ87_004165 [Escherichia coli]
 gb|AUF92541.1| hypothetical protein BH100B_03513 [Escherichia coli]
 gb|AUL68570.1| hypothetical protein BVL39_10610 [Escherichia coli]
 gb|AUL83401.1| hypothetical protein CRT55_04335 [Escherichia coli]
 gb|AUL91965.1| hypothetical protein CR916_24415 [Escherichia coli]
 gb|AUM20931.1| hypothetical protein CP957_03470 [Escherichia coli]
 gb|PMB58373.1| hypothetical protein C1A36_25865 [Escherichia coli]
 gb|PMD76179.1| hypothetical protein A8A11_14565 [Escherichia coli]
 gb|PMD89472.1| hypothetical protein A8A05_03265 [Escherichia coli]
 gb|AUO39815.1| hypothetical protein C0R78_03760 [Escherichia coli]
 gb|PNC00054.1| hypothetical protein C1I39_05120 [Escherichia coli]
 gb|PNC03191.1| hypothetical protein C1I42_05120 [Escherichia coli]
 gb|AUQ38953.1| hypothetical protein BH100L_03365 [Escherichia coli]
 gb|PND70077.1| hypothetical protein C1X10_08610 [Escherichia coli]
 gb|AUR80648.1| Inner membrane protein YqjK (plasmid) [Escherichia coli]
 gb|PNL70412.1| hypothetical protein CEP71_012530 [Escherichia coli O157]
 gb|PNM71794.1| hypothetical protein AL488_001000 [Shigella sonnei]
 gb|PNO47899.1| hypothetical protein MC59_006110 [Shigella sonnei]
 gb|PNP02509.1| hypothetical protein RK59_009430 [Shigella flexneri]
 gb|PNP62760.1| hypothetical protein AL530_005850 [Escherichia coli]
 gb|AUP45200.1| membrane protein [Escherichia coli]
 gb|PNR04985.1| hypothetical protein C1629_08340 [Escherichia coli]
 gb|PNR06150.1| hypothetical protein C1630_20650 [Escherichia coli]
 gb|PNR17710.1| hypothetical protein BA882_18670 [Escherichia coli]
 gb|AUT07605.1| hypothetical protein C1467_03385 [Escherichia coli]
 gb|AUN91944.1| hypothetical protein BH100N_03523 [Escherichia coli]
 gb|PNY52013.1| hypothetical protein C2M27_18735 [Escherichia coli]
 gb|PNY68964.1| hypothetical protein C2M16_04670 [Escherichia coli]
 gb|AUV32448.1| hypothetical protein C2U48_18045 [Escherichia coli]
 gb|POF69437.1| hypothetical protein C2W55_00175 [Escherichia coli]
 gb|POF70645.1| hypothetical protein C2W44_19645 [Escherichia coli]
 gb|POF79444.1| hypothetical protein C2W48_00885 [Escherichia coli]
 gb|POF81817.1| hypothetical protein C2W54_14940 [Escherichia coli]
 gb|AUU30465.1| hypothetical protein MC63_005105 [Shigella flexneri]
 gb|POH48022.1| hypothetical protein C2U36_00130 [Escherichia coli]
 gb|POH79306.1| hypothetical protein C2858_06760 [Escherichia coli]
 gb|POH93747.1| hypothetical protein C3B65_08885 [Escherichia coli]
 gb|POI00203.1| hypothetical protein C3B69_11745 [Escherichia coli]
 gb|POI14096.1| hypothetical protein C3B68_02565 [Escherichia coli]
 gb|POL47907.1| hypothetical protein C3F33_06860 [Escherichia coli]
 gb|POL53222.1| hypothetical protein C3F30_05035 [Escherichia coli]
 gb|POL63360.1| hypothetical protein C3F29_05260 [Escherichia coli]
 gb|POL69835.1| hypothetical protein C3F32_09830 [Escherichia coli]
 gb|POL72008.1| hypothetical protein C3F24_12955 [Escherichia coli]
 gb|POL78230.1| hypothetical protein C3F31_10345 [Escherichia coli]
 gb|POL87041.1| hypothetical protein C3F23_08375 [Escherichia coli]
 gb|POL90727.1| hypothetical protein C3F28_00320 [Escherichia coli]
 gb|POM02968.1| hypothetical protein C3F27_00215 [Escherichia coli]
 gb|POM04000.1| hypothetical protein C3F21_06160 [Escherichia coli]
 gb|POM04624.1| hypothetical protein C3F26_02360 [Escherichia coli]
 gb|AUX00877.1| Inner membrane protein YqjK [Escherichia coli]
 gb|POO40721.1| hypothetical protein CTZ36_14710 [Escherichia coli]
 gb|POO47866.1| hypothetical protein CTZ33_03330 [Escherichia coli]
 gb|AUY03999.1| hypothetical protein C3F40_20870 [Escherichia coli]
 gb|AUY44260.1| hypothetical protein C3K24_11280 [Escherichia coli]
 gb|AUY27858.1| Inner membrane protein YqjK [Escherichia coli]
 gb|POS23947.1| hypothetical protein BJN38_00575 [Escherichia coli]
 gb|POS25803.1| hypothetical protein BJN43_00950 [Escherichia coli]
 gb|POS31425.1| hypothetical protein BJN46_04100 [Escherichia coli]
 gb|POS34381.1| hypothetical protein BJP21_10360 [Escherichia coli]
 gb|POS45390.1| hypothetical protein BJP17_11495 [Escherichia coli]
 gb|POS46652.1| hypothetical protein BJP18_13670 [Escherichia coli]
 gb|POS54687.1| hypothetical protein BJP19_14420 [Escherichia coli]
 gb|POS59873.1| hypothetical protein BJP20_06275 [Escherichia coli]
 gb|POT07039.1| hypothetical protein C3735_03535 [Escherichia coli]
 gb|POT09118.1| hypothetical protein C3740_02955 [Escherichia coli]
 gb|POT09447.1| hypothetical protein C3739_02920 [Escherichia coli]
 gb|POT18879.1| hypothetical protein C3738_02950 [Escherichia coli]
 gb|POT22029.1| hypothetical protein C3736_02955 [Escherichia coli]
 gb|POT23242.1| hypothetical protein C3742_03195 [Escherichia coli]
 gb|AUZ90612.1| hypothetical protein BXO92_05990 [Escherichia coli]
 gb|PPE16319.1| hypothetical protein C3R75_10695 [Escherichia coli]
 gb|PPE18547.1| hypothetical protein C4Y12_15900 [Escherichia coli]
 gb|PPE27236.1| hypothetical protein C4Y10_09310 [Escherichia coli]
 gb|PPE32389.1| hypothetical protein C4K41_03360 [Escherichia coli]
 gb|PPE41110.1| hypothetical protein C4M75_12425 [Escherichia coli]
 gb|PPE45959.1| hypothetical protein C4M76_13890 [Escherichia coli]
 gb|PPE49870.1| hypothetical protein C4M77_20810 [Escherichia coli]
 gb|AVE95394.1| hypothetical protein AM456_17695 [Escherichia coli]
 gb|AVG00759.1| hypothetical protein AL502_15110 [Escherichia coli]
 gb|PPV48554.1| hypothetical protein C5O83_11730 [Escherichia coli]
 gb|PPV58286.1| hypothetical protein C5O86_03330 [Escherichia coli]
 gb|PPV72277.1| hypothetical protein C5O92_05470 [Escherichia coli]
 gb|PPV83536.1| hypothetical protein C5O94_21845 [Escherichia coli]
 gb|PPV86270.1| hypothetical protein C5O84_19610 [Escherichia coli]
 gb|PPW03632.1| hypothetical protein C5O88_04895 [Escherichia coli]
 gb|PPW12628.1| hypothetical protein C5P08_00040 [Escherichia coli]
 gb|PPW20200.1| hypothetical protein C5P42_02440 [Escherichia coli]
 gb|PPW26824.1| hypothetical protein C5P10_07360 [Escherichia coli]
 gb|PPW30879.1| hypothetical protein C5P33_11050 [Escherichia coli]
 gb|PPW35841.1| hypothetical protein C5O95_03905 [Escherichia coli]
 gb|PPW40441.1| hypothetical protein C5O99_17485 [Escherichia coli]
 gb|PPW49358.1| hypothetical protein C5P17_07750 [Escherichia coli]
 gb|PPW53882.1| hypothetical protein C5P39_12930 [Escherichia coli]
 gb|PPW61086.1| hypothetical protein C5P18_09690 [Escherichia coli]
 gb|PPW66281.1| hypothetical protein C5P01_03080 [Escherichia coli]
 gb|PPW70197.1| hypothetical protein C5P00_19335 [Escherichia coli]
 gb|PPW79947.1| hypothetical protein C5P12_23210 [Escherichia coli]
 gb|PPW86832.1| hypothetical protein C5P09_14190 [Escherichia coli]
 gb|PPW98326.1| hypothetical protein C5P04_03715 [Escherichia coli]
 gb|PPX04115.1| hypothetical protein C5P15_08295 [Escherichia coli]
 gb|PPX26694.1| hypothetical protein C5O96_09055 [Escherichia coli]
 gb|PPX35400.1| hypothetical protein C5P02_21360 [Escherichia coli]
 gb|PPX50115.1| hypothetical protein C5P13_07860 [Escherichia coli]
 gb|PPX54385.1| hypothetical protein C5P16_06770 [Escherichia coli]
 gb|PPX59216.1| hypothetical protein C5P07_12550 [Escherichia coli]
 gb|PPY60282.1| hypothetical protein C5P28_17190 [Escherichia coli]
 gb|PPY65929.1| hypothetical protein C5P38_17970 [Escherichia coli]
 gb|PPY75784.1| hypothetical protein C5P37_11300 [Escherichia coli]
 gb|PPY90226.1| hypothetical protein C5P45_07865 [Escherichia coli]
 gb|PPZ08917.1| hypothetical protein C5P44_00900 [Escherichia coli]
 gb|PPZ15704.1| hypothetical protein C5P29_09630 [Escherichia coli]
 gb|PPZ21959.1| hypothetical protein C5P34_06300 [Escherichia coli]
 gb|PPZ31660.1| hypothetical protein C5P40_07770 [Escherichia coli]
 gb|PPZ36679.1| hypothetical protein C5P36_10760 [Escherichia coli]
 gb|PPZ43253.1| hypothetical protein C5P26_05600 [Escherichia coli]
 gb|PPZ55240.1| hypothetical protein C5P43_12765 [Escherichia coli]
 gb|PPZ99426.1| hypothetical protein C5F43_08415 [Escherichia coli]
 gb|PQA05226.1| hypothetical protein C5F33_14240 [Escherichia coli]
 gb|PQA10307.1| hypothetical protein C5F30_07880 [Escherichia coli]
 gb|PQA12870.1| hypothetical protein C5F42_11500 [Escherichia coli]
 gb|PQA21217.1| hypothetical protein C5F40_14855 [Escherichia coli]
 gb|PQA22171.1| hypothetical protein C5F37_09110 [Escherichia coli]
 gb|PQA26681.1| hypothetical protein C5F39_14575 [Escherichia coli]
 gb|PQA32981.1| hypothetical protein C5F29_12325 [Escherichia coli]
 gb|PQA38612.1| hypothetical protein C5F34_11875 [Escherichia coli]
 gb|PQA40086.1| hypothetical protein C5F36_21570 [Escherichia coli]
 gb|PQA48703.1| hypothetical protein C5F41_11555 [Escherichia coli]
 gb|PQA55324.1| hypothetical protein C5F38_12160 [Escherichia coli]
 gb|PQA64953.1| hypothetical protein C5F31_11070 [Escherichia coli]
 gb|PQA69510.1| hypothetical protein C5F32_09450 [Escherichia coli]
 gb|PQH08191.1| hypothetical protein C5F35_16490 [Escherichia coli]
 gb|PQK31256.1| hypothetical protein C5Y85_14480 [Escherichia coli]
 gb|PQK48822.1| hypothetical protein C5Y92_07815 [Escherichia coli]
 gb|PQK67715.1| hypothetical protein C5Y89_05410 [Escherichia coli]
 gb|AVJ14796.1| hypothetical protein B1T56_19830 [Escherichia coli]
 gb|PQN08905.1| hypothetical protein C5K18_09265 [Shigella dysenteriae]
 gb|PQN24252.1| hypothetical protein C5K23_29980 [Shigella boydii]
 gb|PQN56710.1| hypothetical protein C5K24_09190 [Shigella boydii]
 gb|PQO00459.1| hypothetical protein C5K15_17735 [Shigella dysenteriae]
 gb|AVJ76883.1| yqjK-like family protein [Escherichia coli]
 gb|PQV22655.1| hypothetical protein CX383_000885 [Escherichia coli]
 gb|PQV25292.1| hypothetical protein CYD33_018260 [Escherichia coli]
 gb|PQV33993.1| hypothetical protein C1N94_014425 [Escherichia coli]
 gb|PQV40329.1| hypothetical protein CYD32_005705 [Escherichia coli]
 gb|PRB39087.1| hypothetical protein CQ036_05220 [Escherichia coli]
 gb|PRC27454.1| hypothetical protein CQ003_06025 [Escherichia coli]
 gb|AVM05039.1| hypothetical protein C6P57_15290 [Escherichia coli]
 gb|PRP03381.1| hypothetical protein C6X66_16120 [Escherichia coli]
 gb|PRP05807.1| hypothetical protein C6X64_10030 [Escherichia coli]
 gb|PRP07657.1| hypothetical protein C6X67_00935 [Escherichia coli]
 gb|PRP15040.1| hypothetical protein C6X63_10165 [Escherichia coli]
 gb|PRP17579.1| hypothetical protein C6X65_10275 [Escherichia coli]
 gb|PRP23381.1| hypothetical protein C6T22_25160 [Escherichia coli]
 gb|PRP24212.1| hypothetical protein C6T25_17850 [Escherichia coli]
 gb|PRP25119.1| hypothetical protein C6T23_10330 [Escherichia coli]
 gb|PRP38799.1| hypothetical protein C6P05_09470 [Escherichia coli]
 gb|PRP42452.1| hypothetical protein C6T24_10490 [Escherichia coli]
 gb|PRP45853.1| hypothetical protein C6P06_16300 [Escherichia coli]
 gb|AVM99756.1| hypothetical protein CXB56_06885 [Escherichia coli]
 gb|AVN09002.1| yqjK-like family protein [Escherichia coli]
 gb|AVL08073.1| hypothetical protein C6C13_05400 [Escherichia coli]
 gb|PRT59967.1| hypothetical protein C6086_17470 [Escherichia coli]
 gb|PRW37181.1| yqjK-like family protein [Escherichia coli]
 gb|PSB94203.1| hypothetical protein C6954_16900 [Escherichia coli]
 gb|PSF27515.1| hypothetical protein C6982_18010 [Escherichia coli]
 gb|PSF41292.1| hypothetical protein C6983_17900 [Escherichia coli]
 gb|PSF59028.1| hypothetical protein C6981_18155 [Escherichia coli]
 gb|PSF72955.1| hypothetical protein C6968_17910 [Escherichia coli]
 gb|PSF79373.1| hypothetical protein C6970_17130 [Escherichia coli]
 gb|PSG01709.1| hypothetical protein C6967_16520 [Escherichia coli]
 gb|PSG05628.1| hypothetical protein C6971_17090 [Escherichia coli]
 gb|PSG15475.1| hypothetical protein C6972_18105 [Escherichia coli]
 gb|PSG48338.1| hypothetical protein C6969_16845 [Escherichia coli]
 gb|PSG81409.1| hypothetical protein C6986_19975 [Escherichia coli]
          Length = 99

 Score =  197 bits (500), Expect = 4e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLE TGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98


>ref|WP_000096087.1| hypothetical protein [Escherichia coli]
 gb|EGI49575.1| putative inner membrane protein [Escherichia coli H299]
 gb|EMD08070.1| hypothetical protein A364_16273 [Escherichia coli SEPT362]
 gb|EQP69487.1| hypothetical protein G742_03340 [Escherichia coli HVH 79 (4-2512823)]
 gb|EQT59230.1| hypothetical protein G840_03356 [Escherichia coli HVH 188
            (4-2356988)]
 gb|EYZ96146.1| membrane protein [Escherichia coli O119:H4 str. 03-3458]
 gb|KDX52291.1| yqjK-like family protein [Escherichia coli 2-177-06_S4_C1]
 gb|AKK40643.1| membrane protein [Escherichia coli APEC O2-211]
 gb|KLX58110.1| hypothetical protein SK78_02363 [Escherichia coli]
 gb|KNY77805.1| hypothetical protein AGA26_04650 [Escherichia coli]
 gb|ALL88782.1| hypothetical protein MJ49_14765 [Escherichia coli]
 gb|KUR84274.1| hypothetical protein AWE63_03375 [Escherichia coli]
 gb|OAP66750.1| hypothetical protein A8A56_19040 [Escherichia coli]
 gb|OCQ33274.1| hypothetical protein A6I95_17715 [Escherichia coli]
 gb|OJR04942.1| hypothetical protein BK373_10600 [Escherichia coli]
 gb|APK42358.1| membrane protein [Escherichia coli]
 gb|OMI52205.1| membrane protein [Escherichia coli N40513]
 gb|ONG23413.1| hypothetical protein BWX43_06990 [Escherichia coli]
 gb|OOJ28709.1| hypothetical protein BMT90_08170 [Escherichia coli]
 gb|OOK14573.1| hypothetical protein BMT92_08185 [Escherichia coli]
 gb|AQU94200.1| hypothetical protein B1200_02040 [Escherichia coli]
 dbj|BAX12572.1| hypothetical protein MRY16002_c32380 [Escherichia coli]
 gb|ORS89201.1| hypothetical protein BHS89_18265 [Escherichia coli]
 gb|ORT13688.1| hypothetical protein BGP71_18185 [Escherichia coli]
 gb|ORT17620.1| hypothetical protein BGP70_17735 [Escherichia coli]
 gb|OUG20183.1| hypothetical protein AZZ65_002448 [Escherichia coli]
 gb|OUJ69966.1| hypothetical protein BZK35_05050 [Escherichia coli]
 gb|OWG55566.1| hypothetical protein CCE17_06240 [Escherichia coli]
 gb|OWX80587.1| hypothetical protein BIQ87_17600 [Escherichia coli]
 gb|OWX81547.1| hypothetical protein BIQ86_18365 [Escherichia coli]
 gb|ASJ35488.1| membrane protein [Escherichia coli]
 gb|PBK31058.1| hypothetical protein CMR91_01940 [Escherichia coli]
 gb|PBK37256.1| hypothetical protein CMR90_04165 [Escherichia coli]
 gb|PBK47149.1| hypothetical protein CMR85_02035 [Escherichia coli]
 gb|PCS73169.1| hypothetical protein BMR46_04115 [Escherichia coli]
 gb|PDM30153.1| hypothetical protein CQR81_11290 [Escherichia coli]
 gb|PIM38396.1| hypothetical protein CT147_08670 [Escherichia coli]
 gb|PJW91128.1| hypothetical protein CWD62_03755 [Escherichia coli]
 gb|PJY17348.1| hypothetical protein CWM28_20950 [Escherichia coli]
 gb|PJY25378.1| hypothetical protein CWM32_05305 [Escherichia coli]
 gb|PKI87187.1| hypothetical protein CXF22_21450 [Escherichia coli]
 gb|PKJ02629.1| hypothetical protein CXF25_09585 [Escherichia coli]
 gb|AUK05028.1| hypothetical protein CR537_03780 [Escherichia coli]
 gb|POS14710.1| hypothetical protein BJN40_12830 [Escherichia coli]
 gb|PPE36956.1| hypothetical protein C4K42_06880 [Escherichia coli]
 gb|PSK08787.1| hypothetical protein C7R80_21780 [Escherichia coli]
 gb|PSK22355.1| hypothetical protein C7R82_21715 [Escherichia coli]
 gb|PSL58848.1| hypothetical protein C7R62_24130 [Escherichia coli]
 gb|PSL67764.1| hypothetical protein C7R59_19260 [Escherichia coli]
 gb|PSL69014.1| hypothetical protein C7R61_06005 [Escherichia coli]
 gb|PSL78125.1| hypothetical protein C7R58_01520 [Escherichia coli]
          Length = 99

 Score =  197 bits (500), Expect = 4e-60
 Identities = 96/98 (97%), Positives = 97/98 (98%)
 Frame = +2

Query: 713  VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVM 892
            +SSKVERERRKAQLLSQIQQQRLDLSASRREWLE TGAYDRRWNMLLSLRSWALVGSSVM
Sbjct: 1    MSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNMLLSLRSWALVGSSVM 60

Query: 893  AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 1006
            AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR
Sbjct: 61   AIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLR 98