BLASTX nr result
ID: Acanthopanax21_contig00000278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00000278 (715 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFX67016.1| 30S ribosomal protein S7, partial [Solanum tubero... 128 2e-34 gb|OTG29917.1| putative ribosomal protein S7 domain protein [Hel... 127 7e-34 gb|AEK71580.1| ribosomal protein S7, partial (plastid) [Stylobas... 126 7e-34 gb|KJB23822.1| hypothetical protein B456_004G116400, partial [Go... 125 1e-33 gb|AUF33485.1| ribosomal protein S7 (chloroplast) [Hydrangea het... 128 1e-33 ref|YP_009442293.1| ribosomal protein S7 (chloroplast) [Iodes ci... 128 1e-33 ref|NP_054548.1| ribosomal protein S7 [Nicotiana tabacum] >gi|11... 128 1e-33 ref|YP_009306516.1| 30S ribosomal protein S7 (chloroplast) [Helw... 128 1e-33 ref|YP_009245718.1| ribosomal protein S7 (chloroplast) [Carum ca... 128 1e-33 ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] >gi|522208... 128 1e-33 ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum... 128 1e-33 gb|ABB90084.1| ribosomal protein S7 (chloroplast) [Solanum tuber... 128 1e-33 gb|AKZ24112.1| ribosomal protein S7 (plastid) [Impatiens capensi... 128 1e-33 ref|YP_009155340.1| ribosomal protein S7 (plastid) [Seseli monta... 128 1e-33 gb|AHW52243.1| ribosomal protein S7 (chloroplast) [Rhazya stricta] 128 1e-33 ref|YP_009108805.1| ribosomal protein S7 [Oncinotis tenuiloba] >... 128 1e-33 gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta]... 128 1e-33 gb|ADD29892.1| ribosomal protein S7 (chloroplast) [Ehretia acumi... 128 1e-33 ref|YP_008814990.1| ribosomal protein S7 (chloroplast) [Brassaio... 128 1e-33 gb|AGW04711.1| ribosomal protein S7 (plastid) [Matelea biflora] 128 1e-33 >gb|AFX67016.1| 30S ribosomal protein S7, partial [Solanum tuberosum] Length = 99 Score = 128 bits (321), Expect = 2e-34 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 35 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 94 Query: 184 FAHFR 198 FAHFR Sbjct: 95 FAHFR 99 >gb|OTG29917.1| putative ribosomal protein S7 domain protein [Helianthus annuus] Length = 105 Score = 127 bits (318), Expect = 7e-34 Identities = 63/65 (96%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRK+EETHRMAEANRA Sbjct: 41 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKREETHRMAEANRA 100 Query: 184 FAHFR 198 FAHFR Sbjct: 101 FAHFR 105 >gb|AEK71580.1| ribosomal protein S7, partial (plastid) [Stylobasium spathulatum] Length = 94 Score = 126 bits (317), Expect = 7e-34 Identities = 63/65 (96%), Positives = 63/65 (96%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 30 IGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 89 Query: 184 FAHFR 198 FAHFR Sbjct: 90 FAHFR 94 >gb|KJB23822.1| hypothetical protein B456_004G116400, partial [Gossypium raimondii] Length = 82 Score = 125 bits (315), Expect = 1e-33 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 +GSTQGK LAIRWLL ASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 18 LGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 77 Query: 184 FAHFR 198 FAHFR Sbjct: 78 FAHFR 82 >gb|AUF33485.1| ribosomal protein S7 (chloroplast) [Hydrangea heteromalla] gb|AUF33486.1| ribosomal protein S7 (chloroplast) [Hydrangea heteromalla] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_009442293.1| ribosomal protein S7 (chloroplast) [Iodes cirrhosa] ref|YP_009442277.1| ribosomal protein S7 (chloroplast) [Iodes cirrhosa] gb|ATN95358.1| ribosomal protein S7 (chloroplast) [Iodes cirrhosa] gb|ATN95375.1| ribosomal protein S7 (chloroplast) [Iodes cirrhosa] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|NP_054548.1| ribosomal protein S7 [Nicotiana tabacum] ref|NP_054569.1| ribosomal protein S7 [Nicotiana tabacum] ref|NP_783277.1| ribosomal protein S7 [Atropa belladonna] ref|NP_783291.1| ribosomal protein S7 [Atropa belladonna] ref|YP_358728.1| ribosomal protein S7 [Nicotiana sylvestris] ref|YP_358750.1| ribosomal protein S7 [Nicotiana sylvestris] ref|YP_398914.1| ribosomal protein S7 [Nicotiana tomentosiformis] ref|YP_398936.1| ribosomal protein S7 [Nicotiana tomentosiformis] ref|YP_538896.1| ribosomal protein S7 [Solanum bulbocastanum] ref|YP_538909.1| ribosomal protein S7 [Solanum bulbocastanum] ref|YP_635685.1| ribosomal protein S7 [Solanum tuberosum] ref|YP_635698.1| ribosomal protein S7 [Solanum tuberosum] ref|YP_004891657.1| rps7 gene product (chloroplast) [Nicotiana undulata] ref|YP_004891679.1| rps7 gene product (chloroplast) [Nicotiana undulata] ref|YP_006503837.1| ribosomal protein S7 (chloroplast) [Datura stramonium] ref|YP_006503851.1| ribosomal protein S7 (chloroplast) [Datura stramonium] ref|YP_008563135.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] ref|YP_008563148.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] ref|YP_009040367.1| ribosomal protein S7 [Hyoscyamus niger] ref|YP_009040381.1| ribosomal protein S7 [Hyoscyamus niger] ref|YP_009128226.1| ribosomal protein S7 (chloroplast) [Saracha punctata] ref|YP_009128884.1| ribosomal protein S7 (chloroplast) [Iochroma loxense] ref|YP_009128897.1| ribosomal protein S7 (chloroplast) [Iochroma loxense] ref|YP_009123677.1| ribosomal protein S7 (chloroplast) [Iochroma stenanthum] ref|YP_009123690.1| ribosomal protein S7 (chloroplast) [Iochroma stenanthum] ref|YP_009123201.1| ribosomal protein S7 (chloroplast) [Dunalia obovata] ref|YP_009123213.1| ribosomal protein S7 (chloroplast) [Dunalia obovata] ref|YP_009131757.1| ribosomal protein S7 (chloroplast) [Solanum cheesmaniae] ref|YP_009131771.1| ribosomal protein S7 (chloroplast) [Solanum cheesmaniae] ref|YP_009132006.1| ribosomal protein S7 (chloroplast) [Solanum habrochaites] ref|YP_009132020.1| ribosomal protein S7 (chloroplast) [Solanum habrochaites] ref|YP_009132089.1| ribosomal protein S7 (chloroplast) [Solanum neorickii] ref|YP_009132103.1| ribosomal protein S7 (chloroplast) [Solanum neorickii] ref|YP_009131840.1| ribosomal protein S7 (chloroplast) [Solanum chilense] ref|YP_009131854.1| ribosomal protein S7 (chloroplast) [Solanum chilense] ref|YP_009131923.1| ribosomal protein S7 (chloroplast) [Solanum galapagense] ref|YP_009131937.1| ribosomal protein S7 (chloroplast) [Solanum galapagense] ref|YP_009132172.1| ribosomal protein S7 (chloroplast) [Solanum peruvianum] ref|YP_009132186.1| ribosomal protein S7 (chloroplast) [Solanum peruvianum] ref|YP_009132255.1| ribosomal protein S7 (chloroplast) [Solanum pimpinellifolium] ref|YP_009132269.1| ribosomal protein S7 (chloroplast) [Solanum pimpinellifolium] ref|YP_009132797.1| ribosomal protein S7 (chloroplast) [Dunalia brachyacantha] ref|YP_009132810.1| ribosomal protein S7 (chloroplast) [Dunalia brachyacantha] ref|YP_009123571.1| ribosomal protein S7 (plastid) [Physalis peruviana] ref|YP_009123585.1| ribosomal protein S7 (plastid) [Physalis peruviana] ref|YP_009139511.1| ribosomal protein S7 (chloroplast) [Dunalia solanacea] ref|YP_009139525.1| ribosomal protein S7 (chloroplast) [Dunalia solanacea] ref|YP_009142371.1| ribosomal protein S7 (chloroplast) [Iochroma tingoanum] ref|YP_009142385.1| ribosomal protein S7 (chloroplast) [Iochroma tingoanum] ref|YP_009171827.1| ribosomal protein S7 (chloroplast) [Solanum commersonii] ref|YP_009171841.1| ribosomal protein S7 (chloroplast) [Solanum commersonii] ref|YP_009171913.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] ref|YP_009171927.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] ref|YP_009240644.1| ribosomal protein S7 (chloroplast) [Iochroma cardenasianum] ref|YP_009240657.1| ribosomal protein S7 (chloroplast) [Iochroma cardenasianum] ref|YP_009243261.1| ribosomal protein S7 (chloroplast) [Iochroma australe] ref|YP_009243275.1| ribosomal protein S7 (chloroplast) [Iochroma australe] ref|YP_009250910.1| ribosomal protein S7 (chloroplast) [Iochroma umbellatum] ref|YP_009250923.1| ribosomal protein S7 (chloroplast) [Iochroma umbellatum] ref|YP_009251282.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens x Iochroma cyaneum] ref|YP_009251295.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens x Iochroma cyaneum] ref|YP_009252720.1| ribosomal protein S7 (chloroplast) [Iochroma salpoanum] ref|YP_009252733.1| ribosomal protein S7 (chloroplast) [Iochroma salpoanum] ref|YP_009252894.1| ribosomal protein S7 (chloroplast) [Eriolarynx fasciculata] ref|YP_009252908.1| ribosomal protein S7 (chloroplast) [Eriolarynx fasciculata] ref|YP_009253117.1| ribosomal protein S7 (chloroplast) [Iochroma ellipticum] ref|YP_009253131.1| ribosomal protein S7 (chloroplast) [Iochroma ellipticum] ref|YP_009253201.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] ref|YP_009253214.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] ref|YP_009253433.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens] ref|YP_009253446.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens] ref|YP_009254122.1| ribosomal protein S7 (plastid) [Solanum melongena] ref|YP_009254136.1| ribosomal protein S7 (plastid) [Solanum melongena] ref|YP_009256080.1| ribosomal protein S7 (chloroplast) [Scopolia parviflora] ref|YP_009256093.1| ribosomal protein S7 (chloroplast) [Scopolia parviflora] ref|YP_009380344.1| ribosomal protein S7 (chloroplast) [Solanum berthaultii] ref|YP_009380358.1| ribosomal protein S7 (chloroplast) [Solanum berthaultii] ref|YP_009420704.1| ribosomal protein S7 (chloroplast) [Solanum dulcamara] ref|YP_009420718.1| ribosomal protein S7 (chloroplast) [Solanum dulcamara] ref|YP_009421404.1| ribosomal protein S7 (chloroplast) [Solanum pennellii] ref|YP_009421417.1| ribosomal protein S7 (chloroplast) [Solanum pennellii] ref|YP_009429495.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] ref|YP_009429508.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] ref|YP_009453938.1| ribosomal protein S7 (chloroplast) [Przewalskia tangutica] ref|YP_009453951.1| ribosomal protein S7 (chloroplast) [Przewalskia tangutica] ref|AP_004974.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] ref|AP_004988.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] sp|P62729.1|RR7_ATRBE RecName: Full=30S ribosomal protein S7, chloroplastic sp|P62731.1|RR7_SOLNI RecName: Full=30S ribosomal protein S7, chloroplastic sp|P62732.1|RR7_TOBAC RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q27RZ0.1|RR7_SOLTU RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q2MI54.1|RR7_SOLLC RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q2MIE1.1|RR7_SOLBU RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q33BY2.1|RR7_NICTO RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q3C1M8.1|RR7_NICSY RecName: Full=30S ribosomal protein S7, chloroplastic emb|CAA77390.1| ribosomal protein S7 (chloroplast) [Nicotiana tabacum] emb|CAA77403.1| ribosomal protein S7 (chloroplast) [Nicotiana tabacum] emb|CAB41472.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] emb|CAC88090.1| ribosomal protein S7 (chloroplast) [Atropa belladonna] emb|CAC88105.1| ribosomal protein S7 (chloroplast) [Atropa belladonna] dbj|BAE46704.1| ribosomal protein S7 (chloroplast) [Nicotiana sylvestris] dbj|BAE46727.1| ribosomal protein S7 (chloroplast) [Nicotiana sylvestris] dbj|BAE48053.1| ribosomal protein S7 (chloroplast) [Nicotiana tomentosiformis] dbj|BAE48076.1| ribosomal protein S7 (chloroplast) [Nicotiana tomentosiformis] gb|ABC56259.1| ribosomal protein S7 (chloroplast) [Solanum bulbocastanum] gb|ABC56274.1| ribosomal protein S7 (chloroplast) [Solanum bulbocastanum] gb|ABC56346.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ABC56361.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ABD47102.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|ABD47116.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] emb|CAJ32440.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] emb|CAJ32454.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|AEB72185.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AEB72198.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AEB72271.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AEB72284.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AEO95615.1| ribosomal protein S7 (chloroplast) [Nicotiana undulata] gb|AEO95636.1| ribosomal protein S7 (chloroplast) [Nicotiana undulata] gb|AEO95725.1| ribosomal protein S7 [synthetic construct] gb|AEO95744.1| ribosomal protein S7 [synthetic construct] gb|AEQ36997.1| ribosomal protein S7 (chloroplast) [Datura stramonium] gb|AEQ37069.1| ribosomal protein S7 (chloroplast) [Datura stramonium] gb|AEQ37084.1| ribosomal protein S7 (chloroplast) [Datura stramonium] gb|AGJ51294.1| ribosomal protein S7 (chloroplast) [Solanum carolinense] gb|AGU46515.1| ribosomal protein S7 (plastid) [Hyoscyamus niger] gb|AGU46529.1| ribosomal protein S7 (plastid) [Hyoscyamus niger] gb|AJL34453.1| ribosomal protein S7 (chloroplast) [Dunalia obovata] gb|AJL34464.1| ribosomal protein S7 (chloroplast) [Dunalia obovata] gb|AJN90352.1| ribosomal protein S7 (plastid) [Physalis peruviana] gb|AJN90366.1| ribosomal protein S7 (plastid) [Physalis peruviana] gb|AJN90550.1| ribosomal protein S7 (chloroplast) [Iochroma stenanthum] gb|AJN90563.1| ribosomal protein S7 (chloroplast) [Iochroma stenanthum] gb|AJO25157.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|AJO25169.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|AJO61626.1| ribosomal protein S7 (chloroplast) [Saracha punctata] gb|AJR30422.1| ribosomal protein S7 (chloroplast) [Vassobia breviflora] gb|AJR30437.1| ribosomal protein S7 (chloroplast) [Vassobia breviflora] gb|AJR32942.1| ribosomal protein S7 (chloroplast) [Dunalia spinosa] gb|AJR32955.1| ribosomal protein S7 (chloroplast) [Dunalia spinosa] gb|AJS14298.1| ribosomal protein S7 (chloroplast) [Iochroma loxense] gb|AJS14311.1| ribosomal protein S7 (chloroplast) [Iochroma loxense] gb|AJS14381.1| ribosomal protein S7 (chloroplast) [Iochroma calycinum] gb|AJS14394.1| ribosomal protein S7 (chloroplast) [Iochroma calycinum] gb|AJS14548.1| ribosomal protein S7 (plastid) [Iochroma australe] gb|AJS14562.1| ribosomal protein S7 (plastid) [Iochroma australe] gb|AJW75095.1| ribosomal protein S7 (chloroplast) [Vassobia dichotoma] gb|AJW75108.1| ribosomal protein S7 (chloroplast) [Vassobia dichotoma] gb|AJY78735.1| ribosomal protein S7 (chloroplast) [Solanum cheesmaniae] gb|AJY78749.1| ribosomal protein S7 (chloroplast) [Solanum cheesmaniae] gb|AJY78818.1| ribosomal protein S7 (chloroplast) [Solanum chilense] gb|AJY78832.1| ribosomal protein S7 (chloroplast) [Solanum chilense] gb|AJY78901.1| ribosomal protein S7 (chloroplast) [Solanum galapagense] gb|AJY78915.1| ribosomal protein S7 (chloroplast) [Solanum galapagense] gb|AJY78984.1| ribosomal protein S7 (chloroplast) [Solanum habrochaites] gb|AJY78998.1| ribosomal protein S7 (chloroplast) [Solanum habrochaites] gb|AJY79067.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|AJY79081.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|AJY79150.1| ribosomal protein S7 (chloroplast) [Solanum neorickii] gb|AJY79164.1| ribosomal protein S7 (chloroplast) [Solanum neorickii] gb|AJY79233.1| ribosomal protein S7 (chloroplast) [Solanum peruvianum] gb|AJY79247.1| ribosomal protein S7 (chloroplast) [Solanum peruvianum] gb|AJY79316.1| ribosomal protein S7 (chloroplast) [Solanum pimpinellifolium] gb|AJY79330.1| ribosomal protein S7 (chloroplast) [Solanum pimpinellifolium] gb|AKA66577.1| ribosomal protein S7 (chloroplast) [Dunalia brachyacantha] gb|AKA66590.1| ribosomal protein S7 (chloroplast) [Dunalia brachyacantha] gb|AKF78454.1| ribosomal protein S7 (chloroplast) [Dunalia solanacea] gb|AKF78468.1| ribosomal protein S7 (chloroplast) [Dunalia solanacea] gb|AKH02363.1| ribosomal protein S7 (chloroplast) [Iochroma tingoanum] gb|AKH02377.1| ribosomal protein S7 (chloroplast) [Iochroma tingoanum] gb|AKM21904.1| ribosomal protein S7 (chloroplast) [Solanum commersonii] gb|AKM21918.1| ribosomal protein S7 (chloroplast) [Solanum commersonii] gb|AKM21990.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] gb|AKM22004.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] gb|AKM22076.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AKM22090.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|AKZ24094.1| ribosomal protein S7 (plastid) [Physalis heterophylla] gb|AKZ24095.1| ribosomal protein S7 (plastid) [Physalis virginiana] gb|AKZ24096.1| ribosomal protein S7 (plastid) [Solanum carolinense] gb|AKZ24097.1| ribosomal protein S7 (plastid) [Solanum rostratum] gb|AKZ24098.1| ribosomal protein S7 (plastid) [Solanum triflorum] gb|ALI31186.1| ribosomal protein S7 (chloroplast) [Solanum nigrum] gb|AMM05593.1| ribosomal protein S7 (plastid) [Nicotiana tabacum] gb|AMM05610.1| ribosomal protein S7 (plastid) [Nicotiana tabacum] gb|AMP19621.1| ribosomal protein S7 (chloroplast) [Iochroma cardenasianum] gb|AMP19635.1| ribosomal protein S7 (chloroplast) [Iochroma cardenasianum] gb|AMR00434.1| ribosomal protein S7 (chloroplast) [Iochroma australe] gb|AMR00448.1| ribosomal protein S7 (chloroplast) [Iochroma australe] gb|AMV74104.1| ribosomal protein S7 (plastid) [Iochroma lehmannii] gb|AMV74117.1| ribosomal protein S7 (plastid) [Iochroma lehmannii] gb|AMX21637.1| ribosomal protein S7 (chloroplast) [Iochroma grandiflorum] gb|AMX21649.1| ribosomal protein S7 (chloroplast) [Iochroma grandiflorum] gb|AMX21729.1| ribosomal protein S7 (chloroplast) [Iochroma parvifolium] gb|AMX21741.1| ribosomal protein S7 (chloroplast) [Iochroma parvifolium] gb|AMX23201.1| ribosomal protein S7 (chloroplast) [Solanum melongena] gb|AMY95803.1| ribosomal protein S7 (chloroplast) [Iochroma umbellatum] gb|AMY95817.1| ribosomal protein S7 (chloroplast) [Iochroma umbellatum] gb|ANA07603.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens x Iochroma cyaneum] gb|ANA07616.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens x Iochroma cyaneum] gb|ANA56846.1| ribosomal protein S7 (chloroplast) [Iochroma salpoanum] gb|ANA56859.1| ribosomal protein S7 (chloroplast) [Iochroma salpoanum] gb|ANA91110.1| ribosomal protein S7 (chloroplast) [Eriolarynx fasciculata] gb|ANA91125.1| ribosomal protein S7 (chloroplast) [Eriolarynx fasciculata] gb|ANB44527.1| ribosomal protein S7 (chloroplast) [Iochroma ellipticum] gb|ANB44541.1| ribosomal protein S7 (chloroplast) [Iochroma ellipticum] gb|ANB44610.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] gb|ANB44624.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] gb|ANC49217.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens] gb|ANC49229.1| ribosomal protein S7 (chloroplast) [Acnistus arborescens] gb|ANC62808.1| ribosomal protein S7 (plastid) [Solanum melongena] gb|ANC62822.1| ribosomal protein S7 (plastid) [Solanum melongena] gb|ANC95103.1| ribosomal protein S7 (chloroplast) [Dunalia spathulata] gb|ANC95117.1| ribosomal protein S7 (chloroplast) [Dunalia spathulata] gb|ANC95279.1| ribosomal protein S7 (plastid) [Iochroma gesnerioides] gb|ANC95291.1| ribosomal protein S7 (plastid) [Iochroma gesnerioides] gb|ANC95411.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] gb|ANC95424.1| ribosomal protein S7 (chloroplast) [Iochroma cyaneum] gb|ANC96423.1| ribosomal protein S7 (chloroplast) [Iochroma albianthum] gb|ANC96437.1| ribosomal protein S7 (chloroplast) [Iochroma albianthum] gb|ANE20325.1| ribosomal protein S7 (plastid) [Iochroma confertiflorum] gb|ANE20338.1| ribosomal protein S7 (plastid) [Iochroma confertiflorum] gb|ANF05258.1| ribosomal protein S7 (chloroplast) [Scopolia parviflora] gb|ANF05271.1| ribosomal protein S7 (chloroplast) [Scopolia parviflora] gb|ARS01147.1| ribosomal protein S7 (chloroplast) [Solanum berthaultii] gb|ARS01161.1| ribosomal protein S7 (chloroplast) [Solanum berthaultii] gb|ASO76640.1| ribosomal protein S7 (chloroplast) [Solanum dulcamara] gb|ASO76641.1| ribosomal protein S7 (chloroplast) [Solanum dulcamara] gb|ASR92467.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ASR92479.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ASR92554.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ASR92567.1| ribosomal protein S7 (chloroplast) [Solanum lycopersicum] gb|ASR92641.1| ribosomal protein S7 (chloroplast) [Solanum pennellii] gb|ASR92654.1| ribosomal protein S7 (chloroplast) [Solanum pennellii] gb|ASW34623.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] gb|ASW34637.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] gb|ATI96706.1| ribosomal protein S7 (chloroplast) [Przewalskia tangutica] gb|ATI96719.1| ribosomal protein S7 (chloroplast) [Przewalskia tangutica] gb|ATL23016.1| ribosomal protein S7 (chloroplast) [Solanum chacoense] gb|ATL23030.1| ribosomal protein S7 (chloroplast) [Solanum chacoense] gb|ATL23103.1| ribosomal protein S7 (chloroplast) [Solanum hougasii] gb|ATL23117.1| ribosomal protein S7 (chloroplast) [Solanum hougasii] gb|ATL23190.1| ribosomal protein S7 (chloroplast) [Solanum stoloniferum] gb|ATL23204.1| ribosomal protein S7 (chloroplast) [Solanum stoloniferum] gb|PHT74391.1| 30S ribosomal protein S7, chloroplastic [Capsicum annuum] gb|PHT74397.1| 30S ribosomal protein S7, chloroplastic [Capsicum annuum] gb|PHT92790.1| 30S ribosomal protein S7, chloroplastic [Capsicum annuum] gb|AUJ22450.1| ribosomal protein S7 (chloroplast) [Solanum melongena] gb|AUJ22451.1| ribosomal protein S7 (chloroplast) [Solanum melongena] gb|AUJ22782.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] gb|AUJ22783.1| ribosomal protein S7 (chloroplast) [Nicotiana attenuata] prf||1211235CF ribosomal protein S7 Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_009306516.1| 30S ribosomal protein S7 (chloroplast) [Helwingia himalaica] ref|YP_009306535.1| 30S ribosomal protein S7 (chloroplast) [Helwingia himalaica] gb|AOP19433.1| 30S ribosomal protein S7 (chloroplast) [Helwingia himalaica] gb|AOP19452.1| 30S ribosomal protein S7 (chloroplast) [Helwingia himalaica] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_009245718.1| ribosomal protein S7 (chloroplast) [Carum carvi] ref|YP_009245728.1| ribosomal protein S7 (chloroplast) [Carum carvi] gb|AKS28733.1| ribosomal protein S7 (chloroplast) [Carum carvi] gb|AKS28744.1| ribosomal protein S7 (chloroplast) [Carum carvi] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] ref|YP_087025.1| ribosomal protein S7 [Panax ginseng] ref|YP_740163.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_740176.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_004222692.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004222705.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004733889.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004733902.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004935599.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_004935612.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_008815077.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815090.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815164.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008815177.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008814903.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008814916.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008815251.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_008815264.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_009121220.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009121233.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009122772.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009122785.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009155258.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155271.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155473.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009155487.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009159584.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009159598.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009161726.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009161739.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009186298.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009186313.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009191899.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191913.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191986.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009192000.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009232790.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232806.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232875.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232891.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232960.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009232976.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009233044.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009233060.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009235925.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009235939.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009236010.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009236023.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009240841.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009240854.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009241112.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009241098.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009266564.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009266578.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009306821.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009306834.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009330735.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009330748.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009331749.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338302.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338315.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338386.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338400.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338469.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009338482.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009363624.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363640.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363723.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363739.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363539.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009363555.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009367049.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009367062.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009379660.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379674.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379572.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009379586.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009387618.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387605.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387690.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387703.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387775.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387788.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387860.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009387873.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009434292.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] ref|YP_009434305.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] sp|Q68RU7.1|RR7_PANGI RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q0G9Q3.1|RR7_DAUCA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAT98555.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AAT98570.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|ABI32469.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABI32484.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABU85171.1| ribosomal protein S7, partial (chloroplast) [Anethum graveolens] gb|ADD13684.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD13698.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD29890.1| ribosomal protein S7 (chloroplast) [Aucuba japonica] gb|ADK89824.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89838.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89997.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADK90011.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADM92747.1| ribosomal protein S7, partial (chloroplast) [Davidia involucrata] gb|AEK71711.1| ribosomal protein S7 (plastid) [Aucuba japonica] gb|AEO92665.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AEO92678.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AGG39002.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39017.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39176.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39191.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39263.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39278.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39350.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGG39365.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGM15028.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15029.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15114.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15115.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15200.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15201.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31960.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31961.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AHJ81010.1| ribosomal protein S7 (mitochondrion) [Panax ginseng] gb|AIA24374.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIA24387.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIU99067.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIU99080.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIX97934.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX97948.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98019.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98033.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98104.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98118.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98189.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98203.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98274.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98288.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98359.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98373.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98444.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98458.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98529.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98543.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98615.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98629.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99533.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99547.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99618.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99632.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99703.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99717.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJK29888.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJK29889.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJO25247.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AJO25248.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AKB99118.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99132.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99205.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99219.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99292.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99306.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99379.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99393.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKG26647.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKG26660.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKQ20774.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKQ20788.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKS11000.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKS11014.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKU70823.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKU70837.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKZ24089.1| ribosomal protein S7 (plastid) [Cicuta maculata] gb|AKZ24090.1| ribosomal protein S7 (plastid) [Conium maculatum] gb|AKZ24091.1| ribosomal protein S7 (plastid) [Zizia aurea] gb|AKZ29807.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|ALN96875.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALN96876.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALO71652.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|ALO71653.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|AMA97862.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97863.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97948.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA97949.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA98033.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98034.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98120.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMA98121.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMD83961.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD83976.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD84046.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMD84060.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMK46209.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMK46222.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMR97494.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AMR97508.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|KZM81269.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|KZM81282.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|ANK36397.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36410.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36481.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36495.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36564.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36577.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK78376.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78390.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78462.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANK78476.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANS71815.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71829.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71902.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71916.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71989.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72003.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72075.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72091.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72158.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|ANS72174.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOC32763.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOC32764.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOQ76964.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOQ76966.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOT84427.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84443.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84512.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84528.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84611.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84627.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84710.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|AOT84726.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|APB93649.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93662.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93734.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93747.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93819.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93832.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93904.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93917.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93989.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94002.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94074.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94087.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94159.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94172.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94244.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94257.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94329.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94342.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94414.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94427.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94499.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94512.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94584.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94597.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94669.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94682.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94754.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94767.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94839.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94852.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94924.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB94937.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95009.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95022.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95094.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95107.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95179.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95192.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95264.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95277.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95349.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95362.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95434.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95447.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95519.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95532.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95604.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95617.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95689.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95702.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95774.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95787.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95859.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95872.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95944.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95957.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB96029.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96042.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96114.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96127.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96199.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96212.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96283.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96296.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96368.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96381.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96453.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96466.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96538.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96551.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96623.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96636.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96708.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APB96721.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APD79337.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APD79350.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APH07318.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] gb|AQU64682.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64683.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64769.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64770.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64854.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AQU64855.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|ARJ61717.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARJ61718.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARQ81805.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81819.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81893.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81907.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ART32505.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32506.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32590.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32591.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32675.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32676.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32760.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ART32761.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ARX79284.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ARX79297.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATI20909.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATI20923.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26070.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26071.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26174.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26188.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26242.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26243.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26327.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATJ26328.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATL63061.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATL63077.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATN40524.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATN40525.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF33230.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33231.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33400.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33401.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33570.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33571.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33654.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33655.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33909.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33910.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33995.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF33996.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF34079.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34080.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34165.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34166.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34249.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34250.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34420.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF34421.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AVK80245.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] gb|AVK80246.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_004733386.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_009255653.1| ribosomal protein S7 (chloroplast) [Cornus controversa] ref|YP_009255666.1| ribosomal protein S7 (chloroplast) [Cornus controversa] sp|Q6EMA2.1|RR7_CORMA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64539.1| ribosomal protein S7 (chloroplast) [Cornus mas] gb|ADD29903.1| ribosomal protein S7 (chloroplast) [Cornus florida] gb|ADK89909.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|ADK89923.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|AEK71692.1| ribosomal protein S7 (plastid) [Cornus florida] gb|AND96927.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AND96928.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF33144.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33145.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33824.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33825.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF34334.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF34335.1| ribosomal protein S7 (chloroplast) [Cornus controversa] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|ABB90084.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] gb|ABB90096.1| ribosomal protein S7 (chloroplast) [Solanum tuberosum] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|AKZ24112.1| ribosomal protein S7 (plastid) [Impatiens capensis] gb|AVI69829.1| ribosomal protein S7 (chloroplast) [Hydrocera triflora] gb|AVI69845.1| ribosomal protein S7 (chloroplast) [Hydrocera triflora] gb|AVI69918.1| ribosomal protein S7 (chloroplast) [Impatiens piufanensis] gb|AVI69934.1| ribosomal protein S7 (chloroplast) [Impatiens piufanensis] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_009155340.1| ribosomal protein S7 (plastid) [Seseli montanum] ref|YP_009155353.1| ribosomal protein S7 (plastid) [Seseli montanum] gb|AIU99149.1| ribosomal protein S7 (plastid) [Seseli montanum] gb|AIU99162.1| ribosomal protein S7 (plastid) [Seseli montanum] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|AHW52243.1| ribosomal protein S7 (chloroplast) [Rhazya stricta] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_009108805.1| ribosomal protein S7 [Oncinotis tenuiloba] ref|YP_009108818.1| ribosomal protein S7 [Oncinotis tenuiloba] ref|YP_009108635.1| ribosomal protein S7 [Echites umbellatus] ref|YP_009108648.1| ribosomal protein S7 [Echites umbellatus] ref|YP_009108889.1| ribosomal protein S7 [Pentalinon luteum] ref|YP_009108902.1| ribosomal protein S7 [Pentalinon luteum] ref|YP_009108720.1| ribosomal protein S7 [Nerium oleander] ref|YP_009108733.1| ribosomal protein S7 [Nerium oleander] gb|ADD29897.1| ribosomal protein S7 (chloroplast) [Nerium oleander] gb|AEK71767.1| ribosomal protein S7 (plastid) [Nerium oleander] gb|AGW04331.1| ribosomal protein S7 (plastid) [Secamone afzelii] gb|AGW04634.1| ribosomal protein S7 (plastid) [Marsdenia astephanoides] gb|AGW04865.1| ribosomal protein S7 (plastid) [Sisyranthus trichostomus] gb|AGW04942.1| ribosomal protein S7 (plastid) [Telosma cordata] gb|AIE08746.1| ribosomal protein S7 (plastid) [Secamone afzelii] gb|AIW05310.1| ribosomal protein S7 (plastid) [Echites umbellatus] gb|AIW05323.1| ribosomal protein S7 (plastid) [Echites umbellatus] gb|AIW05479.1| ribosomal protein S7 (plastid) [Neobracea bahamensis] gb|AIW05492.1| ribosomal protein S7 (plastid) [Neobracea bahamensis] gb|AIW05564.1| ribosomal protein S7 (plastid) [Nerium oleander] gb|AIW05577.1| ribosomal protein S7 (plastid) [Nerium oleander] gb|AIW05649.1| ribosomal protein S7 (plastid) [Oncinotis tenuiloba] gb|AIW05662.1| ribosomal protein S7 (plastid) [Oncinotis tenuiloba] gb|AIW05733.1| ribosomal protein S7 (plastid) [Pentalinon luteum] gb|AIW05746.1| ribosomal protein S7 (plastid) [Pentalinon luteum] gb|AIW05818.1| ribosomal protein S7 (plastid) [Periploca sepium] gb|AIW05831.1| ribosomal protein S7 (plastid) [Periploca sepium] gb|AIW05903.1| ribosomal protein S7 (plastid) [Rhabdadenia biflora] gb|AIW05916.1| ribosomal protein S7 (plastid) [Rhabdadenia biflora] gb|AIW05988.1| ribosomal protein S7 (plastid) [Wrightia natalensis] gb|AIW06001.1| ribosomal protein S7 (plastid) [Wrightia natalensis] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta] gb|AEK71617.1| ribosomal protein S7 (plastid) [Ilex cornuta] gb|AJW59668.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|AJW59681.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|ANS80773.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80794.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80868.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80889.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80963.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS80984.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS81058.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81079.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81153.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81174.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81248.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81269.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81343.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] gb|ANS81364.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|ADD29892.1| ribosomal protein S7 (chloroplast) [Ehretia acuminata] gb|AEK71603.1| ribosomal protein S7 (plastid) [Ehretia acuminata] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >ref|YP_008814990.1| ribosomal protein S7 (chloroplast) [Brassaiopsis hainla] ref|YP_008815003.1| ribosomal protein S7 (chloroplast) [Brassaiopsis hainla] gb|AGG39089.1| ribosomal protein S7 (chloroplast) [Brassaiopsis hainla] gb|AGG39104.1| ribosomal protein S7 (chloroplast) [Brassaiopsis hainla] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155 >gb|AGW04711.1| ribosomal protein S7 (plastid) [Matelea biflora] Length = 155 Score = 128 bits (321), Expect = 1e-33 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = +1 Query: 4 IGSTQGKTLAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 183 IGSTQGK LAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA Sbjct: 91 IGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRA 150 Query: 184 FAHFR 198 FAHFR Sbjct: 151 FAHFR 155