BLASTX nr result
ID: Acanthopanax21_contig00000277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00000277 (2230 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022932068.1| uncharacterized protein LOC111438394 [Cucurb... 254 2e-77 gb|PPD74055.1| hypothetical protein GOBAR_DD29018 [Gossypium bar... 245 7e-74 ref|NP_001238194.1| ribosomal protein S7 [Glycine max] >gi|25562... 241 6e-72 gb|ERM95251.1| hypothetical protein AMTR_s02071p00004290 [Ambore... 239 1e-71 gb|PPD74578.1| hypothetical protein GOBAR_DD28493 [Gossypium bar... 238 2e-71 gb|KCW72264.1| hypothetical protein EUGRSUZ_E00717 [Eucalyptus g... 238 4e-71 ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] >gi|522208... 236 4e-70 ref|YP_009379485.1| ribosomal protein S7 (chloroplast) [Hydrange... 236 4e-70 ref|YP_009164362.1| ribosomal protein S7 (chloroplast) [Bupleuru... 236 4e-70 gb|AEX94156.1| ribosomal protein S7 (chloroplast) [Haworthia cym... 236 4e-70 gb|AJW59560.1| ribosomal protein S7 (chloroplast) [Ilex dumosa] ... 235 5e-70 gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta]... 235 5e-70 gb|AEK71887.1| ribosomal protein S7, partial (plastid) [Pinzona ... 234 6e-70 gb|AEK78139.1| ribosomal protein S7, partial (plastid) [Austroba... 234 7e-70 ref|YP_009409282.1| ribosomal protein S7 (chloroplast) [Aloe mac... 235 8e-70 ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum... 235 8e-70 gb|ACV71759.1| ribosomal protein S7, partial (chloroplast) [Eccr... 234 8e-70 gb|ABQ14870.1| ribosomal protein S7, partial (chloroplast) [Liqu... 234 9e-70 ref|YP_003359404.1| ribosomal protein S7 (chloroplast) [Olea eur... 234 1e-69 ref|YP_008964092.1| ribosomal protein S7 [Ajuga reptans] >gi|123... 234 1e-69 >ref|XP_022932068.1| uncharacterized protein LOC111438394 [Cucurbita moschata] ref|XP_023520570.1| uncharacterized protein LOC111783982 [Cucurbita pepo subsp. pepo] ref|XP_023520572.1| uncharacterized protein LOC111783984 [Cucurbita pepo subsp. pepo] Length = 143 Score = 254 bits (650), Expect = 2e-77 Identities = 129/140 (92%), Positives = 134/140 (95%) Frame = -1 Query: 1033 HENVTKLVLVTLRDGVEKGRGFSNAEKDPMTSKELNEEPYEVKISCTFL*SGSKGDLSVN 854 +ENVT+LV VTLRDG+E+GR FSN EKDPMTSKELNEEPYEVKISCT L SGSKGDLSVN Sbjct: 2 NENVTELVPVTLRDGMEEGRRFSNEEKDPMTSKELNEEPYEVKISCTVLSSGSKGDLSVN 61 Query: 853 FSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYH 674 FSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYH Sbjct: 62 FSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYH 121 Query: 673 IVRGTLDAVGVKDRQQGRST 614 IVRGTLDAVGVKDRQQGRS+ Sbjct: 122 IVRGTLDAVGVKDRQQGRSS 141 >gb|PPD74055.1| hypothetical protein GOBAR_DD29018 [Gossypium barbadense] Length = 140 Score = 245 bits (625), Expect = 7e-74 Identities = 127/143 (88%), Positives = 130/143 (90%) Frame = -1 Query: 1042 QLEHENVTKLVLVTLRDGVEKGRGFSNAEKDPMTSKELNEEPYEVKISCTFL*SGSKGDL 863 QLEHENVT+ VLVTLRD VE+GR FSN EKDPMTSKELNEEPYE SGSKGDL Sbjct: 5 QLEHENVTEFVLVTLRDRVEEGRRFSNEEKDPMTSKELNEEPYE---------SGSKGDL 55 Query: 862 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 683 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV Sbjct: 56 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 115 Query: 682 RYHIVRGTLDAVGVKDRQQGRST 614 RYHIVRGTLDAVGVKDRQQGRS+ Sbjct: 116 RYHIVRGTLDAVGVKDRQQGRSS 138 >ref|NP_001238194.1| ribosomal protein S7 [Glycine max] gb|ACU14175.1| unknown [Glycine max] Length = 173 Score = 241 bits (615), Expect = 6e-72 Identities = 122/126 (96%), Positives = 124/126 (98%) Frame = -1 Query: 547 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTET 368 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTET Sbjct: 15 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTET 74 Query: 367 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNM 188 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVP+EIGSTQGK LAIRWLL ASRKRPGRNM Sbjct: 75 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNM 134 Query: 187 AFKLSS 170 AFKLSS Sbjct: 135 AFKLSS 140 >gb|ERM95251.1| hypothetical protein AMTR_s02071p00004290 [Amborella trichopoda] Length = 140 Score = 239 bits (610), Expect = 1e-71 Identities = 124/143 (86%), Positives = 129/143 (90%) Frame = -1 Query: 1042 QLEHENVTKLVLVTLRDGVEKGRGFSNAEKDPMTSKELNEEPYEVKISCTFL*SGSKGDL 863 QLEHEN T+LVLVT RDGVE+GR FS+ EKDP+TSKELNEEPYE S SKGDL Sbjct: 5 QLEHENATELVLVTPRDGVEEGRRFSSEEKDPITSKELNEEPYE---------SDSKGDL 55 Query: 862 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 683 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV Sbjct: 56 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 115 Query: 682 RYHIVRGTLDAVGVKDRQQGRST 614 RYHIVRGTLDAVGVKDRQQGRS+ Sbjct: 116 RYHIVRGTLDAVGVKDRQQGRSS 138 >gb|PPD74578.1| hypothetical protein GOBAR_DD28493 [Gossypium barbadense] Length = 140 Score = 238 bits (608), Expect = 2e-71 Identities = 123/143 (86%), Positives = 128/143 (89%) Frame = -1 Query: 1042 QLEHENVTKLVLVTLRDGVEKGRGFSNAEKDPMTSKELNEEPYEVKISCTFL*SGSKGDL 863 QLEHEN+T ++ TLRD VE+GR FSN EKDPMTSKELNEEPYE SGSKGDL Sbjct: 5 QLEHENMTDNIMPTLRDRVEEGRRFSNEEKDPMTSKELNEEPYE---------SGSKGDL 55 Query: 862 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 683 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV Sbjct: 56 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 115 Query: 682 RYHIVRGTLDAVGVKDRQQGRST 614 RYHIVRGTLDAVGVKDRQQGRS+ Sbjct: 116 RYHIVRGTLDAVGVKDRQQGRSS 138 >gb|KCW72264.1| hypothetical protein EUGRSUZ_E00717 [Eucalyptus grandis] Length = 135 Score = 238 bits (606), Expect = 4e-71 Identities = 124/143 (86%), Positives = 127/143 (88%) Frame = -1 Query: 1042 QLEHENVTKLVLVTLRDGVEKGRGFSNAEKDPMTSKELNEEPYEVKISCTFL*SGSKGDL 863 QLEHENVT+LVLVTLRDGVE+GR FSN EKDPMTSKELNEEP KGDL Sbjct: 5 QLEHENVTELVLVTLRDGVEEGRRFSNEEKDPMTSKELNEEP--------------KGDL 50 Query: 862 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 683 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV Sbjct: 51 SVNFSTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGV 110 Query: 682 RYHIVRGTLDAVGVKDRQQGRST 614 RYHIVRGTLDAVGVKDRQQGRS+ Sbjct: 111 RYHIVRGTLDAVGVKDRQQGRSS 133 >ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] ref|YP_087025.1| ribosomal protein S7 [Panax ginseng] ref|YP_740163.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_740176.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_004222692.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004222705.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004733889.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004733902.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004935599.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_004935612.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_008815077.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815090.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815164.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008815177.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008814903.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008814916.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008815251.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_008815264.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_009121220.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009121233.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009122772.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009122785.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009155258.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155271.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155473.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009155487.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009159584.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009159598.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009161726.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009161739.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009186298.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009186313.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009191899.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191913.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191986.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009192000.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009232790.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232806.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232875.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232891.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232960.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009232976.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009233044.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009233060.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009235925.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009235939.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009236010.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009236023.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009240841.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009240854.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009241112.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009241098.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009266564.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009266578.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009306821.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009306834.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009330735.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009330748.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009331749.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338302.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338315.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338386.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338400.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338469.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009338482.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009363624.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363640.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363723.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363739.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363539.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009363555.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009367049.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009367062.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009379660.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379674.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379572.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009379586.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009387618.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387605.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387690.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387703.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387775.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387788.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387860.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009387873.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009434292.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] ref|YP_009434305.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] sp|Q68RU7.1|RR7_PANGI RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q0G9Q3.1|RR7_DAUCA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAT98555.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AAT98570.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|ABI32469.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABI32484.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABU85171.1| ribosomal protein S7, partial (chloroplast) [Anethum graveolens] gb|ADD13684.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD13698.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD29890.1| ribosomal protein S7 (chloroplast) [Aucuba japonica] gb|ADK89824.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89838.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89997.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADK90011.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADM92747.1| ribosomal protein S7, partial (chloroplast) [Davidia involucrata] gb|AEK71711.1| ribosomal protein S7 (plastid) [Aucuba japonica] gb|AEO92665.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AEO92678.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AGG39002.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39017.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39176.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39191.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39263.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39278.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39350.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGG39365.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGM15028.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15029.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15114.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15115.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15200.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15201.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31960.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31961.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AHJ81010.1| ribosomal protein S7 (mitochondrion) [Panax ginseng] gb|AIA24374.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIA24387.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIU99067.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIU99080.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIX97934.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX97948.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98019.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98033.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98104.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98118.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98189.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98203.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98274.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98288.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98359.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98373.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98444.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98458.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98529.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98543.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98615.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98629.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99533.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99547.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99618.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99632.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99703.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99717.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJK29888.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJK29889.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJO25247.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AJO25248.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AKB99118.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99132.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99205.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99219.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99292.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99306.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99379.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99393.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKG26647.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKG26660.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKQ20774.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKQ20788.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKS11000.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKS11014.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKU70823.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKU70837.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKZ24089.1| ribosomal protein S7 (plastid) [Cicuta maculata] gb|AKZ24090.1| ribosomal protein S7 (plastid) [Conium maculatum] gb|AKZ24091.1| ribosomal protein S7 (plastid) [Zizia aurea] gb|AKZ29807.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|ALN96875.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALN96876.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALO71652.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|ALO71653.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|AMA97862.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97863.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97948.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA97949.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA98033.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98034.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98120.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMA98121.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMD83961.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD83976.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD84046.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMD84060.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMK46209.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMK46222.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMR97494.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AMR97508.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|KZM81269.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|KZM81282.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|ANK36397.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36410.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36481.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36495.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36564.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36577.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK78376.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78390.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78462.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANK78476.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANS71815.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71829.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71902.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71916.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71989.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72003.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72075.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72091.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72158.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|ANS72174.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOC32763.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOC32764.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOQ76964.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOQ76966.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOT84427.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84443.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84512.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84528.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84611.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84627.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84710.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|AOT84726.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|APB93649.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93662.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93734.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93747.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93819.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93832.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93904.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93917.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93989.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94002.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94074.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94087.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94159.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94172.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94244.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94257.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94329.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94342.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94414.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94427.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94499.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94512.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94584.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94597.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94669.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94682.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94754.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94767.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94839.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94852.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94924.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB94937.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95009.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95022.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95094.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95107.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95179.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95192.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95264.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95277.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95349.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95362.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95434.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95447.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95519.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95532.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95604.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95617.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95689.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95702.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95774.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95787.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95859.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95872.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95944.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95957.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB96029.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96042.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96114.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96127.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96199.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96212.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96283.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96296.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96368.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96381.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96453.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96466.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96538.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96551.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96623.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96636.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96708.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APB96721.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APD79337.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APD79350.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APH07318.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] gb|AQU64682.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64683.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64769.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64770.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64854.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AQU64855.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|ARJ61717.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARJ61718.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARQ81805.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81819.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81893.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81907.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ART32505.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32506.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32590.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32591.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32675.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32676.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32760.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ART32761.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ARX79284.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ARX79297.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATI20909.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATI20923.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26070.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26071.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26174.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26188.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26242.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26243.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26327.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATJ26328.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATL63061.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATL63077.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATN40524.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATN40525.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF33230.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33231.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33400.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33401.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33570.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33571.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33654.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33655.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33909.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33910.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33995.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF33996.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF34079.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34080.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34165.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34166.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34249.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34250.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34420.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF34421.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AVK80245.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] gb|AVK80246.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] Length = 155 Score = 236 bits (601), Expect = 4e-70 Identities = 121/122 (99%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_009379485.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] ref|YP_009379499.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] ref|YP_009417005.1| 30S ribosomal protein S7 (chloroplast) [Hydrangea luteovenosa] ref|YP_009416989.1| 30S ribosomal protein S7 (chloroplast) [Hydrangea luteovenosa] sp|Q6EM87.1|RR7_HYDMC RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64554.1| ribosomal protein S7 (chloroplast) [Hydrangea macrophylla] gb|ANN38977.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] gb|ANN38992.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] gb|ARQ81459.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81474.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81546.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81560.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81632.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81646.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81717.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81732.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81979.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|ARQ81994.1| ribosomal protein S7 (chloroplast) [Hydrangea serrata] gb|AST10032.1| 30S ribosomal protein S7 (chloroplast) [Hydrangea luteovenosa] gb|AST10033.1| 30S ribosomal protein S7 (chloroplast) [Hydrangea luteovenosa] gb|AUF33315.1| ribosomal protein S7 (chloroplast) [Hydrangea aspera] gb|AUF33316.1| ribosomal protein S7 (chloroplast) [Hydrangea aspera] Length = 155 Score = 236 bits (601), Expect = 4e-70 Identities = 121/122 (99%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_009164362.1| ribosomal protein S7 (chloroplast) [Bupleurum falcatum] ref|YP_009164376.1| ribosomal protein S7 (chloroplast) [Bupleurum falcatum] ref|YP_009338552.1| ribosomal protein S7 (chloroplast) [Bupleurum latissimum] ref|YP_009338565.1| ribosomal protein S7 (chloroplast) [Bupleurum latissimum] ref|YP_009433465.1| ribosomal protein S7 (chloroplast) [Bupleurum boissieuanum] ref|YP_009433479.1| ribosomal protein S7 (chloroplast) [Bupleurum boissieuanum] gb|AIY72348.1| ribosomal protein S7 (chloroplast) [Bupleurum falcatum] gb|AIY72362.1| ribosomal protein S7 (chloroplast) [Bupleurum falcatum] gb|ANK36647.1| ribosomal protein S7 (chloroplast) [Bupleurum latissimum] gb|ANK36660.1| ribosomal protein S7 (chloroplast) [Bupleurum latissimum] gb|ATD85331.1| ribosomal protein S7 (chloroplast) [Bupleurum boissieuanum] gb|ATD85332.1| ribosomal protein S7 (chloroplast) [Bupleurum boissieuanum] Length = 155 Score = 236 bits (601), Expect = 4e-70 Identities = 121/122 (99%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|AEX94156.1| ribosomal protein S7 (chloroplast) [Haworthia cymbiformis] Length = 155 Score = 236 bits (601), Expect = 4e-70 Identities = 121/122 (99%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|AJW59560.1| ribosomal protein S7 (chloroplast) [Ilex dumosa] gb|AJW59590.1| ribosomal protein S7 (chloroplast) [Ilex dumosa] Length = 155 Score = 235 bits (600), Expect = 5e-70 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIVYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta] gb|AEK71617.1| ribosomal protein S7 (plastid) [Ilex cornuta] gb|AJW59668.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|AJW59681.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|ANS80773.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80794.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80868.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80889.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80963.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS80984.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS81058.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81079.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81153.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81174.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81248.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81269.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81343.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] gb|ANS81364.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] Length = 155 Score = 235 bits (600), Expect = 5e-70 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIVYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|AEK71887.1| ribosomal protein S7, partial (plastid) [Pinzona coriacea] Length = 130 Score = 234 bits (597), Expect = 6e-70 Identities = 120/122 (98%), Positives = 120/122 (98%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLL ASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|AEK78139.1| ribosomal protein S7, partial (plastid) [Austrobaileya scandens] Length = 134 Score = 234 bits (597), Expect = 7e-70 Identities = 120/122 (98%), Positives = 120/122 (98%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLL ASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_009409282.1| ribosomal protein S7 (chloroplast) [Aloe maculata] ref|YP_009409295.1| ribosomal protein S7 (chloroplast) [Aloe maculata] gb|APP88735.1| ribosomal protein S7 (chloroplast) [Aloe maculata] gb|APP88748.1| ribosomal protein S7 (chloroplast) [Aloe maculata] Length = 155 Score = 235 bits (599), Expect = 8e-70 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_004733386.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_009255653.1| ribosomal protein S7 (chloroplast) [Cornus controversa] ref|YP_009255666.1| ribosomal protein S7 (chloroplast) [Cornus controversa] sp|Q6EMA2.1|RR7_CORMA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64539.1| ribosomal protein S7 (chloroplast) [Cornus mas] gb|ADD29903.1| ribosomal protein S7 (chloroplast) [Cornus florida] gb|ADK89909.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|ADK89923.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|AEK71692.1| ribosomal protein S7 (plastid) [Cornus florida] gb|AND96927.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AND96928.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF33144.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33145.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33824.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33825.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF34334.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF34335.1| ribosomal protein S7 (chloroplast) [Cornus controversa] Length = 155 Score = 235 bits (599), Expect = 8e-70 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|ACV71759.1| ribosomal protein S7, partial (chloroplast) [Eccremis coarctata] Length = 137 Score = 234 bits (597), Expect = 8e-70 Identities = 120/122 (98%), Positives = 120/122 (98%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLL ASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >gb|ABQ14870.1| ribosomal protein S7, partial (chloroplast) [Liquidambar styraciflua] Length = 140 Score = 234 bits (597), Expect = 9e-70 Identities = 120/122 (98%), Positives = 120/122 (98%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLL ASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_003359404.1| ribosomal protein S7 (chloroplast) [Olea europaea] ref|YP_003359418.1| ribosomal protein S7 (chloroplast) [Olea europaea] ref|YP_004376466.1| ribosomal protein S7 [Olea europaea subsp. europaea] ref|YP_004376480.1| ribosomal protein S7 [Olea europaea subsp. europaea] ref|YP_004563826.1| ribosomal protein S7 [Olea europaea subsp. cuspidata] ref|YP_004563840.1| ribosomal protein S7 [Olea europaea subsp. cuspidata] ref|YP_004564049.1| ribosomal protein S7 [Olea woodiana subsp. woodiana] ref|YP_004564063.1| ribosomal protein S7 [Olea woodiana subsp. woodiana] ref|YP_004564542.1| ribosomal protein S7 [Olea europaea subsp. maroccana] ref|YP_004564556.1| ribosomal protein S7 [Olea europaea subsp. maroccana] ref|YP_004935713.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] ref|YP_004935726.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] ref|YP_004940555.1| rps7 gene product (chloroplast) [Dorcoceras hygrometricum] ref|YP_004940569.1| rps7 gene product (chloroplast) [Dorcoceras hygrometricum] ref|YP_005090419.1| rps7 gene product (mitochondrion) [Dorcoceras hygrometricum] ref|YP_007353961.1| ribosomal protein S7 (chloroplast) [Tectona grandis] ref|YP_007353974.1| ribosomal protein S7 (chloroplast) [Tectona grandis] ref|YP_007507158.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] ref|YP_007507171.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] ref|YP_008815983.1| ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] ref|YP_008815996.1| ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] ref|YP_008992307.1| ribosomal protein S7 (mitochondrion) [Salvia miltiorrhiza] ref|YP_009002300.1| ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] ref|YP_009002304.1| ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] ref|YP_009110647.1| ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] ref|YP_009110661.1| ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] ref|YP_009115942.1| ribosomal protein S7 [Scrophularia takesimensis] ref|YP_009115956.1| ribosomal protein S7 [Scrophularia takesimensis] ref|YP_009117268.1| ribosomal protein S7 (chloroplast) [Premna microphylla] ref|YP_009117281.1| ribosomal protein S7 (chloroplast) [Premna microphylla] ref|YP_009232089.1| ribosomal protein S7 (chloroplast) [Lavandula angustifolia] ref|YP_009232104.1| ribosomal protein S7 (chloroplast) [Lavandula angustifolia] ref|YP_009242110.1| ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] ref|YP_009242124.1| ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] ref|YP_009242198.1| ribosomal protein S7 (chloroplast) [Stenogyne bifida] ref|YP_009242212.1| ribosomal protein S7 (chloroplast) [Stenogyne bifida] ref|YP_009242286.1| ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] ref|YP_009242300.1| ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] ref|YP_009242374.1| ribosomal protein S7 (chloroplast) [Phyllostegia velutina] ref|YP_009242388.1| ribosomal protein S7 (chloroplast) [Phyllostegia velutina] ref|YP_009242462.1| ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] ref|YP_009242476.1| ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] ref|YP_009242550.1| ribosomal protein S7 (chloroplast) [Stachys chamissonis] ref|YP_009242564.1| ribosomal protein S7 (chloroplast) [Stachys chamissonis] ref|YP_009242638.1| ribosomal protein S7 (chloroplast) [Stachys coccinea] ref|YP_009242652.1| ribosomal protein S7 (chloroplast) [Stachys coccinea] ref|YP_009242726.1| ribosomal protein S7 (chloroplast) [Stachys sylvatica] ref|YP_009242740.1| ribosomal protein S7 (chloroplast) [Stachys sylvatica] ref|YP_009242814.1| ribosomal protein S7 (chloroplast) [Stachys byzantina] ref|YP_009242828.1| ribosomal protein S7 (chloroplast) [Stachys byzantina] ref|YP_009254261.1| ribosomal protein S7 (chloroplast) [Erythranthe lutea] ref|YP_009254274.1| ribosomal protein S7 (chloroplast) [Erythranthe lutea] ref|YP_009270959.1| ribosomal protein S7 (chloroplast) [Perilla setoyensis] ref|YP_009270973.1| ribosomal protein S7 (chloroplast) [Perilla setoyensis] ref|YP_009270783.1| ribosomal protein S7 (chloroplast) [Perilla citriodora] ref|YP_009270797.1| ribosomal protein S7 (chloroplast) [Perilla citriodora] ref|YP_009270871.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] ref|YP_009270885.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] ref|YP_009305681.1| ribosomal protein S7 (plastid) [Veronicastrum sibiricum] ref|YP_009305695.1| ribosomal protein S7 (plastid) [Veronicastrum sibiricum] ref|YP_009309324.1| ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] ref|YP_009309337.1| ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] ref|YP_009309411.1| ribosomal protein S7 (chloroplast) [Pogostemon stellatus] ref|YP_009309424.1| ribosomal protein S7 (chloroplast) [Pogostemon stellatus] ref|YP_009309498.1| ribosomal protein S7 (chloroplast) [Paulownia coreana] ref|YP_009309511.1| ribosomal protein S7 (chloroplast) [Paulownia coreana] ref|YP_009309585.1| ribosomal protein S7 (chloroplast) [Paulownia tomentosa] ref|YP_009309598.1| ribosomal protein S7 (chloroplast) [Paulownia tomentosa] ref|YP_009309672.1| ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] ref|YP_009309685.1| ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] ref|YP_009309921.1| ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] ref|YP_009309934.1| ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] ref|YP_009317956.1| ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] ref|YP_009317969.1| ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] ref|YP_009316359.1| ribosomal protein S7 (plastid) [Castilleja paramensis] ref|YP_009316370.1| ribosomal protein S7 (plastid) [Castilleja paramensis] ref|YP_009327434.1| ribosomal protein S7 (chloroplast) [Mentha longifolia] ref|YP_009327447.1| ribosomal protein S7 (chloroplast) [Mentha longifolia] ref|YP_009344483.1| ribosomal protein S7 (chloroplast) [Rehmannia chingii] ref|YP_009344496.1| ribosomal protein S7 (chloroplast) [Rehmannia chingii] ref|YP_009353989.1| ribosomal protein S7 (chloroplast) [Rehmannia glutinosa] ref|YP_009354003.1| ribosomal protein S7 (chloroplast) [Rehmannia glutinosa] ref|YP_009354077.1| ribosomal protein S7 (chloroplast) [Rehmannia henryi] ref|YP_009354090.1| ribosomal protein S7 (chloroplast) [Rehmannia henryi] ref|YP_009354164.1| ribosomal protein S7 (chloroplast) [Rehmannia solanifolia] ref|YP_009354178.1| ribosomal protein S7 (chloroplast) [Rehmannia solanifolia] ref|YP_009354252.1| ribosomal protein S7 (chloroplast) [Rehmannia piasezkii] ref|YP_009354265.1| ribosomal protein S7 (chloroplast) [Rehmannia piasezkii] ref|YP_009354339.1| ribosomal protein S7 (chloroplast) [Rehmannia elata] ref|YP_009354352.1| ribosomal protein S7 (chloroplast) [Rehmannia elata] ref|YP_009364440.1| ribosomal protein S7 (chloroplast) [Lysionotus pauciflorus] ref|YP_009364454.1| ribosomal protein S7 (chloroplast) [Lysionotus pauciflorus] ref|YP_009365706.1| ribosomal protein S7 (plastid) [Digitalis lanata] ref|YP_009365719.1| ribosomal protein S7 (plastid) [Digitalis lanata] ref|YP_009383775.1| ribosomal protein S7 (chloroplast) [Chionanthus retusus] ref|YP_009383788.1| ribosomal protein S7 (chloroplast) [Chionanthus retusus] ref|YP_009388816.1| ribosomal protein S7 (chloroplast) [Ocimum basilicum] ref|YP_009388829.1| ribosomal protein S7 (chloroplast) [Ocimum basilicum] ref|YP_009428124.1| ribosomal protein S7 (chloroplast) [Echinacanthus lofouensis] ref|YP_009428137.1| ribosomal protein S7 (chloroplast) [Echinacanthus lofouensis] ref|YP_009437515.1| ribosomal protein S7 (chloroplast) [Primulina eburnea] ref|YP_009437529.1| ribosomal protein S7 (chloroplast) [Primulina eburnea] ref|YP_009437603.1| ribosomal protein S7 (chloroplast) [Primulina liboensis] ref|YP_009437617.1| ribosomal protein S7 (chloroplast) [Primulina liboensis] ref|YP_009443993.1| ribosomal protein S7 (chloroplast) [Forsythia suspensa] ref|YP_009444006.1| ribosomal protein S7 (chloroplast) [Forsythia suspensa] ref|YP_009445290.1| ribosomal protein S7 (chloroplast) [Primulina huaijiensis] ref|YP_009445304.1| ribosomal protein S7 (chloroplast) [Primulina huaijiensis] ref|YP_009445377.1| ribosomal protein S7 (chloroplast) [Primulina linearifolia] ref|YP_009445391.1| ribosomal protein S7 (chloroplast) [Primulina linearifolia] ref|YP_009459659.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] ref|YP_009459672.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] ref|YP_009459746.1| ribosomal protein S7 (chloroplast) [Scrophularia henryi] ref|YP_009459759.1| ribosomal protein S7 (chloroplast) [Scrophularia henryi] ref|YP_009460836.1| ribosomal protein S7 (plastid) [Galeopsis tetrahit] ref|YP_009460822.1| ribosomal protein S7 (plastid) [Galeopsis tetrahit] ref|YP_009461093.1| ribosomal protein S7 (plastid) [Lamium album] ref|YP_009461079.1| ribosomal protein S7 (plastid) [Lamium album] ref|YP_009461182.1| ribosomal protein S7 (plastid) [Lamium galeobdolon] ref|YP_009461168.1| ribosomal protein S7 (plastid) [Lamium galeobdolon] ref|YP_009461774.1| ribosomal protein S7 (chloroplast) [Chionanthus parkinsonii] ref|YP_009461788.1| ribosomal protein S7 (chloroplast) [Chionanthus parkinsonii] ref|YP_009461862.1| ribosomal protein S7 (chloroplast) [Chionanthus rupicola] ref|YP_009461876.1| ribosomal protein S7 (chloroplast) [Chionanthus rupicola] ref|YP_009461950.1| ribosomal protein S7 (chloroplast) [Forestiera isabelae] ref|YP_009461964.1| ribosomal protein S7 (chloroplast) [Forestiera isabelae] ref|YP_009462038.1| ribosomal protein S7 (chloroplast) [Forsythia x intermedia] ref|YP_009462051.1| ribosomal protein S7 (chloroplast) [Forsythia x intermedia] ref|YP_009462125.1| ribosomal protein S7 (chloroplast) [Nestegis apetala] ref|YP_009462139.1| ribosomal protein S7 (chloroplast) [Nestegis apetala] ref|YP_009462213.1| ribosomal protein S7 (chloroplast) [Noronhia lowryi] ref|YP_009462227.1| ribosomal protein S7 (chloroplast) [Noronhia lowryi] ref|YP_009462301.1| ribosomal protein S7 (chloroplast) [Olea exasperata] ref|YP_009462315.1| ribosomal protein S7 (chloroplast) [Olea exasperata] ref|YP_009462389.1| ribosomal protein S7 (chloroplast) [Schrebera arborea] ref|YP_009462403.1| ribosomal protein S7 (chloroplast) [Schrebera arborea] ref|YP_009462477.1| ribosomal protein S7 (chloroplast) [Syringa vulgaris] ref|YP_009462489.1| ribosomal protein S7 (chloroplast) [Syringa vulgaris] ref|YP_009468654.1| 30S ribosomal protein S7 (plastid) [Fraxinus chiisanensis] ref|YP_009468667.1| 30S ribosomal protein S7 (plastid) [Fraxinus chiisanensis] ref|YP_009469046.1| ribosomal protein S7 (chloroplast) [Streptocarpus teitensis] ref|YP_009469061.1| ribosomal protein S7 (chloroplast) [Streptocarpus teitensis] ref|YP_009471870.1| ribosomal protein S7 (chloroplast) [Mentha spicata] ref|YP_009471883.1| ribosomal protein S7 (chloroplast) [Mentha spicata] gb|ADA69971.1| ribosomal protein S7 (chloroplast) [Olea europaea] gb|ADA69985.1| ribosomal protein S7 (chloroplast) [Olea europaea] gb|ADD29889.1| ribosomal protein S7 (chloroplast) [Antirrhinum majus] gb|ADD72135.1| ribosomal protein S7 (chloroplast) [Olea europaea] gb|ADD72150.1| ribosomal protein S7 (chloroplast) [Olea europaea] emb|CBR30360.1| ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] emb|CBR30374.1| ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] emb|CBR23876.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23890.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR24670.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] emb|CBR24684.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] emb|CBR30453.1| ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] emb|CBR30468.1| ribosomal protein S7 (plastid) [Olea europaea subsp. europaea] emb|CBS29397.1| ribosomal protein S7 (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29412.1| ribosomal protein S7 (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29293.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. maroccana] emb|CBS29309.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. maroccana] emb|CBJ04343.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBJ04357.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23784.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23798.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] gb|AEK53275.1| ribosomal protein S7 (chloroplast) [Dorcoceras hygrometricum] gb|AEK53289.1| ribosomal protein S7 (chloroplast) [Dorcoceras hygrometricum] gb|AEK53319.1| ribosomal protein S7 (mitochondrion) [Dorcoceras hygrometricum] gb|AEK71665.1| ribosomal protein S7 (plastid) [Antirrhinum majus] gb|AEO92753.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] gb|AEO92766.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] gb|AFQ30975.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] gb|AFQ30990.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] gb|AFV61859.1| ribosomal protein S7 (chloroplast) [Origanum vulgare subsp. vulgare] gb|AFV61872.1| ribosomal protein S7 (chloroplast) [Origanum vulgare subsp. vulgare] emb|CCP47177.1| ribosomal protein S7 (chloroplast) [Tectona grandis] emb|CCP47193.1| ribosomal protein S7 (chloroplast) [Tectona grandis] emb|CCP47266.1| ribosomal protein S7 (chloroplast) [Tectona grandis] emb|CCP47282.1| ribosomal protein S7 (chloroplast) [Tectona grandis] emb|CCP47355.1| ribosomal protein S7 (chloroplast) [Tectona grandis] emb|CCP47371.1| ribosomal protein S7 (chloroplast) [Tectona grandis] gb|AGL45382.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] gb|AGL45395.1| ribosomal protein S7 (chloroplast) [Sesamum indicum] emb|CCQ09147.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] emb|CCQ09161.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AGU16573.1| ribosomal protein S7 (mitochondrion) [Salvia miltiorrhiza] emb|CDI43964.1| ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] emb|CDI43977.1| ribosomal protein S7 (chloroplast) [Lindenbergia philippensis] emb|CCQ71667.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] emb|CCQ71682.1| ribosomal protein S7 (chloroplast) [Salvia miltiorrhiza] emb|CDL78856.1| ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] emb|CDL78860.1| ribosomal protein S7 (chloroplast) [Pinguicula ehlersiae] gb|EYU43440.1| hypothetical protein MIMGU_mgv11b012968mg [Erythranthe guttata] emb|CED79807.1| ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] emb|CED79821.1| ribosomal protein S7 (chloroplast) [Hesperelaea palmeri] gb|AJD00771.1| ribosomal protein S7 (plastid) [Scrophularia takesimensis] gb|AJD00786.1| ribosomal protein S7 (plastid) [Scrophularia takesimensis] gb|AJE28422.1| ribosomal protein S7 (chloroplast) [Premna microphylla] gb|AJE28435.1| ribosomal protein S7 (chloroplast) [Premna microphylla] gb|AKJ77776.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] gb|AKJ77785.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] gb|AKM21384.1| ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] gb|AKM21397.1| ribosomal protein S7 (chloroplast) [Pogostemon yatabeanus] gb|AKM21471.1| ribosomal protein S7 (chloroplast) [Pogostemon stellatus] gb|AKM21484.1| ribosomal protein S7 (chloroplast) [Pogostemon stellatus] gb|AKM21559.1| ribosomal protein S7 (chloroplast) [Paulownia coreana] gb|AKM21571.1| ribosomal protein S7 (chloroplast) [Paulownia coreana] gb|AKM21646.1| ribosomal protein S7 (chloroplast) [Paulownia tomentosa] gb|AKM21658.1| ribosomal protein S7 (chloroplast) [Paulownia tomentosa] gb|AKM21732.1| ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] gb|AKM21745.1| ribosomal protein S7 (chloroplast) [Scrophularia buergeriana] gb|AKM21819.1| ribosomal protein S7 (chloroplast) [Scrophularia takesimensis] gb|AKM21832.1| ribosomal protein S7 (chloroplast) [Scrophularia takesimensis] gb|AKZ24101.1| ribosomal protein S7 (plastid) [Nepeta cataria] gb|AKZ24103.1| ribosomal protein S7 (plastid) [Penstemon gracilis] gb|AKZ24104.1| ribosomal protein S7 (plastid) [Verbascum thapsus] gb|ALJ01947.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] gb|ALJ01960.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] gb|ALZ50064.1| ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] gb|ALZ50077.1| ribosomal protein S7 (chloroplast) [Abeliophyllum distichum] gb|AMA20369.1| ribosomal protein S7 (chloroplast) [Lavandula angustifolia] gb|AMA20370.1| ribosomal protein S7 (chloroplast) [Lavandula angustifolia] gb|AMQ32907.1| ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] gb|AMQ32922.1| ribosomal protein S7 (chloroplast) [Stenogyne haliakalae] gb|AMQ32994.1| ribosomal protein S7 (chloroplast) [Phyllostegia waimeae] gb|AMQ33010.1| ribosomal protein S7 (chloroplast) [Phyllostegia waimeae] gb|AMQ33082.1| ribosomal protein S7 (chloroplast) [Stenogyne bifida] gb|AMQ33098.1| ribosomal protein S7 (chloroplast) [Stenogyne bifida] gb|AMQ33170.1| ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] gb|AMQ33186.1| ribosomal protein S7 (chloroplast) [Haplostachys haplostachya] gb|AMQ33258.1| ribosomal protein S7 (chloroplast) [Phyllostegia velutina] gb|AMQ33274.1| ribosomal protein S7 (chloroplast) [Phyllostegia velutina] gb|AMQ33346.1| ribosomal protein S7 (chloroplast) [Stenogyne sessilis] gb|AMQ33362.1| ribosomal protein S7 (chloroplast) [Stenogyne sessilis] gb|AMQ33434.1| ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] gb|AMQ33450.1| ribosomal protein S7 (chloroplast) [Stenogyne kanehoana] gb|AMQ33522.1| ribosomal protein S7 (chloroplast) [Haplostachys linearifolia] gb|AMQ33538.1| ribosomal protein S7 (chloroplast) [Haplostachys linearifolia] gb|AMQ33610.1| ribosomal protein S7 (chloroplast) [Stachys chamissonis] gb|AMQ33626.1| ribosomal protein S7 (chloroplast) [Stachys chamissonis] gb|AMQ33698.1| ribosomal protein S7 (chloroplast) [Stachys coccinea] gb|AMQ33714.1| ribosomal protein S7 (chloroplast) [Stachys coccinea] gb|AMQ33786.1| ribosomal protein S7 (chloroplast) [Stachys sylvatica] gb|AMQ33802.1| ribosomal protein S7 (chloroplast) [Stachys sylvatica] gb|AMQ33874.1| ribosomal protein S7 (chloroplast) [Stachys byzantina] gb|AMQ33890.1| ribosomal protein S7 (chloroplast) [Stachys byzantina] gb|AMR74155.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] gb|AMR74169.1| ribosomal protein S7 (chloroplast) [Perilla frutescens] gb|AMR74243.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. acuta] gb|AMR74257.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. acuta] gb|AMR74331.1| ribosomal protein S7 (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74345.1| ribosomal protein S7 (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74419.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74433.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74507.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74521.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74595.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74609.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74683.1| ribosomal protein S7 (chloroplast) [Perilla citriodora] gb|AMR74697.1| ribosomal protein S7 (chloroplast) [Perilla citriodora] gb|AMR74771.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74785.1| ribosomal protein S7 (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74859.1| ribosomal protein S7 (chloroplast) [Perilla setoyensis] gb|AMR74873.1| ribosomal protein S7 (chloroplast) [Perilla setoyensis] gb|ANA57755.1| ribosomal protein S7 (plastid) [Veronicastrum sibiricum] gb|ANA57769.1| ribosomal protein S7 (plastid) [Veronicastrum sibiricum] gb|ANC62960.1| ribosomal protein S7 (chloroplast) [Erythranthe lutea] gb|ANC62973.1| ribosomal protein S7 (chloroplast) [Erythranthe lutea] gb|ANJ04319.1| ribosomal protein S7 (plastid) [Castilleja paramensis] gb|ANJ04331.1| ribosomal protein S7 (plastid) [Castilleja paramensis] gb|ANQ46356.1| rps7 (chloroplast) [Pogostemon cablin] gb|ANX10212.1| ribosomal protein S7 (chloroplast) [Triphysaria versicolor] gb|ANX10224.1| ribosomal protein S7 (chloroplast) [Triphysaria versicolor] gb|AOW32164.1| ribosomal protein S7 (chloroplast) [Mentha longifolia] gb|AOW32165.1| ribosomal protein S7 (chloroplast) [Mentha longifolia] gb|AOY41483.1| ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] gb|AOY41484.1| ribosomal protein S7 (chloroplast) [Haberlea rhodopensis] gb|APT42278.1| ribosomal protein S7 (chloroplast) [Rehmannia chingii] gb|APT42279.1| ribosomal protein S7 (chloroplast) [Rehmannia chingii] gb|AQZ40519.1| ribosomal protein S7 (chloroplast) [Rehmannia glutinosa] gb|AQZ40520.1| ribosomal protein S7 (chloroplast) [Rehmannia glutinosa] gb|AQZ40606.1| ribosomal protein S7 (chloroplast) [Rehmannia henryi] gb|AQZ40607.1| ribosomal protein S7 (chloroplast) [Rehmannia henryi] gb|AQZ40694.1| ribosomal protein S7 (chloroplast) [Rehmannia solanifolia] gb|AQZ40695.1| ribosomal protein S7 (chloroplast) [Rehmannia solanifolia] gb|AQZ40781.1| ribosomal protein S7 (chloroplast) [Rehmannia piasezkii] gb|AQZ40782.1| ribosomal protein S7 (chloroplast) [Rehmannia piasezkii] gb|AQZ40868.1| ribosomal protein S7 (chloroplast) [Rehmannia elata] gb|AQZ40869.1| ribosomal protein S7 (chloroplast) [Rehmannia elata] gb|ARF05934.1| ribosomal protein S7 (chloroplast) [Lysionotus pauciflorus] gb|ARF05935.1| ribosomal protein S7 (chloroplast) [Lysionotus pauciflorus] gb|ARJ61206.1| ribosomal protein S7 (plastid) [Digitalis lanata] gb|ARJ61207.1| ribosomal protein S7 (plastid) [Digitalis lanata] gb|ARS43948.1| ribosomal protein S7 (chloroplast) [Chionanthus retusus] gb|ARS43961.1| ribosomal protein S7 (chloroplast) [Chionanthus retusus] gb|ARU77286.1| ribosomal protein S7 (chloroplast) [Ocimum basilicum] gb|ARU77301.1| ribosomal protein S7 (chloroplast) [Ocimum basilicum] gb|ASV48012.1| ribosomal protein S7 (chloroplast) [Echinacanthus lofouensis] gb|ASV48025.1| ribosomal protein S7 (chloroplast) [Echinacanthus lofouensis] gb|ATG27910.1| ribosomal protein S7 (chloroplast) [Primulina brachytricha var. magnibracteata] gb|ATG27911.1| ribosomal protein S7 (chloroplast) [Primulina brachytricha var. magnibracteata] gb|ATG27998.1| ribosomal protein S7 (chloroplast) [Primulina eburnea] gb|ATG27999.1| ribosomal protein S7 (chloroplast) [Primulina eburnea] gb|ATG28086.1| ribosomal protein S7 (chloroplast) [Primulina liboensis] gb|ATG28087.1| ribosomal protein S7 (chloroplast) [Primulina liboensis] gb|ATU07213.1| ribosomal protein S7 (chloroplast) [Forsythia suspensa] gb|ATU07226.1| ribosomal protein S7 (chloroplast) [Forsythia suspensa] gb|ATV96024.1| ribosomal protein S7 (chloroplast) [Primulina huaijiensis] gb|ATV96038.1| ribosomal protein S7 (chloroplast) [Primulina huaijiensis] gb|ATV96111.1| ribosomal protein S7 (chloroplast) [Primulina linearifolia] gb|ATV96125.1| ribosomal protein S7 (chloroplast) [Primulina linearifolia] gb|AUT13305.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] gb|AUT13318.1| ribosomal protein S7 (chloroplast) [Scrophularia dentata] gb|AUT13392.1| ribosomal protein S7 (chloroplast) [Scrophularia henryi] gb|AUT13405.1| ribosomal protein S7 (chloroplast) [Scrophularia henryi] gb|AUT82089.1| ribosomal protein S7 (plastid) [Galeopsis tetrahit] gb|AUT82090.1| ribosomal protein S7 (plastid) [Galeopsis tetrahit] gb|AUT82347.1| ribosomal protein S7 (plastid) [Lamium album] gb|AUT82348.1| ribosomal protein S7 (plastid) [Lamium album] gb|AUT82435.1| ribosomal protein S7 (plastid) [Lamium galeobdolon] gb|AUT82436.1| ribosomal protein S7 (plastid) [Lamium galeobdolon] gb|AUT83924.1| ribosomal protein S7 (chloroplast) [Chionanthus parkinsonii] gb|AUT83938.1| ribosomal protein S7 (chloroplast) [Chionanthus parkinsonii] gb|AUT84012.1| ribosomal protein S7 (chloroplast) [Chionanthus rupicola] gb|AUT84026.1| ribosomal protein S7 (chloroplast) [Chionanthus rupicola] gb|AUT84100.1| ribosomal protein S7 (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84113.1| ribosomal protein S7 (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84187.1| ribosomal protein S7 (chloroplast) [Forestiera isabelae] gb|AUT84201.1| ribosomal protein S7 (chloroplast) [Forestiera isabelae] gb|AUT84275.1| ribosomal protein S7 (chloroplast) [Forsythia x intermedia] gb|AUT84288.1| ribosomal protein S7 (chloroplast) [Forsythia x intermedia] gb|AUT84361.1| ribosomal protein S7 (chloroplast) [Fraxinus ornus] gb|AUT84375.1| ribosomal protein S7 (chloroplast) [Fraxinus ornus] gb|AUT84449.1| ribosomal protein S7 (chloroplast) [Nestegis apetala] gb|AUT84463.1| ribosomal protein S7 (chloroplast) [Nestegis apetala] gb|AUT84537.1| ribosomal protein S7 (chloroplast) [Noronhia lowryi] gb|AUT84551.1| ribosomal protein S7 (chloroplast) [Noronhia lowryi] gb|AUT84625.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84639.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84712.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84726.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84801.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84815.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84889.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84903.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84977.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. guanchica] gb|AUT84991.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. guanchica] gb|AUT85065.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85078.1| ribosomal protein S7 (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85152.1| ribosomal protein S7 (chloroplast) [Olea exasperata] gb|AUT85166.1| ribosomal protein S7 (chloroplast) [Olea exasperata] gb|AUT85240.1| ribosomal protein S7 (chloroplast) [Schrebera arborea] gb|AUT85254.1| ribosomal protein S7 (chloroplast) [Schrebera arborea] gb|AUT85328.1| ribosomal protein S7 (chloroplast) [Syringa vulgaris] gb|AUT85340.1| ribosomal protein S7 (chloroplast) [Syringa vulgaris] gb|AVA09442.1| 30S ribosomal protein S7 (plastid) [Fraxinus chiisanensis] gb|AVA09455.1| 30S ribosomal protein S7 (plastid) [Fraxinus chiisanensis] gb|AVC55588.1| ribosomal protein S7 (chloroplast) [Streptocarpus teitensis] gb|AVC55603.1| ribosomal protein S7 (chloroplast) [Streptocarpus teitensis] gb|AVE14988.1| ribosomal protein S7 (chloroplast) [Forsythia saxatilis] gb|AVE15002.1| ribosomal protein S7 (chloroplast) [Forsythia saxatilis] gb|AVI16434.1| ribosomal protein S7 (chloroplast) [Mentha spicata] gb|AVI16447.1| ribosomal protein S7 (chloroplast) [Mentha spicata] gb|AVK80136.1| ribosomal protein S7 (chloroplast) [Pedicularis hallaisanensis] gb|AVK80137.1| ribosomal protein S7 (chloroplast) [Pedicularis hallaisanensis] gb|AVM38779.1| ribosomal protein S7 (chloroplast) [Fraxinus excelsior] gb|AVM38790.1| ribosomal protein S7 (chloroplast) [Fraxinus excelsior] Length = 155 Score = 234 bits (598), Expect = 1e-69 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122 >ref|YP_008964092.1| ribosomal protein S7 [Ajuga reptans] ref|YP_009420941.1| ribosomal protein S7 (chloroplast) [Caryopteris mongholica] ref|YP_009420953.1| ribosomal protein S7 (chloroplast) [Caryopteris mongholica] gb|AHA84951.1| ribosomal protein S7 (plastid) [Ajuga reptans] gb|ASQ40526.1| ribosomal protein S7 (chloroplast) [Caryopteris mongholica] gb|ASQ40538.1| ribosomal protein S7 (chloroplast) [Caryopteris mongholica] Length = 155 Score = 234 bits (598), Expect = 1e-69 Identities = 120/122 (98%), Positives = 121/122 (99%) Frame = -1 Query: 535 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 356 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 355 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKTLAIRWLLAASRKRPGRNMAFKL 176 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK LAIRWLLAASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 175 SS 170 SS Sbjct: 121 SS 122