BLASTX nr result
ID: Acanthopanax21_contig00000124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00000124 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_097245711.1| hypothetical protein [Nocardia amikacinitole... 55 8e-06 ref|WP_067787412.1| hypothetical protein [Nocardia amikacinitole... 55 8e-06 >ref|WP_097245711.1| hypothetical protein [Nocardia amikacinitolerans] emb|SNY82360.1| hypothetical protein SAMN04244553_3422 [Nocardia amikacinitolerans] Length = 444 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/89 (34%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Frame = -1 Query: 393 PLADMPAPCTGSPY---TEGSGYPPPNGELDLPSQNSDWPYPPIGRPRMVPPRERNSTAP 223 P D PAP SP T+ + PPP + +P + P PP + VPP + + AP Sbjct: 316 PTQDTPAPTQESPVPPPTQETPAPPPTQDAPVPPPTQETPAPPPSQESPVPPPTQETPAP 375 Query: 222 RPLQHWPLPAQTPQH*PLQALTPQPLDPP 136 P Q P P T Q P +P+P+ PP Sbjct: 376 PPTQEMPAPPPT-QEAPPPPPSPEPVPPP 403 >ref|WP_067787412.1| hypothetical protein [Nocardia amikacinitolerans] Length = 444 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/89 (34%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Frame = -1 Query: 393 PLADMPAPCTGSPY---TEGSGYPPPNGELDLPSQNSDWPYPPIGRPRMVPPRERNSTAP 223 P D PAP SP T+ + PPP + +P + P PP + VPP + + AP Sbjct: 316 PTQDTPAPTQESPVPPPTQETPAPPPTQDAPVPPPTQETPAPPPSQESPVPPPTQETPAP 375 Query: 222 RPLQHWPLPAQTPQH*PLQALTPQPLDPP 136 P Q P P T Q P +P+P+ PP Sbjct: 376 PPTQEMPAPPPT-QEAPPPPPSPEPVPPP 403