BLASTX nr result
ID: Acanthopanax21_contig00000010
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax21_contig00000010
(13,823 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|WP_095186774.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_096965272.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_001118861.1| MULTISPECIES: protein translocase subunit Se... 791 0.0
ref|WP_063267744.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_047340654.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_032314168.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_021549622.1| protein translocase subunit SecY [Escherichi... 791 0.0
ref|WP_020231571.1| protein translocase subunit SecY [Escherichi... 791 0.0
ref|WP_001666098.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_001500112.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_001399816.1| preprotein translocase subunit SecY [Escheri... 791 0.0
ref|WP_015962746.1| MULTISPECIES: protein translocase subunit Se... 791 0.0
ref|WP_006817268.1| preprotein translocase subunit SecY [Yokenel... 791 0.0
ref|WP_096974258.1| preprotein translocase subunit SecY [Escheri... 790 0.0
ref|WP_089589831.1| preprotein translocase subunit SecY [Escheri... 790 0.0
ref|WP_088540863.1| preprotein translocase subunit SecY [Escheri... 790 0.0
ref|WP_075332235.1| preprotein translocase subunit SecY [Shigell... 790 0.0
ref|WP_038158504.1| MULTISPECIES: preprotein translocase subunit... 790 0.0
ref|WP_001557396.1| protein translocase subunit SecY [Escherichi... 790 0.0
ref|WP_001118868.1| protein translocase subunit SecY [Escherichi... 790 0.0
>ref|WP_095186774.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAB76350.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSARGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_096965272.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AQW74982.1| preprotein translocase subunit SecY [Escherichia coli M8]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLSELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001118861.1| MULTISPECIES: protein translocase subunit SecY [Proteobacteria]
ref|NP_312192.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
Sakai]
ref|NP_417759.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
substr. MG1655]
ref|NP_709088.1| preprotein translocase subunit SecY [Shigella flexneri 2a str. 301]
ref|YP_002409691.1| preprotein translocase subunit SecY [Escherichia coli IAI39]
ref|YP_002414426.1| preprotein translocase membrane subunit [Escherichia coli UMN026]
ref|YP_006121612.1| preprotein translocase subunit SecY [Escherichia coli O83:H1 str. NRG
857C]
ref|YP_006777230.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
2011C-3493]
sp|P0AGA4.1|SECY_ECO57 RecName: Full=Protein translocase subunit SecY
sp|P0AGA3.1|SECY_ECOL6 RecName: Full=Protein translocase subunit SecY
sp|P0AGA2.1|SECY_ECOLI RecName: Full=Protein translocase subunit SecY
sp|P0AGA5.1|SECY_SHIFL RecName: Full=Protein translocase subunit SecY
pdb|5ABB|A Chain A, Visualization Of A Polytopic Membrane Protein During
Secy-mediated Membrane Insertion
pdb|5GAE|GG Chain g, Rnc In Complex With A Translocating Secyeg
gb|AAG58421.1|AE005556_14 putative ATPase subunit of translocase [Escherichia coli O157:H7 str.
EDL933]
gb|AAN82499.1|AE016767_259 Preprotein translocase secY subunit [Escherichia coli CFT073]
emb|CAA25725.1| unnamed protein product [Escherichia coli]
gb|AAA58097.1| secY [Escherichia coli str. K-12 substr. MG1655]
gb|AAC76325.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
substr. MG1655]
dbj|BAB37588.1| putative ATPase subunit of translocase [Escherichia coli O157:H7 str.
Sakai]
gb|AAN44795.1| putative ATPase subunit of translocase [Shigella flexneri 2a str. 301]
gb|AAP19381.1| putative ATPase subunit of translocase [Shigella flexneri 2a str.
2457T]
gb|ABB67782.1| putative ATPase subunit of translocase [Shigella boydii Sb227]
dbj|BAE77991.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
substr. W3110]
gb|ABE09183.1| putative ATPase subunit of translocase [Escherichia coli UTI89]
gb|ABG71368.1| preprotein translocase secY subunit [Escherichia coli 536]
gb|ABF05363.1| putative ATPase subunit of translocase [Shigella flexneri 5 str. 8401]
gb|ABJ02780.1| putative ATPase subunit of translocase [Escherichia coli APEC O1]
gb|ABV07709.1| preprotein translocase, SecY subunit [Escherichia coli HS]
gb|ABV20488.1| preprotein translocase, SecY subunit [Escherichia coli O139:H28 str.
E24377A]
gb|ACA76091.1| preprotein translocase, SecY subunit [Escherichia coli ATCC 8739]
gb|ACB04362.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
substr. DH10B]
gb|ACB17845.1| preprotein translocase, SecY subunit [Escherichia coli SMS-3-5]
gb|ACD07609.1| preprotein translocase, SecY subunit [Shigella boydii CDC 3083-94]
gb|EDU30840.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4196]
gb|EDU51965.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4113]
gb|EDU62646.1| preprotein translocase, SecY subunit [Escherichia coli 53638]
gb|EDU67872.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4076]
gb|EDU80182.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4486]
gb|EDV64896.1| preprotein translocase, SecY subunit [Escherichia coli F11]
gb|EDV80512.1| preprotein translocase, SecY subunit [Escherichia coli E22]
gb|EDV85639.1| preprotein translocase, SecY subunit [Escherichia coli E110019]
gb|EDX28009.1| preprotein translocase, SecY subunit [Escherichia coli B171]
gb|EDX32815.1| preprotein translocase, SecY subunit [Shigella dysenteriae 1012]
gb|EDX37086.1| preprotein translocase, SecY subunit [Escherichia coli 101-1]
gb|EDZ78558.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4206]
gb|EDZ83168.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4045]
gb|EDZ89450.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4042]
gb|ACI39815.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
EC4115]
gb|ACI76931.1| putative ATPase subunit of translocase [Escherichia coli]
gb|ACI76932.1| putative ATPase subunit of translocase [Escherichia coli]
gb|ACI76933.1| putative ATPase subunit of translocase [Escherichia coli]
gb|ACI76934.1| putative ATPase subunit of translocase [Escherichia coli]
gb|ACI76935.1| putative ATPase subunit of translocase [Escherichia coli]
dbj|BAG79099.1| preprotein translocase subunit [Escherichia coli SE11]
emb|CAS11111.1| preprotein translocase membrane subunit [Escherichia coli O127:H6 str.
E2348/69]
gb|EEC29166.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
TW14588]
emb|CAV00003.1| preprotein translocase membrane subunit [Escherichia coli 55989]
emb|CAQ90763.1| preprotein translocase membrane subunit [Escherichia fergusonii ATCC
35469]
emb|CAR00251.1| preprotein translocase membrane subunit [Escherichia coli IAI1]
emb|CAR04904.1| preprotein translocase membrane subunit [Escherichia coli S88]
emb|CAR19908.1| preprotein translocase membrane subunit [Escherichia coli IAI39]
emb|CAR10102.2| preprotein translocase membrane subunit [Escherichia coli ED1a]
emb|CAR14921.1| preprotein translocase membrane subunit [Escherichia coli UMN026]
emb|CAP77752.1| Preprotein translocase subunit secY [Escherichia coli LF82]
gb|EEH70990.1| preprotein translocase subunit secY [Escherichia sp. 1_1_43]
gb|EEH88553.1| preprotein translocase subunit secY [Escherichia sp. 3_2_53FAA]
gb|EEJ50041.1| preprotein translocase, SecY subunit [Escherichia coli 83972]
gb|ACR65270.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
emb|CAQ33619.1| SecY, subunit of SecEGY-Secretion Complex and Sec Protein Secretion
Complex [Escherichia coli BL21(DE3)]
gb|ACT27522.1| preprotein translocase, SecY subunit [Escherichia coli
'BL21-Gold(DE3)pLysS AG']
gb|ACT40800.1| protein translocase subunit SecY [Escherichia coli B str. REL606]
gb|ACT44955.1| preprotein translocase membrane subunit [Escherichia coli BL21(DE3)]
gb|ACT73998.1| preprotein translocase membrane subunit [Escherichia coli O157:H7 str.
TW14359]
dbj|BAI27572.1| preprotein translocase membrane subunit SecY [Escherichia coli O26:H11
str. 11368]
dbj|BAI32742.1| preprotein translocase membrane subunit SecY [Escherichia coli O103:H2
str. 12009]
dbj|BAI37894.1| preprotein translocase membrane subunit SecY [Escherichia coli O111:H-
str. 11128]
gb|ACX38103.1| preprotein translocase, SecY subunit [Escherichia coli DH1]
dbj|BAI56665.1| preprotein translocase subunit [Escherichia coli SE15]
gb|ADA75649.1| Preprotein translocase subunit secY [Shigella flexneri 2002017]
emb|CBG36400.1| preprotein translocase subunit SecY [Escherichia coli 042]
gb|ADD58492.1| Preprotein translocase subunit secY [Escherichia coli O55:H7 str.
CB9615]
gb|EFE61175.1| preprotein translocase [Escherichia coli B088]
gb|EFE98742.1| secY [Escherichia coli FVEC1412]
gb|EFF04278.1| preprotein translocase [Escherichia coli B185]
gb|EFF10859.1| preprotein translocase [Escherichia coli B354]
gb|ADE92549.1| preprotein translocase, SecY subunit [Escherichia coli IHE3034]
gb|EFI17992.1| preprotein translocase subunit secY [Escherichia coli FVEC1302]
gb|EFI89848.1| preprotein translocase, SecY subunit [Escherichia coli MS 196-1]
gb|EFJ58282.1| preprotein translocase, SecY subunit [Escherichia coli MS 185-1]
gb|EFJ63509.1| preprotein translocase, SecY subunit [Escherichia coli MS 200-1]
gb|EFJ68010.1| preprotein translocase, SecY subunit [Escherichia coli MS 175-1]
gb|EFJ75349.1| preprotein translocase, SecY subunit [Escherichia coli MS 198-1]
gb|EFJ83084.1| preprotein translocase, SecY subunit [Escherichia coli MS 69-1]
gb|EFJ87959.1| preprotein translocase, SecY subunit [Escherichia coli MS 84-1]
gb|EFJ92920.1| preprotein translocase, SecY subunit [Escherichia coli MS 45-1]
gb|EFJ97844.1| preprotein translocase, SecY subunit [Escherichia coli MS 115-1]
gb|EFK05050.1| preprotein translocase, SecY subunit [Escherichia coli MS 182-1]
gb|EFK17388.1| preprotein translocase, SecY subunit [Escherichia coli MS 116-1]
gb|EFK23510.1| preprotein translocase, SecY subunit [Escherichia coli MS 187-1]
gb|EFK45732.1| preprotein translocase, SecY subunit [Escherichia coli MS 119-7]
gb|EFK53444.1| preprotein translocase, SecY subunit [Escherichia coli MS 107-1]
gb|EFK66964.1| preprotein translocase, SecY subunit [Escherichia coli MS 124-1]
gb|EFK75772.1| preprotein translocase, SecY subunit [Escherichia coli MS 78-1]
gb|EFK92589.1| preprotein translocase, SecY subunit [Escherichia coli MS 146-1]
gb|EFM51210.1| preprotein translocase subunit SecY [Escherichia coli NC101]
gb|EFN36005.1| preprotein translocase, SecY subunit [Escherichia coli W]
gb|ADN48163.1| preprotein translocase membrane subunit [Escherichia coli ABU 83972]
gb|ADN72639.1| preprotein translocase subunit SecY [Escherichia coli UM146]
gb|EFO58887.1| preprotein translocase, SecY subunit [Escherichia coli MS 145-7]
emb|CBJ03053.1| preprotein translocase subunit SecY [Escherichia coli ETEC H10407]
gb|EFQ01021.1| preprotein translocase subunit secY [Escherichia coli 1827-70]
gb|EFR15110.1| preprotein translocase subunit secY [Escherichia coli 2362-75]
gb|ADR28678.1| preprotein translocase subunit SecY [Escherichia coli O83:H1 str. NRG
857C]
gb|EFS11842.1| preprotein translocase subunit secY [Shigella flexneri 2a str. 2457T]
gb|ADT76919.1| preprotein translocase membrane subunit [Escherichia coli W]
dbj|BAJ45034.1| preprotein translocase subunit secY [Escherichia coli DH1]
gb|EFU35851.1| preprotein translocase, SecY subunit [Escherichia coli MS 85-1]
gb|EFU44070.1| preprotein translocase, SecY subunit [Escherichia coli MS 110-3]
gb|EFU51735.1| preprotein translocase, SecY subunit [Escherichia coli MS 153-1]
gb|EFU57853.1| preprotein translocase, SecY subunit [Escherichia coli MS 16-3]
gb|EFU97712.1| preprotein translocase subunit secY [Escherichia coli 3431]
gb|EFW49120.1| Preprotein translocase secY subunit [Shigella dysenteriae CDC 74-1112]
gb|EFW57588.1| Preprotein translocase secY subunit [Shigella boydii ATCC 9905]
gb|EFW61733.1| Preprotein translocase secY subunit [Shigella flexneri CDC 796-83]
gb|EFW66316.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
EC1212]
gb|EFW70019.1| Preprotein translocase secY subunit [Escherichia coli WV_060327]
gb|EFW74077.1| Preprotein translocase secY subunit [Escherichia coli EC4100B]
gb|EFX09199.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
G5101]
gb|EFX14119.1| preprotein translocase subunit SecY [Escherichia coli O157:H- str.
493-89]
gb|EFX18880.1| preprotein translocase subunit SecY [Escherichia coli O157:H- str. H
2687]
gb|EFX23859.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str.
3256-97]
gb|EFX28806.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str. USDA
5905]
gb|EFX33396.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
LSU-61]
gb|EFZ40341.1| preprotein translocase subunit secY [Escherichia coli EPECa14]
gb|EFZ48814.1| preprotein translocase subunit secY [Escherichia coli E128010]
gb|EFZ59564.1| preprotein translocase subunit secY [Escherichia coli LT-68]
gb|EFZ64738.1| preprotein translocase subunit secY [Escherichia coli OK1180]
gb|EFZ68179.1| preprotein translocase subunit secY [Escherichia coli OK1357]
gb|EFZ74379.1| preprotein translocase subunit secY [Escherichia coli RN587/1]
gb|ADX49089.1| preprotein translocase, SecY subunit [Escherichia coli KO11FL]
gb|EGB30910.1| preprotein translocase [Escherichia coli E1520]
gb|EGB35490.1| preprotein translocase [Escherichia coli E482]
gb|EGB40355.1| preprotein translocase [Escherichia coli H120]
gb|EGB46096.1| preprotein translocase [Escherichia coli H252]
gb|EGB50360.1| preprotein translocase [Escherichia coli H263]
gb|EGB55202.1| preprotein translocase [Escherichia coli H489]
gb|EGB61697.1| preprotein translocase [Escherichia coli M863]
gb|EGB65378.1| preprotein translocase [Escherichia coli TA007]
gb|EGB69860.1| preprotein translocase [Escherichia coli TW10509]
gb|EGB78253.1| preprotein translocase, SecY subunit [Escherichia coli MS 57-2]
gb|EGB84135.1| preprotein translocase, SecY subunit [Escherichia coli MS 60-1]
gb|EGB87101.1| preprotein translocase, SecY subunit [Escherichia coli MS 117-3]
gb|EGC05958.1| preprotein translocase [Escherichia fergusonii B253]
gb|EGC10230.1| preprotein translocase [Escherichia coli E1167]
gb|EGC96727.1| preprotein translocase subunit SecY [Escherichia fergusonii ECD227]
gb|EGD66322.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
1044]
gb|EGD68284.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
1125]
gb|EGE62641.1| preprotein translocase subunit secY [Escherichia coli STEC_7v]
gb|EGH37858.1| preprotein translocase secY subunit [Escherichia coli AA86]
gb|EGI08516.1| preprotein translocase, SecY subunit [Escherichia coli H736]
gb|EGI13739.1| preprotein translocase, SecY subunit [Escherichia coli M605]
gb|EGI18986.1| preprotein translocase, SecY subunit [Escherichia coli M718]
gb|EGI24838.1| preprotein translocase, SecY subunit [Escherichia coli TA206]
gb|EGI29409.1| preprotein translocase, SecY subunit [Escherichia coli TA143]
gb|EGI34111.1| preprotein translocase, SecY subunit [Escherichia coli TA271]
gb|EGI39113.1| preprotein translocase, SecY subunit [Escherichia coli TA280]
gb|EGI43866.1| preprotein translocase, SecY subunit [Escherichia coli H591]
gb|EGI48525.1| preprotein translocase, SecY subunit [Escherichia coli H299]
gb|EGI90615.1| preprotein translocase subunit secY [Shigella boydii 5216-82]
gb|EGI91421.1| preprotein translocase subunit secY [Shigella dysenteriae 155-74]
gb|EGI95373.1| preprotein translocase subunit secY [Shigella boydii 3594-74]
gb|EGJ07553.1| preprotein translocase, SecY subunit [Escherichia coli D9]
gb|AEE58581.1| preprotein translocase subunit SecY [Escherichia coli UMNK88]
gb|EGJ80009.1| preprotein translocase subunit secY [Shigella flexneri K-671]
gb|EGJ80149.1| preprotein translocase subunit secY [Shigella flexneri 4343-70]
gb|EGJ81270.1| preprotein translocase subunit secY [Shigella flexneri 2747-71]
gb|EGJ93943.1| secY [Shigella flexneri 2930-71]
gb|EGK16129.1| preprotein translocase subunit secY [Shigella flexneri VA-6]
gb|EGK16373.1| preprotein translocase subunit secY [Shigella flexneri K-272]
gb|EGK16937.1| preprotein translocase subunit secY [Shigella flexneri K-218]
gb|EGK31780.1| preprotein translocase subunit secY [Shigella flexneri K-304]
gb|EGK32175.1| preprotein translocase subunit secY [Shigella flexneri K-227]
gb|EGM59618.1| secY [Shigella flexneri SFJ17B]
gb|AEJ58693.1| preprotein translocase subunit secY [Escherichia coli UMNF18]
gb|EGR61967.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
01-09591]
gb|EGR72647.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
LB226692]
gb|EGT69311.1| secY [Escherichia coli O104:H4 str. C227-11]
gb|EGU25666.1| preprotein translocase subunit SecY [Escherichia coli XH140A]
gb|EGU95720.1| preprotein translocase, SecY subunit [Escherichia coli MS 79-10]
gb|EGV46085.1| preprotein translocase subunit SecY [Escherichia coli XH001]
gb|EGW64931.1| preprotein translocase subunit secY [Escherichia coli STEC_C165-02]
gb|EGW65740.1| preprotein translocase subunit secY [Escherichia coli 2534-86]
gb|EGW67128.1| preprotein translocase subunit secY [Escherichia coli STEC_B2F1]
gb|EGW79845.1| preprotein translocase subunit secY [Escherichia coli STEC_94C]
gb|EGW81846.1| preprotein translocase subunit secY [Escherichia coli 3030-1]
gb|EGW92093.1| preprotein translocase subunit secY [Escherichia coli STEC_EH250]
gb|EGW99550.1| preprotein translocase subunit secY [Escherichia coli STEC_DG131-3]
gb|EGX03172.1| preprotein translocase subunit secY [Escherichia coli G58-1]
gb|EGX05402.1| preprotein translocase subunit secY [Escherichia coli STEC_H.1.8]
gb|EGX10693.1| preprotein translocase subunit secY [Escherichia coli STEC_MHI813]
gb|EGX15122.1| preprotein translocase subunit secY [Escherichia coli STEC_S1191]
gb|EGX21289.1| preprotein translocase subunit secY [Escherichia coli TX1999]
gb|AEQ14545.1| preprotein translocase membrane subunit [Escherichia coli O7:K1 str.
CE10]
gb|EHF19075.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
C236-11]
gb|EHF23514.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
C227-11]
gb|EHF24400.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
04-8351]
gb|EHF31513.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
09-7901]
gb|EHF38011.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-3677]
gb|EHF46836.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-4404]
gb|EHF50685.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-4522]
gb|EHF54957.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-4623]
gb|EHF66646.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-4632 C1]
gb|EHF69248.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-4632 C2]
gb|EHF71205.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-4632 C3]
gb|EHF73958.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-4632 C4]
gb|EHF81572.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-4632 C5]
gb|EHF99164.1| preprotein translocase, SecY subunit [Escherichia coli cloneA_i1]
gb|AER86276.1| preprotein translocase subunit SecY [Escherichia coli str. 'clone D
i2']
gb|AER91195.1| preprotein translocase subunit SecY [Escherichia coli str. 'clone D
i14']
dbj|BAL39930.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
substr. MDS42]
gb|EHN82503.1| preprotein translocase subunit secY [Escherichia coli H494]
gb|EHN85005.1| preprotein translocase subunit secY [Escherichia coli TA124]
gb|EHN93188.1| preprotein translocase subunit secY [Escherichia coli H397]
gb|EHN95567.1| preprotein translocase subunit secY [Escherichia coli E101]
gb|EHO04364.1| preprotein translocase subunit secY [Escherichia coli B093]
gb|EHP64830.1| preprotein translocase subunit SecY [Escherichia coli 4_1_47FAA]
gb|AEZ42393.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str.
RM12579]
gb|EHU05385.1| secY [Escherichia coli DEC1A]
gb|EHU05541.1| secY [Escherichia coli DEC1C]
gb|EHU08065.1| secY [Escherichia coli DEC1B]
gb|EHU19160.1| preprotein translocase subunit SecY [Escherichia coli DEC1D]
gb|EHU22174.1| secY [Escherichia coli DEC1E]
gb|EHU25323.1| preprotein translocase subunit SecY [Escherichia coli DEC2A]
gb|EHU35958.1| secY [Escherichia coli DEC2B]
gb|EHU38822.1| secY [Escherichia coli DEC2C]
gb|EHU40901.1| secY [Escherichia coli DEC2D]
gb|EHU51273.1| secY [Escherichia coli DEC2E]
gb|EHU54616.1| secY [Escherichia coli DEC3A]
gb|EHU56365.1| secY [Escherichia coli DEC3B]
gb|EHU64604.1| secY [Escherichia coli DEC3C]
gb|EHU69721.1| secY [Escherichia coli DEC3E]
gb|EHU71299.1| secY [Escherichia coli DEC3D]
gb|EHU84559.1| secY [Escherichia coli DEC4A]
gb|EHU91348.1| secY [Escherichia coli DEC4B]
gb|EHU98418.1| secY [Escherichia coli DEC3F]
gb|EHV00862.1| secY [Escherichia coli DEC4C]
gb|EHV02591.1| secY [Escherichia coli DEC4D]
gb|EHV09112.1| secY [Escherichia coli DEC4E]
gb|EHV16983.1| secY [Escherichia coli DEC4F]
gb|EHV21702.1| secY [Escherichia coli DEC5A]
gb|EHV26071.1| secY [Escherichia coli DEC5B]
gb|EHV34176.1| secY [Escherichia coli DEC5C]
gb|EHV35476.1| secY [Escherichia coli DEC5D]
gb|EHV43945.1| preprotein translocase subunit SecY [Escherichia coli DEC5E]
gb|EHV52909.1| secY [Escherichia coli DEC6B]
gb|EHV53779.1| preprotein translocase subunit SecY [Escherichia coli DEC6A]
gb|EHV56574.1| preprotein translocase subunit SecY [Escherichia coli DEC6C]
gb|EHV67664.1| preprotein translocase subunit SecY [Escherichia coli DEC6D]
gb|EHV70617.1| secY [Escherichia coli DEC6E]
gb|EHV75796.1| preprotein translocase subunit SecY [Escherichia coli DEC7A]
gb|EHV84167.1| secY [Escherichia coli DEC7C]
gb|EHV87896.1| secY [Escherichia coli DEC7D]
gb|EHV93006.1| secY [Escherichia coli DEC7B]
gb|EHV98371.1| preprotein translocase subunit SecY [Escherichia coli DEC7E]
gb|EHW06583.1| preprotein translocase subunit SecY [Escherichia coli DEC8A]
gb|EHW07366.1| secY [Escherichia coli DEC8B]
gb|EHW12327.1| secY [Escherichia coli DEC8C]
gb|EHW20755.1| secY [Escherichia coli DEC8D]
gb|EHW31845.1| secY [Escherichia coli DEC9A]
gb|EHW36637.1| secY [Escherichia coli DEC9B]
gb|EHW38292.1| secY [Escherichia coli DEC9C]
gb|EHW49213.1| secY [Escherichia coli DEC9D]
gb|EHW52889.1| secY [Escherichia coli DEC9E]
gb|EHW59231.1| secY [Escherichia coli DEC10A]
gb|EHW62790.1| secY [Escherichia coli DEC10B]
gb|EHW69297.1| secY [Escherichia coli DEC10C]
gb|EHW74038.1| secY [Escherichia coli DEC10D]
gb|EHW86252.1| secY [Escherichia coli DEC10E]
gb|EHW87611.1| secY [Escherichia coli DEC11A]
gb|EHW88240.1| secY [Escherichia coli DEC10F]
gb|EHX00248.1| secY [Escherichia coli DEC11B]
gb|EHX06717.1| preprotein translocase subunit SecY [Escherichia coli DEC11D]
gb|EHX08014.1| preprotein translocase subunit SecY [Escherichia coli DEC11C]
gb|EHX16312.1| preprotein translocase subunit SecY [Escherichia coli DEC11E]
gb|EHX23315.1| secY [Escherichia coli DEC12B]
gb|EHX27804.1| preprotein translocase subunit SecY [Escherichia coli DEC12C]
gb|EHX40370.1| secY [Escherichia coli DEC12D]
gb|EHX44400.1| secY [Escherichia coli DEC13A]
gb|EHX44569.1| secY [Escherichia coli DEC12E]
gb|EHX55761.1| secY [Escherichia coli DEC13D]
gb|EHX56954.1| secY [Escherichia coli DEC13C]
gb|EHX57833.1| secY [Escherichia coli DEC13B]
gb|EHX70652.1| secY [Escherichia coli DEC13E]
gb|EHX73819.1| preprotein translocase subunit SecY [Escherichia coli DEC14A]
gb|EHX76365.1| secY [Escherichia coli DEC14B]
gb|EHX84844.1| secY [Escherichia coli DEC14C]
gb|EHX88712.1| secY [Escherichia coli DEC14D]
gb|EHX95185.1| secY [Escherichia coli DEC15A]
gb|EHY00419.1| secY [Escherichia coli DEC15B]
gb|EHY04861.1| secY [Escherichia coli DEC15C]
gb|EHY12669.1| secY [Escherichia coli DEC15D]
gb|EHY17153.1| secY [Escherichia coli DEC15E]
gb|EIA34990.1| preprotein translocase subunit SecY [Escherichia coli SCI-07]
gb|AFG42220.1| Preprotein translocase subunit secY [Escherichia coli P12b]
gb|AFH16231.1| preprotein translocase subunit SecY [Escherichia coli KO11FL]
gb|AFH13128.1| preprotein translocase subunit SecY [Escherichia coli W]
gb|EID63605.1| preprotein translocase subunit SecY [Shigella flexneri 5a str. M90T]
gb|EID68208.1| preprotein translocase subunit SecY [Escherichia coli W26]
gb|EIE38940.1| preprotein translocase subunit SecY [Escherichia coli J53]
gb|EIE54689.1| preprotein translocase subunit SecY [Escherichia coli AI27]
gb|EIF15767.1| preprotein translocase subunit SecY [Escherichia coli O32:H37 str. P4]
gb|EIF84733.1| preprotein translocase subunit SecY [Escherichia coli M919]
gb|EIG46533.1| preprotein translocase subunit SecY [Escherichia coli H730]
gb|EIG46734.1| preprotein translocase subunit secY [Escherichia coli B799]
gb|EIG68670.1| preprotein translocase subunit SecY [Escherichia sp. 4_1_40B]
gb|EIG80790.1| preprotein translocase, SecY subunit [Escherichia coli 1.2741]
gb|EIG91082.1| preprotein translocase, SecY subunit [Escherichia coli 97.0246]
gb|EIH04338.1| preprotein translocase, SecY subunit [Escherichia coli 5.0588]
gb|EIH12218.1| preprotein translocase, SecY subunit [Escherichia coli 97.0259]
gb|EIH24982.1| preprotein translocase, SecY subunit [Escherichia coli 1.2264]
gb|EIH33325.1| preprotein translocase, SecY subunit [Escherichia coli 96.0497]
gb|EIH45296.1| preprotein translocase, SecY subunit [Escherichia coli 99.0741]
gb|EIH53844.1| preprotein translocase, SecY subunit [Escherichia coli 3.2608]
gb|EIH66582.1| preprotein translocase, SecY subunit [Escherichia coli 93.0624]
gb|EIH77561.1| preprotein translocase, SecY subunit [Escherichia coli 4.0522]
gb|EIH89785.1| preprotein translocase, SecY subunit [Escherichia coli JB1-95]
gb|EII00001.1| preprotein translocase, SecY subunit [Escherichia coli 96.154]
gb|EII12151.1| preprotein translocase, SecY subunit [Escherichia coli 5.0959]
gb|EII23114.1| preprotein translocase, SecY subunit [Escherichia coli 9.0111]
gb|EII44793.1| preprotein translocase, SecY subunit [Escherichia coli 2.3916]
gb|EII67517.1| preprotein translocase, SecY subunit [Escherichia coli 2.4168]
gb|EII78171.1| preprotein translocase, SecY subunit [Escherichia coli 3.2303]
gb|EII88464.1| preprotein translocase, SecY subunit [Escherichia coli 3003]
gb|EII96448.1| preprotein translocase, SecY subunit [Escherichia coli TW07793]
gb|EIJ04485.1| preprotein translocase, SecY subunit [Escherichia coli B41]
gb|EIJ15146.1| preprotein translocase, SecY subunit [Escherichia coli 900105 (10e)]
gb|AFJ30962.1| preprotein translocase subunit SecY [Escherichia coli Xuzhou21]
gb|EIL01868.1| preprotein translocase subunit SecY [Escherichia coli O103:H2 str.
CVM9450]
gb|EIL01999.1| preprotein translocase subunit SecY [Escherichia coli O111:H11 str.
CVM9534]
gb|EIL07295.1| preprotein translocase subunit SecY [Escherichia coli O103:H25 str.
CVM9340]
gb|EIL14320.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
CVM9570]
gb|EIL20018.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
CVM9574]
gb|EIL31331.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CVM9942]
gb|EIL40647.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CVM10026]
gb|EIL51052.1| preprotein translocase subunit SecY [Escherichia coli KD2]
gb|EIL53104.1| preprotein translocase subunit SecY [Escherichia coli KD1]
gb|EIL58868.1| preprotein translocase subunit SecY [Escherichia coli 541-15]
gb|EIL64616.1| preprotein translocase subunit SecY [Escherichia coli 75]
gb|EIL69313.1| preprotein translocase subunit SecY [Escherichia coli 541-1]
gb|EIL70375.1| preprotein translocase subunit SecY [Escherichia coli 576-1]
gb|EIL79092.1| preprotein translocase subunit SecY [Escherichia coli CUMT8]
gb|EIL79254.1| preprotein translocase subunit SecY [Escherichia coli HM605]
gb|EIN18294.1| preprotein translocase, SecY subunit [Escherichia coli FRIK1996]
gb|EIN19937.1| preprotein translocase, SecY subunit [Escherichia coli FDA517]
gb|EIN20120.1| preprotein translocase, SecY subunit [Escherichia coli FDA505]
gb|EIN35937.1| preprotein translocase, SecY subunit [Escherichia coli FRIK1985]
gb|EIN35993.1| preprotein translocase, SecY subunit [Escherichia coli 93-001]
gb|EIN38882.1| preprotein translocase, SecY subunit [Escherichia coli FRIK1990]
gb|EIN51411.1| preprotein translocase, SecY subunit [Escherichia coli PA3]
gb|EIN54535.1| preprotein translocase, SecY subunit [Escherichia coli PA5]
gb|EIN57992.1| preprotein translocase, SecY subunit [Escherichia coli PA9]
gb|EIN68267.1| preprotein translocase, SecY subunit [Escherichia coli PA10]
gb|EIN72517.1| preprotein translocase, SecY subunit [Escherichia coli PA14]
gb|EIN73216.1| preprotein translocase, SecY subunit [Escherichia coli PA15]
gb|EIN85341.1| preprotein translocase, SecY subunit [Escherichia coli PA22]
gb|EIN92051.1| preprotein translocase, SecY subunit [Escherichia coli PA25]
gb|EIN93991.1| preprotein translocase, SecY subunit [Escherichia coli PA24]
gb|EIN97844.1| preprotein translocase, SecY subunit [Escherichia coli PA28]
gb|EIO10060.1| preprotein translocase, SecY subunit [Escherichia coli PA31]
gb|EIO10756.1| preprotein translocase, SecY subunit [Escherichia coli PA32]
gb|EIO13865.1| preprotein translocase, SecY subunit [Escherichia coli PA33]
gb|EIO25721.1| preprotein translocase, SecY subunit [Escherichia coli PA40]
gb|EIO32832.1| preprotein translocase, SecY subunit [Escherichia coli PA39]
gb|EIO33977.1| preprotein translocase, SecY subunit [Escherichia coli PA41]
gb|EIO35521.1| preprotein translocase, SecY subunit [Escherichia coli PA42]
gb|EIO47302.1| preprotein translocase, SecY subunit [Escherichia coli TW06591]
gb|EIO54846.1| preprotein translocase, SecY subunit [Escherichia coli TW07945]
gb|EIO55275.1| preprotein translocase, SecY subunit [Escherichia coli TW10246]
gb|EIO61376.1| preprotein translocase, SecY subunit [Escherichia coli TW11039]
gb|EIO69372.1| preprotein translocase, SecY subunit [Escherichia coli TW09098]
gb|EIO71617.1| preprotein translocase, SecY subunit [Escherichia coli TW09109]
gb|EIO80807.1| preprotein translocase, SecY subunit [Escherichia coli TW10119]
gb|EIO89769.1| preprotein translocase, SecY subunit [Escherichia coli EC4203]
gb|EIO91331.1| preprotein translocase, SecY subunit [Escherichia coli TW09195]
gb|EIO94308.1| preprotein translocase, SecY subunit [Escherichia coli EC4196]
gb|EIP06840.1| preprotein translocase, SecY subunit [Escherichia coli O157:H7 str.
TW14313]
gb|EIP07735.1| preprotein translocase, SecY subunit [Escherichia coli TW14301]
gb|EIP12099.1| preprotein translocase, SecY subunit [Escherichia coli EC4421]
gb|EIP21468.1| preprotein translocase, SecY subunit [Escherichia coli EC4422]
gb|EIP25640.1| preprotein translocase, SecY subunit [Escherichia coli EC4013]
gb|EIP29842.1| preprotein translocase, SecY subunit [Escherichia coli EC4402]
gb|EIP37219.1| preprotein translocase, SecY subunit [Escherichia coli EC4439]
gb|EIP42183.1| preprotein translocase, SecY subunit [Escherichia coli EC4436]
gb|EIP51088.1| preprotein translocase, SecY subunit [Escherichia coli EC4437]
gb|EIP53058.1| preprotein translocase, SecY subunit [Escherichia coli EC4448]
gb|EIP57468.1| preprotein translocase, SecY subunit [Escherichia coli EC1738]
gb|EIP65498.1| preprotein translocase, SecY subunit [Escherichia coli EC1734]
gb|EIP75253.1| preprotein translocase, SecY subunit [Escherichia coli EC1863]
gb|EIP75973.1| preprotein translocase, SecY subunit [Escherichia coli EC1845]
gb|EIQ02500.1| preprotein translocase subunit SecY [Shigella flexneri K-1770]
gb|EIQ03500.1| preprotein translocase subunit SecY [Shigella flexneri 2850-71]
gb|EIQ07486.1| preprotein translocase subunit SecY [Shigella flexneri CCH060]
gb|EIQ16325.1| preprotein translocase subunit SecY [Shigella flexneri K-315]
gb|EIQ20383.1| preprotein translocase subunit SecY [Shigella flexneri K-404]
gb|EIQ25666.1| preprotein translocase subunit SecY [Shigella boydii 965-58]
gb|EIQ33291.1| preprotein translocase subunit SecY [Shigella boydii 4444-74]
gb|EIQ56560.1| preprotein translocase subunit SecY [Shigella dysenteriae 225-75]
gb|EIQ60740.1| preprotein translocase subunit SecY [Escherichia coli EPECa12]
gb|EIQ67904.1| secY [Escherichia coli EPEC C342-62]
gb|EJE63343.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
CVM9602]
gb|EJE65605.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
CVM9634]
gb|EJE68919.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CVM10224]
gb|EJE74959.1| preprotein translocase subunit SecY [Escherichia coli O111:H11 str.
CVM9553]
gb|EJE77715.1| hypothetical protein ECO10021_28827 [Escherichia coli O26:H11 str.
CVM10021]
gb|EJE79457.1| preprotein translocase subunit SecY [Escherichia coli O111:H11 str.
CVM9455]
gb|EJE90757.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CVM10030]
gb|EJE93301.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CVM9952]
gb|EJK94502.1| preprotein translocase subunit secY [Escherichia coli STEC_O31]
gb|EJL10280.1| secY [Shigella flexneri 6603-63]
gb|EJZ61373.1| secY [Shigella flexneri 1485-80]
gb|AFS55228.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
2009EL-2050]
gb|AFS72429.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
2011C-3493]
gb|AFS88345.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
2009EL-2071]
gb|EKG96648.1| preprotein translocase, SecY subunit [Escherichia coli PA7]
gb|EKG99001.1| preprotein translocase, SecY subunit [Escherichia coli FRIK920]
gb|EKH02036.1| preprotein translocase, SecY subunit [Escherichia coli PA34]
gb|EKH11708.1| preprotein translocase, SecY subunit [Escherichia coli FDA506]
gb|EKH15018.1| preprotein translocase, SecY subunit [Escherichia coli FDA507]
gb|EKH22773.1| preprotein translocase, SecY subunit [Escherichia coli FDA504]
gb|EKH28515.1| preprotein translocase, SecY subunit [Escherichia coli FRIK1999]
gb|EKH34365.1| preprotein translocase, SecY subunit [Escherichia coli FRIK1997]
gb|EKH38651.1| preprotein translocase, SecY subunit [Escherichia coli NE1487]
gb|EKH44948.1| preprotein translocase, SecY subunit [Escherichia coli NE037]
gb|EKH50582.1| preprotein translocase, SecY subunit [Escherichia coli FRIK2001]
gb|EKH56258.1| preprotein translocase, SecY subunit [Escherichia coli PA4]
gb|EKH65281.1| preprotein translocase, SecY subunit [Escherichia coli PA23]
gb|EKH68014.1| preprotein translocase, SecY subunit [Escherichia coli PA49]
gb|EKH73964.1| preprotein translocase, SecY subunit [Escherichia coli PA45]
gb|EKH81457.1| preprotein translocase, SecY subunit [Escherichia coli TT12B]
gb|EKH86274.1| preprotein translocase, SecY subunit [Escherichia coli MA6]
gb|EKH90024.1| preprotein translocase, SecY subunit [Escherichia coli 5905]
gb|EKH98529.1| preprotein translocase, SecY subunit [Escherichia coli CB7326]
gb|EKI04846.1| preprotein translocase, SecY subunit [Escherichia coli EC96038]
gb|EKI07886.1| preprotein translocase, SecY subunit [Escherichia coli 5412]
gb|EKI16550.1| preprotein translocase, SecY subunit [Escherichia coli TW15901]
gb|EKI23954.1| preprotein translocase, SecY subunit [Escherichia coli ARS4.2123]
gb|EKI24870.1| preprotein translocase, SecY subunit [Escherichia coli TW00353]
gb|EKI34997.1| preprotein translocase, SecY subunit [Escherichia coli 3006]
gb|EKI35874.1| preprotein translocase, SecY subunit [Escherichia coli 07798]
gb|EKI39154.1| preprotein translocase, SecY subunit [Escherichia coli PA38]
gb|EKI48698.1| preprotein translocase, SecY subunit [Escherichia coli EC1735]
gb|EKI49941.1| preprotein translocase, SecY subunit [Escherichia coli N1]
gb|EKI59070.1| preprotein translocase, SecY subunit [Escherichia coli EC1736]
gb|EKI62646.1| preprotein translocase, SecY subunit [Escherichia coli EC1737]
gb|EKI66926.1| preprotein translocase, SecY subunit [Escherichia coli EC1846]
gb|EKI74876.1| preprotein translocase, SecY subunit [Escherichia coli EC1847]
gb|EKI78467.1| preprotein translocase, SecY subunit [Escherichia coli EC1848]
gb|EKI84567.1| preprotein translocase, SecY subunit [Escherichia coli EC1849]
gb|EKI92384.1| preprotein translocase, SecY subunit [Escherichia coli EC1850]
gb|EKI95180.1| preprotein translocase, SecY subunit [Escherichia coli EC1856]
gb|EKJ02740.1| preprotein translocase, SecY subunit [Escherichia coli EC1862]
gb|EKJ08129.1| preprotein translocase, SecY subunit [Escherichia coli EC1864]
gb|EKJ12721.1| preprotein translocase, SecY subunit [Escherichia coli EC1865]
gb|EKJ22661.1| preprotein translocase, SecY subunit [Escherichia coli EC1868]
gb|EKJ23359.1| preprotein translocase, SecY subunit [Escherichia coli EC1866]
gb|EKJ33139.1| preprotein translocase, SecY subunit [Escherichia coli EC1869]
gb|EKJ38433.1| preprotein translocase, SecY subunit [Escherichia coli EC1870]
gb|EKJ40677.1| preprotein translocase, SecY subunit [Escherichia coli NE098]
gb|EKJ49729.1| preprotein translocase, SecY subunit [Escherichia coli FRIK523]
gb|EKJ56057.1| preprotein translocase, SecY subunit [Escherichia coli 0.1288]
gb|EKJ58660.1| preprotein translocase, SecY subunit [Escherichia coli 0.1304]
gb|EKJ80732.1| preprotein translocase subunit SecY [Escherichia coli AD30]
gb|EKK24214.1| preprotein translocase, SecY subunit [Escherichia coli 5.2239]
gb|EKK24325.1| preprotein translocase, SecY subunit [Escherichia coli 3.4870]
gb|EKK25301.1| preprotein translocase, SecY subunit [Escherichia coli 6.0172]
gb|EKK41165.1| preprotein translocase, SecY subunit [Escherichia coli 8.0566]
gb|EKK41292.1| preprotein translocase, SecY subunit [Escherichia coli 8.0586]
gb|EKK42445.1| preprotein translocase, SecY subunit [Escherichia coli 8.0569]
gb|EKK52413.1| preprotein translocase, SecY subunit [Escherichia coli 10.0833]
gb|EKK54921.1| preprotein translocase, SecY subunit [Escherichia coli 8.2524]
gb|EKK63852.1| preprotein translocase, SecY subunit [Escherichia coli 10.0869]
gb|EKK69188.1| preprotein translocase, SecY subunit [Escherichia coli 88.0221]
gb|EKK71209.1| preprotein translocase, SecY subunit [Escherichia coli 8.0416]
gb|EKK81686.1| preprotein translocase, SecY subunit [Escherichia coli 10.0821]
emb|CCK48604.1| putative ATPase subunit of translocase [Escherichia coli chi7122]
emb|CCJ45917.1| putative ATPase subunit of translocase [Escherichia coli]
gb|EKT90993.1| preprotein translocase subunit SecY [Escherichia coli O111:H11 str.
CFSAN001630]
gb|EKU00410.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
CFSAN001632]
gb|EKU01432.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
CFSAN001629]
gb|EKV71542.1| preprotein translocase, SecY subunit [Escherichia coli 89.0511]
gb|EKV72682.1| preprotein translocase, SecY subunit [Escherichia coli 88.1042]
gb|EKV76478.1| preprotein translocase, SecY subunit [Escherichia coli 88.1467]
gb|EKV87768.1| preprotein translocase, SecY subunit [Escherichia coli 90.0091]
gb|EKV90922.1| preprotein translocase, SecY subunit [Escherichia coli 90.2281]
gb|EKV94189.1| preprotein translocase, SecY subunit [Escherichia coli 90.0039]
gb|EKW06875.1| preprotein translocase, SecY subunit [Escherichia coli 93.0056]
gb|EKW07248.1| preprotein translocase, SecY subunit [Escherichia coli 93.0055]
gb|EKW11190.1| preprotein translocase, SecY subunit [Escherichia coli 94.0618]
gb|EKW23507.1| preprotein translocase, SecY subunit [Escherichia coli 95.1288]
gb|EKW24176.1| preprotein translocase, SecY subunit [Escherichia coli 95.0183]
gb|EKW25268.1| preprotein translocase, SecY subunit [Escherichia coli 95.0943]
gb|EKW39113.1| preprotein translocase, SecY subunit [Escherichia coli 96.0428]
gb|EKW41670.1| preprotein translocase, SecY subunit [Escherichia coli 96.0427]
gb|EKW45766.1| preprotein translocase, SecY subunit [Escherichia coli 96.0939]
gb|EKW53381.1| preprotein translocase, SecY subunit [Escherichia coli 96.0932]
gb|EKW59697.1| preprotein translocase, SecY subunit [Escherichia coli 96.0107]
gb|EKW60110.1| preprotein translocase, SecY subunit [Escherichia coli 97.0003]
gb|EKW71804.1| preprotein translocase, SecY subunit [Escherichia coli 97.1742]
gb|EKW74881.1| preprotein translocase, SecY subunit [Escherichia coli 97.0007]
gb|EKW79076.1| preprotein translocase, SecY subunit [Escherichia coli 99.0672]
gb|EKW85997.1| preprotein translocase, SecY subunit [Escherichia coli 99.0678]
gb|EKW87678.1| preprotein translocase, SecY subunit [Escherichia coli 99.0713]
gb|EKY36432.1| preprotein translocase, SecY subunit [Escherichia coli 96.0109]
gb|EKY37633.1| preprotein translocase, SecY subunit [Escherichia coli 97.0010]
gb|EKY83477.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-02092]
gb|EKY93352.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-02033-1]
gb|EKY94225.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-02030]
gb|EKZ09393.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-02093]
gb|EKZ11324.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-02281]
gb|EKZ13936.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-02318]
gb|EKZ25072.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-02913]
gb|EKZ27820.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
11-03439]
gb|EKZ28826.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-03943]
gb|EKZ38239.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
11-04080]
gb|EKZ39284.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
Ec11-9990]
gb|EKZ42881.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-9450]
gb|EKZ50841.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-4984]
gb|EKZ54283.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-4986]
gb|EKZ60530.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-4987]
gb|EKZ64308.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
Ec11-4988]
gb|EKZ69322.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-5603]
gb|EKZ76227.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-5604]
gb|EKZ81089.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec12-0465]
gb|EKZ84990.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-6006]
gb|EKZ90597.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
Ec12-0466]
gb|EKZ94666.1| preprotein translocase subunit secY [Escherichia coli O104:H4 str.
Ec11-9941]
gb|ELB96345.1| preprotein translocase subunit secY [Escherichia coli KTE2]
gb|ELB97622.1| preprotein translocase subunit secY [Escherichia coli KTE4]
gb|ELC06391.1| preprotein translocase subunit secY [Escherichia coli KTE5]
gb|ELC14076.1| preprotein translocase subunit secY [Escherichia coli KTE10]
gb|ELC18353.1| preprotein translocase subunit secY [Escherichia coli KTE12]
gb|ELC25321.1| preprotein translocase subunit SecY [Escherichia coli KTE15]
gb|ELC26233.1| preprotein translocase subunit secY [Escherichia coli KTE16]
gb|ELC34250.1| preprotein translocase subunit secY [Escherichia coli KTE25]
gb|ELC36188.1| preprotein translocase subunit secY [Escherichia coli KTE21]
gb|ELC43819.1| preprotein translocase subunit SecY [Escherichia coli KTE26]
gb|ELC47807.1| preprotein translocase subunit secY [Escherichia coli KTE28]
gb|ELC53757.1| preprotein translocase subunit SecY [Escherichia coli KTE39]
gb|ELC56868.1| preprotein translocase subunit SecY [Escherichia coli KTE44]
gb|ELC62188.1| preprotein translocase subunit secY [Escherichia coli KTE178]
gb|ELC69916.1| preprotein translocase subunit SecY [Escherichia coli KTE187]
gb|ELC70976.1| preprotein translocase subunit SecY [Escherichia coli KTE181]
gb|ELC78714.1| preprotein translocase subunit secY [Escherichia coli KTE188]
gb|ELC81407.1| preprotein translocase subunit secY [Escherichia coli KTE189]
gb|ELC88007.1| preprotein translocase subunit secY [Escherichia coli KTE191]
gb|ELC94784.1| preprotein translocase subunit secY [Escherichia coli KTE193]
gb|ELC96643.1| preprotein translocase subunit secY [Escherichia coli KTE201]
gb|ELD02480.1| preprotein translocase subunit secY [Escherichia coli KTE204]
gb|ELD07636.1| preprotein translocase subunit SecY [Escherichia coli KTE205]
gb|ELD11928.1| preprotein translocase subunit secY [Escherichia coli KTE206]
gb|ELD17746.1| preprotein translocase subunit SecY [Escherichia coli KTE208]
gb|ELD19463.1| preprotein translocase subunit SecY [Escherichia coli KTE210]
gb|ELD27492.1| preprotein translocase subunit SecY [Escherichia coli KTE212]
gb|ELD31658.1| preprotein translocase subunit secY [Escherichia coli KTE213]
gb|ELD34278.1| preprotein translocase subunit secY [Escherichia coli KTE214]
gb|ELD39109.1| preprotein translocase subunit secY [Escherichia coli KTE216]
gb|ELD46903.1| preprotein translocase subunit secY [Escherichia coli KTE220]
gb|ELD49282.1| preprotein translocase subunit secY [Escherichia coli KTE224]
gb|ELD57725.1| preprotein translocase subunit SecY [Escherichia coli KTE228]
gb|ELD58706.1| preprotein translocase subunit SecY [Escherichia coli KTE230]
gb|ELD67316.1| preprotein translocase subunit secY [Escherichia coli KTE234]
gb|ELD70099.1| preprotein translocase subunit secY [Escherichia coli KTE233]
gb|ELD75671.1| preprotein translocase subunit secY [Escherichia coli KTE235]
gb|ELD79615.1| preprotein translocase subunit SecY [Escherichia coli KTE236]
gb|ELD84666.1| preprotein translocase subunit secY [Escherichia coli KTE237]
gb|ELD87807.1| preprotein translocase subunit secY [Escherichia coli KTE47]
gb|ELD94499.1| preprotein translocase subunit secY [Escherichia coli KTE49]
gb|ELD96031.1| preprotein translocase subunit secY [Escherichia coli KTE51]
gb|ELE02928.1| preprotein translocase subunit SecY [Escherichia coli KTE53]
gb|ELE09178.1| preprotein translocase subunit secY [Escherichia coli KTE55]
gb|ELE16303.1| preprotein translocase subunit secY [Escherichia coli KTE56]
gb|ELE18252.1| preprotein translocase subunit secY [Escherichia coli KTE57]
gb|ELE28305.1| preprotein translocase subunit SecY [Escherichia coli KTE60]
gb|ELE30547.1| preprotein translocase subunit secY [Escherichia coli KTE62]
gb|ELE37520.1| preprotein translocase subunit SecY [Escherichia coli KTE67]
gb|ELE39350.1| preprotein translocase subunit secY [Escherichia coli KTE66]
gb|ELE47764.1| preprotein translocase subunit secY [Escherichia coli KTE72]
gb|ELE52601.1| preprotein translocase subunit secY [Escherichia coli KTE75]
gb|ELE57250.1| preprotein translocase subunit secY [Escherichia coli KTE76]
gb|ELE61299.1| preprotein translocase subunit secY [Escherichia coli KTE77]
gb|ELE67614.1| preprotein translocase subunit SecY [Escherichia coli KTE80]
gb|ELE69055.1| preprotein translocase subunit SecY [Escherichia coli KTE81]
gb|ELE77536.1| preprotein translocase subunit secY [Escherichia coli KTE83]
gb|ELE77859.1| preprotein translocase subunit secY [Escherichia coli KTE86]
gb|ELE86809.1| preprotein translocase subunit secY [Escherichia coli KTE87]
gb|ELE87146.1| preprotein translocase subunit secY [Escherichia coli KTE93]
gb|ELE95953.1| preprotein translocase subunit secY [Escherichia coli KTE111]
gb|ELE96511.1| preprotein translocase subunit secY [Escherichia coli KTE116]
gb|ELF06392.1| preprotein translocase subunit secY [Escherichia coli KTE119]
gb|ELF09606.1| preprotein translocase subunit secY [Escherichia coli KTE142]
gb|ELF15145.1| preprotein translocase subunit secY [Escherichia coli KTE143]
gb|ELF16942.1| preprotein translocase subunit secY [Escherichia coli KTE156]
gb|ELF27152.1| preprotein translocase subunit SecY [Escherichia coli KTE162]
gb|ELF31086.1| preprotein translocase subunit secY [Escherichia coli KTE161]
gb|ELF34390.1| preprotein translocase subunit secY [Escherichia coli KTE169]
gb|ELF35162.1| preprotein translocase subunit secY [Escherichia coli KTE171]
gb|ELF46590.1| preprotein translocase subunit secY [Escherichia coli KTE8]
gb|ELF48430.1| preprotein translocase subunit secY [Escherichia coli KTE6]
gb|ELF52554.1| preprotein translocase subunit secY [Escherichia coli KTE9]
gb|ELF53974.1| preprotein translocase subunit SecY [Escherichia coli KTE17]
gb|ELF62304.1| preprotein translocase subunit SecY [Escherichia coli KTE18]
gb|ELF63062.1| preprotein translocase subunit SecY [Escherichia coli KTE45]
gb|ELF70771.1| preprotein translocase subunit secY [Escherichia coli KTE42]
gb|ELF72095.1| preprotein translocase subunit SecY [Escherichia coli KTE23]
gb|ELF79920.1| preprotein translocase subunit secY [Escherichia coli KTE43]
gb|ELF83989.1| preprotein translocase subunit secY [Escherichia coli KTE29]
gb|ELF89335.1| preprotein translocase subunit secY [Escherichia coli KTE22]
gb|ELF94756.1| preprotein translocase subunit secY [Escherichia coli KTE46]
gb|ELF95583.1| preprotein translocase subunit secY [Escherichia coli KTE48]
gb|ELG09666.1| preprotein translocase subunit secY [Escherichia coli KTE50]
gb|ELG11494.1| preprotein translocase subunit secY [Escherichia coli KTE54]
gb|ELG12116.1| preprotein translocase subunit SecY [Escherichia coli KTE59]
gb|ELG13691.1| preprotein translocase subunit secY [Escherichia coli KTE63]
gb|ELG22321.1| preprotein translocase subunit secY [Escherichia coli KTE65]
gb|ELG24090.1| preprotein translocase subunit secY [Escherichia coli KTE78]
gb|ELG36090.1| preprotein translocase subunit SecY [Escherichia coli KTE79]
gb|ELG39748.1| preprotein translocase subunit secY [Escherichia coli KTE91]
gb|ELG46795.1| preprotein translocase subunit SecY [Escherichia coli KTE101]
gb|ELG48046.1| preprotein translocase subunit secY [Escherichia coli KTE115]
gb|ELG51974.1| preprotein translocase subunit secY [Escherichia coli KTE118]
gb|ELG63706.1| preprotein translocase subunit SecY [Escherichia coli KTE123]
gb|ELG66688.1| preprotein translocase subunit secY [Escherichia coli KTE136]
gb|ELG67138.1| preprotein translocase subunit SecY [Escherichia coli KTE135]
gb|ELG70289.1| preprotein translocase subunit SecY [Escherichia coli KTE140]
gb|ELG76186.1| preprotein translocase subunit secY [Escherichia coli KTE141]
gb|ELG81219.1| preprotein translocase subunit secY [Escherichia coli KTE144]
gb|ELG85415.1| preprotein translocase subunit secY [Escherichia coli KTE146]
gb|ELG91953.1| preprotein translocase subunit secY [Escherichia coli KTE147]
gb|ELG96734.1| preprotein translocase subunit secY [Escherichia coli KTE158]
gb|ELH00479.1| preprotein translocase subunit secY [Escherichia coli KTE154]
gb|ELH05646.1| preprotein translocase subunit SecY [Escherichia coli KTE192]
gb|ELH09913.1| preprotein translocase subunit SecY [Escherichia coli KTE194]
gb|ELH12818.1| preprotein translocase subunit secY [Escherichia coli KTE165]
gb|ELH17039.1| preprotein translocase subunit SecY [Escherichia coli KTE173]
gb|ELH17546.1| preprotein translocase subunit secY [Escherichia coli KTE190]
gb|ELH21898.1| preprotein translocase subunit SecY [Escherichia coli KTE175]
gb|ELH34420.1| preprotein translocase subunit SecY [Escherichia coli KTE196]
gb|ELH40293.1| preprotein translocase subunit secY [Escherichia coli KTE183]
gb|ELH41007.1| preprotein translocase subunit SecY [Escherichia coli KTE184]
gb|ELH44838.1| preprotein translocase subunit SecY [Escherichia coli KTE197]
gb|ELH50265.1| preprotein translocase subunit secY [Escherichia coli KTE202]
gb|ELH56956.1| preprotein translocase subunit SecY [Escherichia coli KTE203]
gb|ELH58666.1| preprotein translocase subunit SecY [Escherichia coli KTE207]
gb|ELH65965.1| preprotein translocase subunit secY [Escherichia coli KTE209]
gb|ELH68969.1| preprotein translocase subunit SecY [Escherichia coli KTE211]
gb|ELH71153.1| preprotein translocase subunit secY [Escherichia coli KTE217]
gb|ELH73981.1| preprotein translocase subunit SecY [Escherichia coli KTE215]
gb|ELH81544.1| preprotein translocase subunit secY [Escherichia coli KTE218]
gb|ELH83264.1| preprotein translocase subunit SecY [Escherichia coli KTE223]
gb|ELH88573.1| preprotein translocase subunit SecY [Escherichia coli KTE227]
gb|ELH98667.1| preprotein translocase subunit secY [Escherichia coli KTE229]
gb|ELI03987.1| preprotein translocase subunit secY [Escherichia coli KTE104]
gb|ELI04779.1| preprotein translocase subunit secY [Escherichia coli KTE105]
gb|ELI08890.1| preprotein translocase subunit SecY [Escherichia coli KTE106]
gb|ELI16410.1| preprotein translocase subunit SecY [Escherichia coli KTE109]
gb|ELI21869.1| preprotein translocase subunit SecY [Escherichia coli KTE112]
gb|ELI23293.1| preprotein translocase subunit secY [Escherichia coli KTE113]
gb|ELI27771.1| preprotein translocase subunit SecY [Escherichia coli KTE117]
gb|ELI35869.1| preprotein translocase subunit secY [Escherichia coli KTE120]
gb|ELI39741.1| preprotein translocase subunit SecY [Escherichia coli KTE124]
gb|ELI40256.1| preprotein translocase subunit SecY [Escherichia coli KTE122]
gb|ELI51377.1| preprotein translocase subunit secY [Escherichia coli KTE125]
gb|ELI52746.1| preprotein translocase subunit SecY [Escherichia coli KTE128]
gb|ELI56292.1| preprotein translocase subunit SecY [Escherichia coli KTE129]
gb|ELI64605.1| preprotein translocase subunit SecY [Escherichia coli KTE131]
gb|ELI68289.1| preprotein translocase subunit SecY [Escherichia coli KTE133]
gb|ELI71839.1| preprotein translocase subunit secY [Escherichia coli KTE137]
gb|ELI77385.1| preprotein translocase subunit secY [Escherichia coli KTE138]
gb|ELI82329.1| preprotein translocase subunit SecY [Escherichia coli KTE139]
gb|ELI85708.1| preprotein translocase subunit secY [Escherichia coli KTE145]
gb|ELI93271.1| preprotein translocase subunit secY [Escherichia coli KTE148]
gb|ELI94338.1| preprotein translocase subunit SecY [Escherichia coli KTE150]
gb|ELI99836.1| preprotein translocase subunit SecY [Escherichia coli KTE153]
gb|ELJ07436.1| preprotein translocase subunit secY [Escherichia coli KTE157]
gb|ELJ09173.1| preprotein translocase subunit secY [Escherichia coli KTE160]
gb|ELJ11613.1| preprotein translocase subunit secY [Escherichia coli KTE163]
gb|ELJ21156.1| preprotein translocase subunit secY [Escherichia coli KTE166]
gb|ELJ23962.1| preprotein translocase subunit SecY [Escherichia coli KTE167]
gb|ELJ25690.1| preprotein translocase subunit secY [Escherichia coli KTE168]
gb|ELJ34377.1| preprotein translocase subunit secY [Escherichia coli KTE174]
gb|ELJ37449.1| preprotein translocase subunit secY [Escherichia coli KTE176]
gb|ELJ40887.1| preprotein translocase subunit secY [Escherichia coli KTE177]
gb|ELJ49999.1| preprotein translocase subunit secY [Escherichia coli KTE179]
gb|ELJ50659.1| preprotein translocase subunit SecY [Escherichia coli KTE180]
gb|ELJ55119.1| preprotein translocase subunit secY [Escherichia coli KTE232]
gb|ELJ63469.1| preprotein translocase subunit secY [Escherichia coli KTE82]
gb|ELJ67698.1| preprotein translocase subunit SecY [Escherichia coli KTE88]
gb|ELJ67759.1| preprotein translocase subunit secY [Escherichia coli KTE85]
gb|ELJ77841.1| preprotein translocase subunit secY [Escherichia coli KTE90]
gb|ELJ81044.1| preprotein translocase subunit SecY [Escherichia coli KTE95]
gb|ELJ82414.1| preprotein translocase subunit secY [Escherichia coli KTE94]
gb|ELJ92237.1| preprotein translocase subunit secY [Escherichia coli KTE97]
gb|ELJ96021.1| preprotein translocase subunit secY [Escherichia coli KTE99]
gb|ELL40397.1| preprotein translocase subunit SecY [Escherichia coli J96]
emb|CCP96022.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
O10:K5(L):H4 str. ATCC 23506]
emb|CCQ02541.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
O5:K4(L):H4 str. ATCC 23502]
emb|CCQ08211.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
Nissle 1917]
gb|AGC88775.1| preprotein translocase subunit SecY [Escherichia coli APEC O78]
gb|ELV14924.1| preprotein translocase, SecY subunit [Escherichia coli 99.0814]
gb|ELV17527.1| preprotein translocase, SecY subunit [Escherichia coli 09BKT078844]
gb|ELV23327.1| preprotein translocase, SecY subunit [Escherichia coli 99.0815]
gb|ELV31865.1| preprotein translocase, SecY subunit [Escherichia coli 99.0816]
gb|ELV32952.1| preprotein translocase, SecY subunit [Escherichia coli 99.0839]
gb|ELV37927.1| preprotein translocase, SecY subunit [Escherichia coli 99.0848]
gb|ELV45236.1| preprotein translocase, SecY subunit [Escherichia coli 99.1753]
gb|ELV51543.1| preprotein translocase, SecY subunit [Escherichia coli 99.1793]
gb|ELV61978.1| preprotein translocase, SecY subunit [Escherichia coli 99.1775]
gb|ELV64453.1| preprotein translocase, SecY subunit [Escherichia coli ATCC 700728]
gb|ELV65924.1| preprotein translocase, SecY subunit [Escherichia coli PA11]
gb|ELV66608.1| preprotein translocase, SecY subunit [Escherichia coli 99.1805]
gb|ELV79674.1| preprotein translocase, SecY subunit [Escherichia coli PA19]
gb|ELV86227.1| preprotein translocase, SecY subunit [Escherichia coli PA2]
gb|ELV90938.1| preprotein translocase, SecY subunit [Escherichia coli PA13]
gb|ELV92297.1| preprotein translocase, SecY subunit [Escherichia coli PA48]
gb|ELV93249.1| preprotein translocase, SecY subunit [Escherichia coli PA47]
gb|ELW08582.1| preprotein translocase, SecY subunit [Escherichia coli 7.1982]
gb|ELW12004.1| preprotein translocase, SecY subunit [Escherichia coli 99.1781]
gb|ELW12838.1| preprotein translocase, SecY subunit [Escherichia coli PA8]
gb|ELW15283.1| preprotein translocase, SecY subunit [Escherichia coli 99.1762]
gb|ELW23845.1| preprotein translocase, SecY subunit [Escherichia coli PA35]
gb|ELW26552.1| preprotein translocase, SecY subunit [Escherichia coli 3.4880]
gb|ELW33223.1| preprotein translocase, SecY subunit [Escherichia coli 95.0083]
gb|ELW46766.1| preprotein translocase, SecY subunit [Escherichia coli 99.0670]
gb|EMD04609.1| preprotein translocase subunit SecY [Escherichia coli O08]
gb|EMD05833.1| preprotein translocase subunit SecY [Escherichia coli S17]
gb|EMD07523.1| preprotein translocase subunit SecY [Escherichia coli SEPT362]
gb|EMR93150.1| preprotein translocase membrane subunit [Escherichia coli ONT:H33 str.
C48/93]
gb|EMR96911.1| preprotein translocase membrane subunit [Escherichia coli O104:H4 str.
E92/11]
gb|EMR99471.1| preprotein translocase membrane subunit [Escherichia coli O104:H4 str.
E112/10]
gb|EMS02868.1| preprotein translocase membrane subunit [Escherichia coli O127:H27 str.
C43/90]
gb|EMU58628.1| preprotein translocase, SecY subunit [Escherichia coli MP021552.7]
gb|EMU58911.1| preprotein translocase, SecY subunit [Escherichia coli MP021552.11]
gb|EMU76559.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.6]
gb|EMU79015.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.5]
gb|EMU89806.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.4]
gb|EMU91189.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.3]
gb|EMU93771.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.2]
gb|EMV04506.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.10]
gb|EMV08240.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.11]
gb|EMV15635.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.12]
gb|EMV17118.1| preprotein translocase, SecY subunit [Escherichia coli C-34666]
gb|EMV27015.1| preprotein translocase, SecY subunit [Escherichia coli BCE034_MS-14]
gb|EMV37696.1| preprotein translocase, SecY subunit [Escherichia coli BCE019_MS-13]
gb|EMV43956.1| preprotein translocase, SecY subunit [Escherichia coli 2872800]
gb|EMV44824.1| preprotein translocase, SecY subunit [Escherichia coli 2875000]
gb|EMV53325.1| preprotein translocase, SecY subunit [Escherichia coli 2871950]
gb|EMV68573.1| preprotein translocase, SecY subunit [Escherichia coli 2866450]
gb|EMV71709.1| preprotein translocase, SecY subunit [Escherichia coli 2866750]
gb|EMV80970.1| preprotein translocase, SecY subunit [Escherichia coli 2866550]
gb|EMV83857.1| preprotein translocase, SecY subunit [Escherichia coli 2865200]
gb|EMV90157.1| preprotein translocase, SecY subunit [Escherichia coli 2860050]
gb|EMW12117.1| preprotein translocase, SecY subunit [Escherichia coli 2853500]
gb|EMW12749.1| preprotein translocase, SecY subunit [Escherichia coli 2850750]
gb|EMW12920.1| preprotein translocase, SecY subunit [Escherichia coli 2848050]
gb|EMW18451.1| preprotein translocase, SecY subunit [Escherichia coli 2845650]
gb|EMW32975.1| preprotein translocase, SecY subunit [Escherichia coli 2785200]
gb|EMW34229.1| preprotein translocase, SecY subunit [Escherichia coli 2788150]
gb|EMW43577.1| preprotein translocase, SecY subunit [Escherichia coli 2770900]
gb|EMW46405.1| preprotein translocase, SecY subunit [Escherichia coli 2780750]
gb|EMW54485.1| preprotein translocase, SecY subunit [Escherichia coli 2762100]
gb|EMW58011.1| preprotein translocase, SecY subunit [Escherichia coli 2756500]
gb|EMW63712.1| preprotein translocase, SecY subunit [Escherichia coli 2749250]
gb|EMW72006.1| preprotein translocase, SecY subunit [Escherichia coli 2747800]
gb|EMW86100.1| preprotein translocase, SecY subunit [Escherichia coli 180600]
gb|EMW91383.1| preprotein translocase, SecY subunit [Escherichia coli ThroopD]
gb|EMW93021.1| preprotein translocase, SecY subunit [Escherichia coli 174750]
gb|EMW96835.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.1]
gb|EMX05891.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.1]
gb|EMX12596.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.2]
gb|EMX17648.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.1]
gb|EMX20598.1| preprotein translocase, SecY subunit [Escherichia coli MP021566.1]
gb|EMX28941.1| preprotein translocase, SecY subunit [Escherichia coli MP021561.2]
gb|EMX35765.1| preprotein translocase, SecY subunit [Escherichia coli MP021552.8]
gb|EMX36343.1| preprotein translocase, SecY subunit [Escherichia coli MP021017.1]
gb|EMX46202.1| preprotein translocase, SecY subunit [Escherichia coli MP020980.2]
gb|EMX47645.1| preprotein translocase, SecY subunit [Escherichia coli Jurua 20/10]
gb|EMX51189.1| preprotein translocase, SecY subunit [Escherichia coli MP020940.1]
gb|EMX60788.1| preprotein translocase, SecY subunit [Escherichia coli Jurua 18/11]
gb|EMX66492.1| preprotein translocase, SecY subunit [Escherichia coli Envira 10/1]
gb|EMX67105.1| preprotein translocase, SecY subunit [Escherichia coli Envira 8/11]
gb|EMX74138.1| preprotein translocase, SecY subunit [Escherichia coli 2726800]
gb|EMX81995.1| preprotein translocase, SecY subunit [Escherichia coli 2719100]
gb|EMX85065.1| preprotein translocase, SecY subunit [Escherichia coli BCE001_MS16]
gb|EMX90319.1| preprotein translocase, SecY subunit [Escherichia coli 2720900]
gb|EMZ40341.1| preprotein translocase subunit secY [Escherichia coli SWW33]
gb|EMZ61121.1| preprotein translocase, SecY subunit [Escherichia coli 2735000]
gb|EMZ61496.1| preprotein translocase, SecY subunit [Escherichia coli 174900]
gb|EMZ64370.1| preprotein translocase, SecY subunit [Escherichia coli 2846750]
gb|EMZ76023.1| preprotein translocase, SecY subunit [Escherichia coli 199900.1]
gb|EMZ77342.1| preprotein translocase, SecY subunit [Escherichia coli 2722950]
gb|EMZ81175.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.1]
gb|EMZ90822.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.1]
gb|EMZ94915.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.1]
gb|ENA01705.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.2]
gb|ENA02129.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.1]
gb|ENA13062.1| preprotein translocase, SecY subunit [Escherichia coli BCE008_MS-13]
gb|ENA18453.1| preprotein translocase, SecY subunit [Escherichia coli 201600.1]
gb|ENA28515.1| preprotein translocase, SecY subunit [Escherichia coli BCE007_MS-11]
gb|ENA37890.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.4]
gb|ENA43175.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.2]
gb|ENA44174.1| preprotein translocase, SecY subunit [Escherichia coli 2729250]
gb|ENA50054.1| preprotein translocase, SecY subunit [Escherichia coli 2726950]
gb|ENA59018.1| preprotein translocase, SecY subunit [Escherichia coli 178900]
gb|ENA71660.1| preprotein translocase, SecY subunit [Escherichia coli 179550]
gb|ENA73285.1| preprotein translocase, SecY subunit [Escherichia coli 180200]
gb|ENA78021.1| preprotein translocase, SecY subunit [Escherichia coli 2730350]
gb|ENA90258.1| preprotein translocase, SecY subunit [Escherichia coli 2860650]
gb|ENA92470.1| preprotein translocase, SecY subunit [Escherichia coli 2864350]
gb|ENB05211.1| preprotein translocase, SecY subunit [Escherichia coli 2866350]
gb|ENB11824.1| preprotein translocase, SecY subunit [Escherichia coli BCE008_MS-01]
gb|ENB31405.1| preprotein translocase, SecY subunit [Escherichia coli BCE032_MS-12]
gb|ENB46625.1| preprotein translocase, SecY subunit [Escherichia coli MP021561.3]
gb|ENB86081.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.10]
gb|ENB91117.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.11]
gb|ENB94462.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.3]
gb|ENC01389.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.4]
gb|ENC08716.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.6]
gb|ENC11311.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.7]
gb|ENC22441.1| preprotein translocase, SecY subunit [Escherichia coli P0299438.8]
gb|ENC28826.1| preprotein translocase, SecY subunit [Escherichia coli P02997067.6]
gb|ENC44011.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.2]
gb|ENC47264.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.10]
gb|ENC51406.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.3]
gb|ENC53173.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.4]
gb|ENC53674.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.5]
gb|ENC74077.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.7]
gb|ENC81282.1| preprotein translocase, SecY subunit [Escherichia coli P0299917.9]
gb|ENC89387.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.11]
gb|ENC90907.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.8]
gb|ENC96775.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.10]
gb|ENC99134.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.11]
gb|END05660.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.2]
gb|END07956.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.3]
gb|END19360.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.5]
gb|END27776.1| preprotein translocase, SecY subunit [Escherichia coli 179100]
gb|END34708.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.13]
gb|END47512.1| preprotein translocase, SecY subunit [Escherichia coli 2854350]
gb|END50428.1| preprotein translocase, SecY subunit [Escherichia coli MP020980.1]
gb|END54881.1| preprotein translocase, SecY subunit [Escherichia coli BCE006_MS-23]
gb|END65105.1| preprotein translocase, SecY subunit [Escherichia coli P0299483.1]
gb|END86183.1| preprotein translocase, SecY subunit [Escherichia coli P0299483.2]
gb|END88664.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.13]
gb|END89603.1| preprotein translocase, SecY subunit [Escherichia coli P0301904.3]
gb|END89800.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.7]
gb|ENE05415.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.2]
gb|ENE16816.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.14]
gb|ENE18154.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.3]
gb|ENE29142.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.4]
gb|ENE29503.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.6]
gb|ENE36683.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.10]
gb|ENE39470.1| preprotein translocase, SecY subunit [Escherichia coli P0302293.8]
gb|ENE57815.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.13]
gb|ENE59743.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.12]
gb|ENE62200.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.11]
gb|ENE78798.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.2]
gb|ENE79506.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.14]
gb|ENE87173.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.15]
gb|ENE90057.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.3]
gb|ENE94756.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.7]
gb|ENE97077.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.5]
gb|ENE98828.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.8]
gb|ENF07698.1| preprotein translocase, SecY subunit [Escherichia coli P0304777.9]
gb|ENF15743.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.10]
gb|ENF26255.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.11]
gb|ENF28734.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.12]
gb|ENF37415.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.13]
gb|ENF39193.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.15]
gb|ENF58278.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.2]
gb|ENF58443.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.6]
gb|ENF60461.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.7]
gb|ENF61077.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.8]
gb|ENF69097.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.9]
gb|ENF80947.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.11]
gb|ENF88047.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.13]
gb|ENF95207.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.15]
gb|ENG02035.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.4]
gb|ENG10239.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.5]
gb|ENG14202.1| preprotein translocase, SecY subunit [Escherichia coli P0305260.6]
gb|ENG39032.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.11]
gb|ENG39127.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.10]
gb|ENG49950.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.12]
gb|ENG62891.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.2]
gb|ENG66850.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.3]
gb|ENG72851.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.4]
gb|ENG75708.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.9]
gb|ENG80496.1| preprotein translocase, SecY subunit [Escherichia coli 178200]
gb|ENG89145.1| preprotein translocase, SecY subunit [Escherichia coli 178850]
gb|ENG94804.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.3]
gb|ENH00176.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.5]
gb|ENH06865.1| preprotein translocase, SecY subunit [Escherichia coli P0301867.7]
gb|ENH13445.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.13]
gb|ENH14299.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.12]
gb|ENH17368.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.14]
gb|ENH28627.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.4]
gb|ENH30166.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.3]
gb|ENH36113.1| preprotein translocase, SecY subunit [Escherichia coli P0304816.5]
gb|ENH49628.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.5]
gb|ENH50342.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.6]
gb|ENH55713.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.7]
gb|ENO10270.1| preprotein translocase membrane subunit [Escherichia coli O157:H43 str.
T22]
gb|EOQ54711.1| preprotein translocase subunit SecY [Escherichia coli KTE33]
gb|EOR53465.1| preprotein translocase membrane subunit [Escherichia coli ATCC 25922]
gb|EOU28574.1| preprotein translocase subunit secY [Escherichia coli KTE7]
gb|EOU28854.1| preprotein translocase subunit SecY [Escherichia coli KTE13]
gb|EOU30282.1| preprotein translocase subunit secY [Escherichia coli KTE3]
gb|EOU43103.1| preprotein translocase subunit secY [Escherichia coli KTE35]
gb|EOU46343.1| preprotein translocase subunit secY [Escherichia sp. KTE114]
gb|EOU48507.1| preprotein translocase subunit secY [Escherichia coli KTE231]
gb|EOU56355.1| preprotein translocase subunit SecY [Escherichia coli KTE14]
gb|EOU60711.1| preprotein translocase subunit secY [Escherichia coli KTE19]
gb|EOU63486.1| preprotein translocase subunit secY [Escherichia coli KTE20]
gb|EOU73881.1| preprotein translocase subunit secY [Escherichia coli KTE27]
gb|EOU84254.1| preprotein translocase subunit secY [Escherichia sp. KTE31]
gb|EOU87825.1| preprotein translocase subunit SecY [Escherichia coli KTE37]
gb|EOU88366.1| preprotein translocase subunit secY [Escherichia coli KTE34]
gb|EOV02133.1| preprotein translocase subunit secY [Escherichia coli KTE38]
gb|EOV04217.1| preprotein translocase subunit secY [Escherichia coli KTE195]
gb|EOV09395.1| preprotein translocase subunit secY [Escherichia coli KTE40]
gb|EOV15822.1| preprotein translocase subunit secY [Escherichia coli KTE198]
gb|EOV20325.1| preprotein translocase subunit secY [Escherichia coli KTE200]
gb|EOV23733.1| preprotein translocase subunit secY [Escherichia coli KTE199]
gb|EOV31884.1| preprotein translocase subunit secY [Escherichia coli KTE219]
gb|EOV34231.1| preprotein translocase subunit SecY [Escherichia coli KTE221]
gb|EOV41805.1| preprotein translocase subunit secY [Escherichia coli KTE222]
gb|EOV47892.1| preprotein translocase subunit secY [Escherichia coli KTE61]
gb|EOV54302.1| preprotein translocase subunit secY [Escherichia coli KTE64]
gb|EOV57366.1| preprotein translocase subunit secY [Escherichia coli KTE68]
gb|EOV61820.1| preprotein translocase subunit secY [Escherichia coli KTE69]
gb|EOV70073.1| preprotein translocase subunit secY [Escherichia coli KTE70]
gb|EOV72127.1| preprotein translocase subunit secY [Escherichia coli KTE71]
gb|EOV75230.1| preprotein translocase subunit SecY [Escherichia coli KTE73]
gb|EOV85876.1| preprotein translocase subunit secY [Escherichia coli KTE74]
gb|EOV86695.1| preprotein translocase subunit secY [Escherichia coli KTE89]
gb|EOW01891.1| preprotein translocase subunit SecY [Escherichia coli KTE98]
gb|EOW02996.1| preprotein translocase subunit secY [Escherichia coli KTE100]
gb|EOW10841.1| preprotein translocase subunit secY [Escherichia coli KTE103]
gb|EOW14814.1| preprotein translocase subunit secY [Escherichia coli KTE102]
gb|EOW18811.1| preprotein translocase subunit secY [Escherichia coli KTE107]
gb|EOW28299.1| preprotein translocase subunit SecY [Escherichia coli KTE121]
gb|EOW29610.1| preprotein translocase subunit secY [Escherichia coli KTE108]
gb|EOW31940.1| preprotein translocase subunit secY [Escherichia coli KTE127]
gb|EOW34177.1| preprotein translocase subunit SecY [Escherichia coli KTE126]
gb|EOW42101.1| preprotein translocase subunit secY [Escherichia coli KTE130]
gb|EOW44107.1| preprotein translocase subunit secY [Escherichia coli KTE132]
gb|EOW56448.1| preprotein translocase subunit secY [Escherichia coli KTE155]
gb|EOW57874.1| preprotein translocase subunit SecY [Escherichia coli KTE134]
gb|EOW64758.1| preprotein translocase subunit secY [Escherichia coli KTE170]
gb|EOW72962.1| preprotein translocase subunit secY [Escherichia sp. KTE172]
gb|EOW88685.1| preprotein translocase subunit secY [Escherichia coli KTE1]
gb|EOW90467.1| preprotein translocase subunit secY [Escherichia coli KTE41]
gb|EOW93240.1| preprotein translocase subunit secY [Escherichia coli KTE182]
gb|EOX06018.1| preprotein translocase subunit SecY [Escherichia coli KTE226]
gb|EOX09030.1| preprotein translocase subunit SecY [Escherichia coli KTE240]
gb|EOX15396.1| preprotein translocase subunit SecY [Escherichia coli KTE225]
gb|EOX20618.1| preprotein translocase subunit secY [Escherichia coli KTE185]
gb|EOX27639.1| preprotein translocase subunit SecY [Escherichia coli KTE186]
gb|EPH46963.1| Preprotein translocase secY subunit [Escherichia coli E2265]
emb|CDC76559.1| protein translocase subunit SecY [Escherichia coli CAG:4]
gb|EQM99883.1| preprotein translocase subunit secY [Escherichia coli HVH 2
(4-6943160)]
gb|EQN02938.1| preprotein translocase subunit SecY [Escherichia coli HVH 3
(4-7276001)]
gb|EQN05259.1| preprotein translocase subunit secY [Escherichia coli HVH 1
(4-6876161)]
gb|EQN14796.1| preprotein translocase subunit secY [Escherichia coli HVH 4
(4-7276109)]
gb|EQN15833.1| preprotein translocase subunit secY [Escherichia coli HVH 5
(4-7148410)]
gb|EQN23320.1| preprotein translocase subunit secY [Escherichia coli HVH 6
(3-8296502)]
gb|EQN28764.1| preprotein translocase subunit secY [Escherichia coli HVH 9
(4-6942539)]
gb|EQN29571.1| preprotein translocase subunit SecY [Escherichia coli HVH 7
(4-7315031)]
gb|EQN37917.1| preprotein translocase subunit secY [Escherichia coli HVH 10
(4-6832164)]
gb|EQN43768.1| preprotein translocase subunit secY [Escherichia coli HVH 13
(4-7634056)]
gb|EQN45877.1| preprotein translocase subunit SecY [Escherichia coli HVH 16
(4-7649002)]
gb|EQN51106.1| preprotein translocase subunit secY [Escherichia coli HVH 17
(4-7473087)]
gb|EQN59366.1| preprotein translocase subunit secY [Escherichia coli HVH 20
(4-5865042)]
gb|EQN61960.1| preprotein translocase subunit secY [Escherichia coli HVH 18
(4-8589585)]
gb|EQN66569.1| preprotein translocase subunit SecY [Escherichia coli HVH 19
(4-7154984)]
gb|EQN72797.1| preprotein translocase subunit SecY [Escherichia coli HVH 21
(4-4517873)]
gb|EQN78270.1| preprotein translocase subunit secY [Escherichia coli HVH 22
(4-2258986)]
gb|EQN82480.1| preprotein translocase subunit secY [Escherichia coli HVH 24
(4-5985145)]
gb|EQN90054.1| preprotein translocase subunit secY [Escherichia coli HVH 26
(4-5703913)]
gb|EQN90389.1| preprotein translocase subunit SecY [Escherichia coli HVH 25
(4-5851939)]
gb|EQN93239.1| preprotein translocase subunit secY [Escherichia coli HVH 27
(4-7449267)]
gb|EQO04329.1| preprotein translocase subunit SecY [Escherichia coli HVH 29
(4-3418073)]
gb|EQO05846.1| preprotein translocase subunit secY [Escherichia coli HVH 28
(4-0907367)]
gb|EQO13404.1| preprotein translocase subunit secY [Escherichia coli HVH 30
(4-2661829)]
gb|EQO14667.1| preprotein translocase subunit secY [Escherichia coli HVH 31
(4-2602156)]
gb|EQO20015.1| preprotein translocase subunit secY [Escherichia coli HVH 32
(4-3773988)]
gb|EQO26289.1| preprotein translocase subunit secY [Escherichia coli HVH 33
(4-2174936)]
gb|EQO29044.1| preprotein translocase subunit secY [Escherichia coli HVH 35
(4-2962667)]
gb|EQO35279.1| preprotein translocase subunit SecY [Escherichia coli HVH 37
(4-2773848)]
gb|EQO39735.1| preprotein translocase subunit secY [Escherichia coli HVH 39
(4-2679949)]
gb|EQO50200.1| preprotein translocase subunit secY [Escherichia coli HVH 40
(4-1219782)]
gb|EQO57802.1| preprotein translocase subunit secY [Escherichia coli HVH 41
(4-2677849)]
gb|EQO57991.1| preprotein translocase subunit secY [Escherichia coli HVH 42
(4-2100061)]
gb|EQO68786.1| preprotein translocase subunit secY [Escherichia coli HVH 44
(4-2298570)]
gb|EQO70237.1| preprotein translocase subunit secY [Escherichia coli HVH 43
(4-2173468)]
gb|EQO75454.1| preprotein translocase subunit secY [Escherichia coli HVH 45
(4-3129918)]
gb|EQO81821.1| preprotein translocase subunit secY [Escherichia coli HVH 48
(4-2658593)]
gb|EQO83071.1| preprotein translocase subunit secY [Escherichia coli HVH 46
(4-2758776)]
gb|EQO89450.1| preprotein translocase subunit SecY [Escherichia coli HVH 51
(4-2172526)]
gb|EQO95936.1| preprotein translocase subunit secY [Escherichia coli HVH 55
(4-2646161)]
gb|EQP03800.1| preprotein translocase subunit secY [Escherichia coli HVH 53
(4-0631051)]
gb|EQP05190.1| preprotein translocase subunit secY [Escherichia coli HVH 56
(4-2153033)]
gb|EQP07390.1| preprotein translocase subunit secY [Escherichia coli HVH 58
(4-2839709)]
gb|EQP14832.1| preprotein translocase subunit SecY [Escherichia coli HVH 59
(4-1119338)]
gb|EQP17640.1| preprotein translocase subunit secY [Escherichia coli HVH 61
(4-2736020)]
gb|EQP21839.1| preprotein translocase subunit SecY [Escherichia coli HVH 63
(4-2542528)]
gb|EQP31415.1| preprotein translocase subunit SecY [Escherichia coli HVH 68
(4-0888028)]
gb|EQP31752.1| preprotein translocase subunit secY [Escherichia coli HVH 69
(4-2837072)]
gb|EQP32685.1| preprotein translocase subunit SecY [Escherichia coli HVH 65
(4-2262045)]
gb|EQP45039.1| preprotein translocase subunit SecY [Escherichia coli HVH 70
(4-2963531)]
gb|EQP47637.1| preprotein translocase subunit secY [Escherichia coli HVH 73
(4-2393174)]
gb|EQP47916.1| preprotein translocase subunit SecY [Escherichia coli HVH 74
(4-1034782)]
gb|EQP58567.1| preprotein translocase subunit secY [Escherichia coli HVH 76
(4-2538717)]
gb|EQP65913.1| preprotein translocase subunit secY [Escherichia coli HVH 78
(4-2735946)]
gb|EQP67674.1| preprotein translocase subunit SecY [Escherichia coli HVH 77
(4-2605759)]
gb|EQP68652.1| preprotein translocase subunit SecY [Escherichia coli HVH 79
(4-2512823)]
gb|EQP75936.1| preprotein translocase subunit secY [Escherichia coli HVH 80
(4-2428830)]
gb|EQP86820.1| preprotein translocase subunit secY [Escherichia coli HVH 84
(4-1021478)]
gb|EQP89177.1| preprotein translocase subunit secY [Escherichia coli HVH 85
(4-0792144)]
gb|EQP90022.1| preprotein translocase subunit secY [Escherichia coli HVH 82
(4-2209276)]
gb|EQQ00459.1| preprotein translocase subunit secY [Escherichia coli HVH 88
(4-5854636)]
gb|EQQ01485.1| preprotein translocase subunit secY [Escherichia coli HVH 87
(4-5977630)]
gb|EQQ02277.1| preprotein translocase subunit SecY [Escherichia coli HVH 89
(4-5885604)]
gb|EQQ11929.1| preprotein translocase subunit SecY [Escherichia coli HVH 90
(4-3191362)]
gb|EQQ18535.1| preprotein translocase subunit SecY [Escherichia coli HVH 91
(4-4638751)]
gb|EQQ21399.1| preprotein translocase subunit secY [Escherichia coli HVH 92
(4-5930790)]
gb|EQQ23980.1| preprotein translocase subunit SecY [Escherichia coli HVH 95
(4-6074464)]
gb|EQQ35682.1| preprotein translocase subunit secY [Escherichia coli HVH 96
(4-5934869)]
gb|EQQ36543.1| preprotein translocase subunit secY [Escherichia coli HVH 100
(4-2850729)]
gb|EQQ37285.1| preprotein translocase subunit secY [Escherichia coli HVH 102
(4-6906788)]
gb|EQQ46890.1| preprotein translocase subunit secY [Escherichia coli HVH 104
(4-6977960)]
gb|EQQ48368.1| preprotein translocase subunit SecY [Escherichia coli HVH 103
(4-5904188)]
gb|EQQ56332.1| preprotein translocase subunit secY [Escherichia coli HVH 106
(4-6881831)]
gb|EQQ63361.1| preprotein translocase subunit secY [Escherichia coli HVH 110
(4-6978754)]
gb|EQQ67415.1| preprotein translocase subunit secY [Escherichia coli HVH 107
(4-5860571)]
gb|EQQ69564.1| preprotein translocase subunit secY [Escherichia coli HVH 109
(4-6977162)]
gb|EQQ71882.1| preprotein translocase subunit secY [Escherichia coli HVH 111
(4-7039018)]
gb|EQQ84209.1| preprotein translocase subunit secY [Escherichia coli HVH 112
(4-5987253)]
gb|EQQ84854.1| preprotein translocase subunit secY [Escherichia coli HVH 113
(4-7535473)]
gb|EQQ86064.1| preprotein translocase subunit SecY [Escherichia coli HVH 114
(4-7037740)]
gb|EQQ95968.1| preprotein translocase subunit secY [Escherichia coli HVH 115
(4-4465989)]
gb|EQQ99561.1| preprotein translocase subunit secY [Escherichia coli HVH 115
(4-4465997)]
gb|EQR04380.1| preprotein translocase subunit secY [Escherichia coli HVH 116
(4-6879942)]
gb|EQR12174.1| preprotein translocase subunit secY [Escherichia coli HVH 117
(4-6857191)]
gb|EQR17213.1| preprotein translocase subunit SecY [Escherichia coli HVH 119
(4-6879578)]
gb|EQR25458.1| preprotein translocase subunit secY [Escherichia coli HVH 120
(4-6978681)]
gb|EQR30539.1| preprotein translocase subunit secY [Escherichia coli HVH 122
(4-6851606)]
gb|EQR35400.1| preprotein translocase subunit SecY [Escherichia coli HVH 121
(4-6877826)]
gb|EQR39923.1| preprotein translocase subunit secY [Escherichia coli HVH 125
(4-2634716)]
gb|EQR45137.1| preprotein translocase subunit secY [Escherichia coli HVH 126
(4-6034225)]
gb|EQR50965.1| preprotein translocase subunit secY [Escherichia coli HVH 127
(4-7303629)]
gb|EQR56500.1| preprotein translocase subunit secY [Escherichia coli HVH 128
(4-7030436)]
gb|EQR59340.1| preprotein translocase subunit secY [Escherichia coli HVH 130
(4-7036876)]
gb|EQR63116.1| preprotein translocase subunit secY [Escherichia coli HVH 132
(4-6876862)]
gb|EQR79648.1| preprotein translocase subunit secY [Escherichia coli HVH 135
(4-4449320)]
gb|EQR81825.1| preprotein translocase subunit SecY [Escherichia coli HVH 134
(4-6073441)]
gb|EQR83044.1| preprotein translocase subunit secY [Escherichia coli HVH 133
(4-4466519)]
gb|EQR86896.1| preprotein translocase subunit secY [Escherichia coli HVH 137
(4-2124971)]
gb|EQR91464.1| preprotein translocase subunit secY [Escherichia coli HVH 138
(4-6066704)]
gb|EQR93495.1| preprotein translocase subunit SecY [Escherichia coli HVH 139
(4-3192644)]
gb|EQR99199.1| preprotein translocase subunit SecY [Escherichia coli HVH 140
(4-5894387)]
gb|EQS01821.1| preprotein translocase subunit secY [Escherichia coli HVH 141
(4-5995973)]
gb|EQS10291.1| preprotein translocase subunit secY [Escherichia coli HVH 143
(4-5674999)]
gb|EQS14581.1| preprotein translocase subunit secY [Escherichia coli HVH 142
(4-5627451)]
gb|EQS15695.1| preprotein translocase subunit secY [Escherichia coli HVH 144
(4-4451937)]
gb|EQS27673.1| preprotein translocase subunit secY [Escherichia coli HVH 145
(4-5672112)]
gb|EQS30472.1| preprotein translocase subunit secY [Escherichia coli HVH 147
(4-5893887)]
gb|EQS31800.1| preprotein translocase subunit SecY [Escherichia coli HVH 146
(4-3189767)]
gb|EQS36447.1| preprotein translocase subunit secY [Escherichia coli HVH 149
(4-4451880)]
gb|EQS45013.1| preprotein translocase subunit secY [Escherichia coli HVH 151
(4-5755573)]
gb|EQS46639.1| preprotein translocase subunit secY [Escherichia coli HVH 153
(3-9344314)]
gb|EQS52236.1| preprotein translocase subunit secY [Escherichia coli HVH 150
(4-3258106)]
gb|EQS59274.1| preprotein translocase subunit secY [Escherichia coli HVH 158
(4-3224287)]
gb|EQS63252.1| preprotein translocase subunit secY [Escherichia coli HVH 154
(4-5636698)]
gb|EQS71683.1| preprotein translocase subunit SecY [Escherichia coli HVH 161
(4-3119890)]
gb|EQS76243.1| preprotein translocase subunit SecY [Escherichia coli HVH 162
(4-5627982)]
gb|EQS80414.1| preprotein translocase subunit secY [Escherichia coli HVH 163
(4-4697553)]
gb|EQS82757.1| preprotein translocase subunit secY [Escherichia coli HVH 164
(4-5953081)]
gb|EQS84279.1| preprotein translocase subunit SecY [Escherichia coli HVH 167
(4-6073565)]
gb|EQS93429.1| preprotein translocase subunit SecY [Escherichia coli HVH 169
(4-1075578)]
gb|EQS96293.1| preprotein translocase subunit SecY [Escherichia coli HVH 171
(4-3191958)]
gb|EQT00039.1| preprotein translocase subunit secY [Escherichia coli HVH 170
(4-3026949)]
gb|EQT07894.1| preprotein translocase subunit SecY [Escherichia coli HVH 172
(4-3248542)]
gb|EQT10358.1| preprotein translocase subunit secY [Escherichia coli HVH 173
(3-9175482)]
gb|EQT18628.1| preprotein translocase subunit SecY [Escherichia coli HVH 176
(4-3428664)]
gb|EQT20563.1| preprotein translocase subunit secY [Escherichia coli HVH 175
(4-3405184)]
gb|EQT24938.1| preprotein translocase subunit SecY [Escherichia coli HVH 180
(4-3051617)]
gb|EQT33921.1| preprotein translocase subunit secY [Escherichia coli HVH 183
(4-3205932)]
gb|EQT34847.1| preprotein translocase subunit secY [Escherichia coli HVH 182
(4-0985554)]
gb|EQT42241.1| preprotein translocase subunit secY [Escherichia coli HVH 184
(4-3343286)]
gb|EQT46960.1| preprotein translocase subunit secY [Escherichia coli HVH 185
(4-2876639)]
gb|EQT50968.1| preprotein translocase subunit secY [Escherichia coli HVH 187
(4-4471660)]
gb|EQT53303.1| preprotein translocase subunit secY [Escherichia coli HVH 186
(4-3405044)]
gb|EQT58402.1| preprotein translocase subunit secY [Escherichia coli HVH 188
(4-2356988)]
gb|EQT66627.1| preprotein translocase subunit secY [Escherichia coli HVH 190
(4-3255514)]
gb|EQT72864.1| preprotein translocase subunit secY [Escherichia coli HVH 189
(4-3220125)]
gb|EQT74818.1| preprotein translocase subunit secY [Escherichia coli HVH 191
(3-9341900)]
gb|EQT80683.1| preprotein translocase subunit secY [Escherichia coli HVH 192
(4-3054470)]
gb|EQT87299.1| preprotein translocase subunit SecY [Escherichia coli HVH 193
(4-3331423)]
gb|EQT90846.1| preprotein translocase subunit secY [Escherichia coli HVH 195
(3-7155360)]
gb|EQT99062.1| preprotein translocase subunit SecY [Escherichia coli HVH 196
(4-4530470)]
gb|EQU01484.1| preprotein translocase subunit secY [Escherichia coli HVH 194
(4-2356805)]
gb|EQU08819.1| preprotein translocase subunit secY [Escherichia coli HVH 198
(4-3206106)]
gb|EQU09151.1| preprotein translocase subunit secY [Escherichia coli HVH 199
(4-5670322)]
gb|EQU10392.1| preprotein translocase subunit secY [Escherichia coli HVH 197
(4-4466217)]
gb|EQU19817.1| preprotein translocase subunit SecY [Escherichia coli HVH 201
(4-4459431)]
gb|EQU20250.1| preprotein translocase subunit SecY [Escherichia coli HVH 200
(4-4449924)]
gb|EQU31355.1| preprotein translocase subunit secY [Escherichia coli HVH 202
(4-3163997)]
gb|EQU31782.1| preprotein translocase subunit secY [Escherichia coli HVH 203
(4-3126218)]
gb|EQU39207.1| preprotein translocase subunit secY [Escherichia coli HVH 204
(4-3112802)]
gb|EQU44438.1| preprotein translocase subunit SecY [Escherichia coli HVH 205
(4-3094677)]
gb|EQU48311.1| preprotein translocase subunit SecY [Escherichia coli HVH 206
(4-3128229)]
gb|EQU52367.1| preprotein translocase subunit SecY [Escherichia coli HVH 207
(4-3113221)]
gb|EQU57388.1| preprotein translocase subunit SecY [Escherichia coli HVH 208
(4-3112292)]
gb|EQU67431.1| preprotein translocase subunit SecY [Escherichia coli HVH 211
(4-3041891)]
gb|EQU69382.1| preprotein translocase subunit secY [Escherichia coli HVH 212
(3-9305343)]
gb|EQU73851.1| preprotein translocase subunit secY [Escherichia coli HVH 209
(4-3062651)]
gb|EQU76502.1| preprotein translocase subunit SecY [Escherichia coli HVH 213
(4-3042928)]
gb|EQU85292.1| preprotein translocase subunit secY [Escherichia coli HVH 215
(4-3008371)]
gb|EQU90355.1| preprotein translocase subunit SecY [Escherichia coli HVH 217
(4-1022806)]
gb|EQU91486.1| preprotein translocase subunit secY [Escherichia coli HVH 216
(4-3042952)]
gb|EQU98051.1| preprotein translocase subunit secY [Escherichia coli HVH 218
(4-4500903)]
gb|EQV05296.1| preprotein translocase subunit secY [Escherichia coli HVH 221
(4-3136817)]
gb|EQV05997.1| preprotein translocase subunit secY [Escherichia coli HVH 220
(4-5876842)]
gb|EQV11137.1| preprotein translocase subunit secY [Escherichia coli HVH 222
(4-2977443)]
gb|EQV17752.1| preprotein translocase subunit SecY [Escherichia coli HVH 223
(4-2976528)]
gb|EQV22830.1| preprotein translocase subunit secY [Escherichia coli HVH 227
(4-2277670)]
gb|EQV23404.1| preprotein translocase subunit SecY [Escherichia coli HVH 225
(4-1273116)]
gb|EQV30349.1| preprotein translocase subunit secY [Escherichia coli KOEGE 30 (63a)]
gb|EQV42587.1| preprotein translocase subunit secY [Escherichia coli KOEGE 33 (68a)]
gb|EQV44382.1| preprotein translocase subunit secY [Escherichia coli KOEGE 32 (66a)]
gb|EQV51356.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 43 (105a)]
gb|EQV52774.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 40 (102a)]
gb|EQV54410.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 44 (106a)]
gb|EQV62920.1| preprotein translocase subunit secY [Escherichia coli KOEGE 56 (169a)]
gb|EQV65767.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 58 (171a)]
gb|EQV77322.1| preprotein translocase subunit secY [Escherichia coli KOEGE 68 (182a)]
gb|EQV80434.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 62 (175a)]
gb|EQV81402.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 70 (185a)]
gb|EQV96960.1| preprotein translocase subunit secY [Escherichia coli KOEGE 77 (202a)]
gb|EQV97905.1| preprotein translocase subunit secY [Escherichia coli KOEGE 73 (195a)]
gb|EQW09192.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 118 (317a)]
gb|EQW09844.1| preprotein translocase subunit secY [Escherichia coli KOEGE 131 (358a)]
gb|EQW14783.1| preprotein translocase subunit secY [Escherichia coli UMEA 3014-1]
gb|EQW15920.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3022-1]
gb|EQW28604.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3033-1]
gb|EQW28793.1| preprotein translocase subunit secY [Escherichia coli UMEA 3041-1]
gb|EQW38608.1| preprotein translocase subunit secY [Escherichia coli UMEA 3053-1]
gb|EQW40841.1| preprotein translocase subunit secY [Escherichia coli UMEA 3065-1]
gb|EQW48624.1| preprotein translocase subunit secY [Escherichia coli UMEA 3087-1]
gb|EQW52479.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3097-1]
gb|EQW57963.1| preprotein translocase subunit secY [Escherichia coli UMEA 3088-1]
gb|EQW63403.1| preprotein translocase subunit secY [Escherichia coli UMEA 3108-1]
gb|EQW63691.1| preprotein translocase subunit secY [Escherichia coli UMEA 3113-1]
gb|EQW72801.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3117-1]
gb|EQW75922.1| preprotein translocase subunit secY [Escherichia coli UMEA 3121-1]
gb|EQW81711.1| preprotein translocase subunit secY [Escherichia coli UMEA 3122-1]
gb|EQW84179.1| preprotein translocase subunit secY [Escherichia coli UMEA 3124-1]
gb|EQW89319.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3139-1]
gb|EQW99043.1| preprotein translocase subunit secY [Escherichia coli UMEA 3152-1]
gb|EQX01000.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3140-1]
gb|EQX07499.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3159-1]
gb|EQX08353.1| preprotein translocase subunit secY [Escherichia coli UMEA 3155-1]
gb|EQX16019.1| preprotein translocase subunit secY [Escherichia coli UMEA 3161-1]
gb|EQX16349.1| preprotein translocase subunit secY [Escherichia coli UMEA 3160-1]
gb|EQX24926.1| preprotein translocase subunit secY [Escherichia coli UMEA 3162-1]
gb|EQX29730.1| preprotein translocase subunit secY [Escherichia coli UMEA 3163-1]
gb|EQX30877.1| preprotein translocase subunit secY [Escherichia coli UMEA 3172-1]
gb|EQX40366.1| preprotein translocase subunit secY [Escherichia coli UMEA 3175-1]
gb|EQX41047.1| preprotein translocase subunit secY [Escherichia coli UMEA 3173-1]
gb|EQX49317.1| preprotein translocase subunit secY [Escherichia coli UMEA 3174-1]
gb|EQX52953.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3176-1]
gb|EQX54205.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3178-1]
gb|EQX63778.1| preprotein translocase subunit secY [Escherichia coli UMEA 3185-1]
gb|EQX66723.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3180-1]
gb|EQX73501.1| preprotein translocase subunit secY [Escherichia coli UMEA 3193-1]
gb|EQX76997.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3190-1]
gb|EQX81282.1| preprotein translocase subunit secY [Escherichia coli UMEA 3199-1]
gb|EQX84678.1| preprotein translocase subunit secY [Escherichia coli UMEA 3200-1]
gb|EQX92581.1| preprotein translocase subunit secY [Escherichia coli UMEA 3201-1]
gb|EQX97129.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3203-1]
gb|EQX97555.1| preprotein translocase subunit secY [Escherichia coli UMEA 3206-1]
gb|EQY08134.1| preprotein translocase subunit secY [Escherichia coli UMEA 3208-1]
gb|EQY12015.1| preprotein translocase subunit secY [Escherichia coli UMEA 3215-1]
gb|EQY15303.1| preprotein translocase subunit secY [Escherichia coli UMEA 3212-1]
gb|EQY19501.1| preprotein translocase subunit secY [Escherichia coli UMEA 3216-1]
gb|EQY25637.1| preprotein translocase subunit secY [Escherichia coli UMEA 3217-1]
gb|EQY29865.1| preprotein translocase subunit secY [Escherichia coli UMEA 3220-1]
gb|EQY36921.1| preprotein translocase subunit secY [Escherichia coli UMEA 3221-1]
gb|EQY40091.1| preprotein translocase subunit secY [Escherichia coli UMEA 3222-1]
gb|EQY40424.1| preprotein translocase subunit secY [Escherichia coli UMEA 3230-1]
gb|EQY52235.1| preprotein translocase subunit secY [Escherichia coli UMEA 3233-1]
gb|EQY52782.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3244-1]
gb|EQY56960.1| preprotein translocase subunit secY [Escherichia coli UMEA 3240-1]
gb|EQY64678.1| preprotein translocase subunit secY [Escherichia coli UMEA 3264-1]
gb|EQY67989.1| preprotein translocase subunit secY [Escherichia coli UMEA 3257-1]
gb|EQY73419.1| preprotein translocase subunit secY [Escherichia coli UMEA 3268-1]
gb|EQY80779.1| preprotein translocase subunit secY [Escherichia coli UMEA 3304-1]
gb|EQY84909.1| preprotein translocase subunit secY [Escherichia coli UMEA 3314-1]
gb|EQY89882.1| preprotein translocase subunit secY [Escherichia coli UMEA 3317-1]
gb|EQY95360.1| preprotein translocase subunit secY [Escherichia coli UMEA 3329-1]
gb|EQY97477.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3337-1]
gb|EQY97882.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3318-1]
gb|EQZ08624.1| preprotein translocase subunit secY [Escherichia coli UMEA 3341-1]
gb|EQZ10623.1| preprotein translocase subunit secY [Escherichia coli UMEA 3355-1]
gb|EQZ15950.1| preprotein translocase subunit secY [Escherichia coli UMEA 3391-1]
gb|EQZ21711.1| preprotein translocase subunit secY [Escherichia coli UMEA 3490-1]
gb|EQZ30718.1| preprotein translocase subunit secY [Escherichia coli UMEA 3585-1]
gb|EQZ31333.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3592-1]
gb|EQZ35927.1| preprotein translocase subunit secY [Escherichia coli UMEA 3617-1]
gb|EQZ36985.1| preprotein translocase subunit secY [Escherichia coli UMEA 3609-1]
gb|EQZ48110.1| preprotein translocase subunit secY [Escherichia coli UMEA 3632-1]
gb|EQZ50877.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3656-1]
gb|EQZ53002.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3662-1]
gb|EQZ62368.1| preprotein translocase subunit secY [Escherichia coli UMEA 3682-1]
gb|EQZ63233.1| preprotein translocase subunit secY [Escherichia coli UMEA 3671-1]
gb|EQZ67899.1| preprotein translocase subunit secY [Escherichia coli UMEA 3687-1]
gb|EQZ72676.1| preprotein translocase subunit secY [Escherichia coli UMEA 3694-1]
gb|EQZ75806.1| preprotein translocase subunit secY [Escherichia coli UMEA 3702-1]
gb|EQZ86738.1| preprotein translocase subunit secY [Escherichia coli UMEA 3707-1]
gb|EQZ87834.1| preprotein translocase subunit secY [Escherichia coli UMEA 3703-1]
gb|EQZ89541.1| preprotein translocase subunit secY [Escherichia coli UMEA 3705-1]
gb|EQZ97755.1| preprotein translocase subunit secY [Escherichia coli UMEA 3718-1]
gb|ERA02813.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3805-1]
gb|ERA14789.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3889-1]
gb|ERA16764.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3834-1]
gb|ERA18130.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3893-1]
gb|ERA31074.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3955-1]
gb|ERA34280.1| preprotein translocase subunit SecY [Escherichia coli UMEA 4075-1]
gb|ERA37782.1| preprotein translocase subunit secY [Escherichia coli UMEA 3899-1]
gb|ERA42950.1| preprotein translocase subunit SecY [Escherichia coli UMEA 4207-1]
gb|ERA46571.1| preprotein translocase subunit secY [Escherichia coli UMEA 4076-1]
gb|ERA57270.1| preprotein translocase subunit SecY [Escherichia coli 95NR1]
gb|ERA64035.1| preprotein translocase subunit SecY [Escherichia coli HVH 155
(4-4509048)]
gb|ERA69109.1| preprotein translocase subunit SecY [Escherichia coli HVH 156
(4-3206505)]
gb|ERA71057.1| preprotein translocase subunit SecY [Escherichia coli HVH 157
(4-3406229)]
gb|ERA75164.1| preprotein translocase subunit secY [Escherichia coli HVH 159
(4-5818141)]
gb|ERA82715.1| preprotein translocase subunit secY [Escherichia coli HVH 160
(4-5695937)]
gb|ERA86764.1| preprotein translocase subunit secY [Escherichia coli HVH 210
(4-3042480)]
gb|ERA89940.1| preprotein translocase subunit secY [Escherichia coli HVH 228
(4-7787030)]
gb|ERA98358.1| preprotein translocase subunit secY [Escherichia coli KOEGE 3 (4a)]
gb|ERB01827.1| preprotein translocase subunit secY [Escherichia coli KOEGE 7 (16a)]
gb|ERB02765.1| preprotein translocase subunit secY [Escherichia coli KOEGE 10 (25a)]
gb|ERB12471.1| preprotein translocase subunit secY [Escherichia coli UMEA 3144-1]
gb|ERB16174.1| preprotein translocase subunit secY [Escherichia coli UMEA 3151-1]
gb|ERB22030.1| preprotein translocase subunit secY [Escherichia coli UMEA 3150-1]
gb|ERB24898.1| preprotein translocase subunit secY [Escherichia coli UMEA 3271-1]
gb|ERB31119.1| preprotein translocase subunit secY [Escherichia coli UMEA 3298-1]
gb|ERB32848.1| preprotein translocase subunit secY [Escherichia coli UMEA 3292-1]
gb|ERB68043.1| preprotein translocase, SecY subunit [Escherichia coli B102]
gb|ERB70683.1| preprotein translocase, SecY subunit [Escherichia coli B107]
gb|ERB73037.1| preprotein translocase, SecY subunit [Escherichia coli 09BKT076207]
gb|ERB81507.1| preprotein translocase, SecY subunit [Escherichia coli B26-1]
gb|ERB85442.1| preprotein translocase, SecY subunit [Escherichia coli B26-2]
gb|ERB93989.1| preprotein translocase, SecY subunit [Escherichia coli B28-2]
gb|ERB94973.1| preprotein translocase, SecY subunit [Escherichia coli B28-1]
gb|ERC00656.1| preprotein translocase, SecY subunit [Escherichia coli B29-1]
gb|ERC16688.1| preprotein translocase, SecY subunit [Escherichia coli B36-2]
gb|ERC24013.1| preprotein translocase, SecY subunit [Escherichia coli B29-2]
gb|ERC27150.1| preprotein translocase, SecY subunit [Escherichia coli B7-1]
gb|ERC27255.1| preprotein translocase, SecY subunit [Escherichia coli B36-1]
gb|ERC32641.1| preprotein translocase, SecY subunit [Escherichia coli B7-2]
gb|ERC36858.1| preprotein translocase, SecY subunit [Escherichia coli B93]
gb|ERC42023.1| preprotein translocase, SecY subunit [Escherichia coli B94]
gb|ERC49457.1| preprotein translocase, SecY subunit [Escherichia coli B95]
gb|ERC54933.1| preprotein translocase, SecY subunit [Escherichia coli TW07509]
gb|ERC62915.1| preprotein translocase, SecY subunit [Escherichia coli Bd5610_99]
gb|ERC66820.1| preprotein translocase, SecY subunit [Escherichia coli T1840_97]
gb|ERC73012.1| preprotein translocase, SecY subunit [Escherichia coli 08BKT055439]
gb|ERC74101.1| preprotein translocase, SecY subunit [Escherichia coli T234_00]
gb|ERC89270.1| preprotein translocase, SecY subunit [Escherichia coli 2886-75]
gb|ERC92099.1| preprotein translocase, SecY subunit [Escherichia coli T924_01]
gb|ERC92711.1| preprotein translocase, SecY subunit [Escherichia coli 14A]
gb|ERC95677.1| preprotein translocase, SecY subunit [Escherichia coli B104]
gb|ERC96401.1| preprotein translocase, SecY subunit [Escherichia coli B103]
gb|ERD06205.1| preprotein translocase, SecY subunit [Escherichia coli B105]
gb|ERD10275.1| preprotein translocase, SecY subunit [Escherichia coli B106]
gb|ERD11318.1| preprotein translocase, SecY subunit [Escherichia coli B108]
gb|ERD23509.1| preprotein translocase, SecY subunit [Escherichia coli B109]
gb|ERD24785.1| preprotein translocase, SecY subunit [Escherichia coli B112]
gb|ERD28674.1| preprotein translocase, SecY subunit [Escherichia coli B113]
gb|ERD36496.1| preprotein translocase, SecY subunit [Escherichia coli B114]
gb|ERD39529.1| preprotein translocase, SecY subunit [Escherichia coli B15]
gb|ERD45826.1| preprotein translocase, SecY subunit [Escherichia coli B17]
gb|ERD55344.1| preprotein translocase, SecY subunit [Escherichia coli B40-2]
gb|ERD55842.1| preprotein translocase, SecY subunit [Escherichia coli B40-1]
gb|ERD60265.1| preprotein translocase, SecY subunit [Escherichia coli B49-2]
gb|ERD70128.1| preprotein translocase, SecY subunit [Escherichia coli B5-2]
gb|ERD74084.1| preprotein translocase, SecY subunit [Escherichia coli B83]
gb|ERD85872.1| preprotein translocase, SecY subunit [Escherichia coli B85]
gb|ERD92901.1| preprotein translocase, SecY subunit [Escherichia coli B84]
gb|ERD98149.1| preprotein translocase subunit SecY [Escherichia coli 95JB1]
gb|ERD98201.1| preprotein translocase, SecY subunit [Escherichia coli B86]
gb|ERE11608.1| preprotein translocase, SecY subunit [Escherichia coli 08BKT77219]
gb|ERE11653.1| preprotein translocase, SecY subunit [Escherichia coli 09BKT024447]
gb|ERE14974.1| preprotein translocase, SecY subunit [Escherichia coli T1282_01]
gb|ERE22321.1| preprotein translocase, SecY subunit [Escherichia coli B89]
gb|ERE23675.1| preprotein translocase, SecY subunit [Escherichia coli B90]
gb|ERE29604.1| preprotein translocase, SecY subunit [Escherichia coli Tx1686]
gb|ERE39227.1| preprotein translocase, SecY subunit [Escherichia coli Tx3800]
gb|ERF52204.1| preprotein translocase subunit secY [Escherichia coli UMEA 3652-1]
gb|ERF90842.1| preprotein translocase subunit SecY [Escherichia coli O104:H21 str.
CFSAN002237]
gb|AGW10385.1| preprotein translocase subunit SecY [Escherichia coli LY180]
emb|CDH66950.1| hypothetical protein ECOPMV1_03611 [Escherichia coli PMV-1]
gb|AGX35261.1| preprotein translocase membrane subunit [synthetic Escherichia coli
C321.deltaA]
gb|ERO92425.1| preprotein translocase subunit secY [Escherichia coli BWH 24]
gb|ERO98292.1| preprotein translocase subunit secY [Escherichia coli BIDMC 19C]
gb|ESA24787.1| Preprotein translocase secY subunit [Escherichia coli SCD1]
gb|ESA24896.1| Preprotein translocase secY subunit [Escherichia coli SCD2]
gb|ESA68235.1| preprotein translocase, SecY subunit [Escherichia coli 113303]
gb|ESA69966.1| preprotein translocase, SecY subunit [Escherichia coli 113290]
gb|ESA73267.1| preprotein translocase, SecY subunit [Escherichia coli 110957]
gb|ESA79139.1| preprotein translocase, SecY subunit [Escherichia coli 907357]
gb|ESA89197.1| preprotein translocase, SecY subunit [Escherichia coli 907713]
gb|ESA91150.1| preprotein translocase, SecY subunit [Escherichia coli 907779]
gb|ESA98773.1| preprotein translocase, SecY subunit [Escherichia coli 909945-2]
gb|ESD01710.1| preprotein translocase, SecY subunit [Escherichia coli 907446]
gb|ESD02235.1| preprotein translocase, SecY subunit [Escherichia coli 907391]
gb|ESD09996.1| preprotein translocase, SecY subunit [Escherichia coli 907672]
gb|ESD10331.1| preprotein translocase, SecY subunit [Escherichia coli 113302]
gb|ESD17135.1| preprotein translocase, SecY subunit [Escherichia coli 907700]
gb|ESD25767.1| preprotein translocase, SecY subunit [Escherichia coli 907710]
gb|ESD27412.1| preprotein translocase, SecY subunit [Escherichia coli 907701]
gb|ESD28985.1| preprotein translocase, SecY subunit [Escherichia coli 907715]
gb|ESD43131.1| preprotein translocase, SecY subunit [Escherichia coli 907889]
gb|ESD44306.1| preprotein translocase, SecY subunit [Escherichia coli 907892]
gb|ESD45135.1| preprotein translocase, SecY subunit [Escherichia coli 908519]
gb|ESD55397.1| preprotein translocase, SecY subunit [Escherichia coli 908521]
gb|ESD58860.1| preprotein translocase, SecY subunit [Escherichia coli 908522]
gb|ESD62016.1| preprotein translocase, SecY subunit [Escherichia coli 908524]
gb|ESD73137.1| preprotein translocase, SecY subunit [Escherichia coli 908555]
gb|ESD78506.1| preprotein translocase, SecY subunit [Escherichia coli 908525]
gb|ESD78852.1| preprotein translocase, SecY subunit [Escherichia coli 908541]
gb|ESD82729.1| preprotein translocase, SecY subunit [Escherichia coli 908573]
gb|ESD90048.1| preprotein translocase, SecY subunit [Escherichia coli 908585]
gb|ESD95537.1| preprotein translocase, SecY subunit [Escherichia coli 908616]
gb|ESE04691.1| preprotein translocase, SecY subunit [Escherichia coli 908624]
gb|ESE09622.1| preprotein translocase, SecY subunit [Escherichia coli 908658]
gb|ESE11049.1| preprotein translocase, SecY subunit [Escherichia coli 908675]
gb|ESE12040.1| preprotein translocase, SecY subunit [Escherichia coli 908632]
gb|ESE23858.1| preprotein translocase, SecY subunit [Escherichia coli 908691]
gb|ESE25158.1| preprotein translocase, SecY subunit [Escherichia coli 910096-2]
gb|ESE38717.1| preprotein translocase, SecY subunit [Escherichia coli A25922R]
gb|ESE39121.1| preprotein translocase, SecY subunit [Escherichia coli A35218R]
gb|AGY85999.1| preprotein translocase subunit SecY [Escherichia coli JJ1886]
gb|ESK00929.1| preprotein translocase subunit secY [Escherichia coli HVH 98
(4-5799287)]
gb|ESK03487.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3336-1]
gb|ESK12723.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3426-1]
gb|ESK14416.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3290-1]
gb|ESK16573.1| preprotein translocase subunit secY [Escherichia coli HVH 50
(4-2593475)]
gb|ESK24663.1| preprotein translocase subunit secY [Escherichia coli UMEA 3693-1]
gb|ESK26378.1| preprotein translocase subunit SecY [Escherichia coli UMEA 3342-1]
gb|ESK32735.1| preprotein translocase subunit secY [Escherichia coli UMEA 3323-1]
gb|ESL19012.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 39]
gb|ESL33240.1| preprotein translocase subunit secY [Escherichia coli BIDMC 38]
gb|ESL34199.1| preprotein translocase subunit secY [Escherichia coli BIDMC 37]
gb|ESM33372.1| preprotein translocase subunit secY [Escherichia coli BWH 32]
gb|ESP06790.1| preprotein translocase subunit SecY [Escherichia coli HVH 36
(4-5675286)]
gb|ESP13579.1| preprotein translocase subunit secY [Escherichia coli HVH 136
(4-5970458)]
gb|ESP15648.1| preprotein translocase subunit secY [Escherichia coli HVH 12
(4-7653042)]
gb|ESP18316.1| preprotein translocase subunit secY [Escherichia coli HVH 86
(4-7026218)]
gb|ESP29673.1| preprotein translocase subunit secY [Escherichia coli HVH 178
(4-3189163)]
gb|ESP34194.1| preprotein translocase subunit SecY [Escherichia coli HVH 152
(4-3447545)]
gb|ESP37607.1| preprotein translocase subunit secY [Escherichia coli HVH 148
(4-3192490)]
gb|ESP41821.1| preprotein translocase subunit secY [Escherichia coli HVH 108
(4-6924867)]
gb|ESP42107.1| preprotein translocase subunit secY [Escherichia coli UMEA 3148-1]
emb|CDJ73574.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
MC4100]
gb|ESS90669.1| Preprotein translocase secY subunit [Escherichia coli CE549]
gb|ESS94905.1| Preprotein translocase secY subunit [Escherichia coli CE418]
gb|ESS95585.1| Preprotein translocase secY subunit [Escherichia coli CE516]
gb|EST64420.1| preprotein translocase subunit SecY [Escherichia coli ECC-Z]
gb|EST65345.1| preprotein translocase subunit SecY [Escherichia coli P4-96]
gb|EST65885.1| preprotein translocase subunit SecY [Escherichia coli P4-NR]
gb|EST87981.1| preprotein translocase subunit SecY [Escherichia coli ECC-1470]
gb|ESV03527.1| Preprotein translocase secY subunit [Escherichia coli E1777]
gb|ETD42861.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2215]
gb|ETD61947.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2209]
gb|ETE07901.1| preprotein translocase subunit SecY [Escherichia coli LAU-EC8]
gb|ETE15194.1| preprotein translocase subunit SecY [Escherichia coli LAU-EC6]
gb|ETE19595.1| preprotein translocase subunit SecY [Escherichia coli LAU-EC10]
gb|ETE31509.1| preprotein translocase subunit SecY [Escherichia coli LAU-EC7]
gb|ETE36413.1| preprotein translocase subunit SecY [Escherichia coli LAU-EC9]
gb|ETF15432.1| preprotein translocase subunit SecY [Escherichia coli HVH 177
(4-2876612)]
gb|ETF22241.1| preprotein translocase subunit secY [Escherichia coli HVH 23
(4-6066488)]
gb|ETF27175.1| preprotein translocase subunit SecY [Escherichia coli HVH 83
(4-2051087)]
gb|ETF29265.1| preprotein translocase subunit secY [Escherichia coli HVH 214
(4-3062198)]
gb|ETF34161.1| preprotein translocase subunit secY [Escherichia coli UMEA 3489-1]
gb|ETI76746.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2219]
gb|ETI80303.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2196]
gb|ETJ59615.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2193]
gb|ETJ70561.1| preprotein translocase subunit SecY [Escherichia coli ATCC 35150]
gb|ETJ77824.1| preprotein translocase subunit SecY [Escherichia coli ATCC BAA-2192]
emb|CDK48588.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS1]
emb|CDK52268.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS5]
emb|CDK83263.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS25]
emb|CDL28903.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
ISC7]
emb|CDK72715.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Klebsiella
pneumoniae IS22]
emb|CDK60273.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS9]
emb|CDL02379.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS35]
emb|CDK90808.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
IS29]
gb|ETS27152.1| preprotein translocase subunit SecY [Escherichia coli O6:H16:CFA/II
str. B2C]
gb|AHG16675.1| Preprotein translocase secY subunit [Escherichia coli O145:H28 str.
RM13516]
gb|AHG10911.1| Preprotein translocase secY subunit [Escherichia coli O145:H28 str.
RM13514]
gb|ETX79079.1| preprotein translocase subunit secY [Escherichia coli BIDMC 43b]
gb|ETX86949.1| preprotein translocase subunit secY [Escherichia coli BIDMC 43a]
gb|ETX87877.1| preprotein translocase subunit secY [Escherichia coli BIDMC 20B]
gb|ETX91556.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 20A]
gb|ETX99233.1| preprotein translocase subunit secY [Escherichia coli BIDMC 19B]
gb|ETY06795.1| preprotein translocase subunit secY [Escherichia coli BIDMC 19A]
gb|ETY11387.1| preprotein translocase subunit secY [Escherichia coli BIDMC 17B]
gb|ETY17441.1| preprotein translocase subunit secY [Escherichia coli BIDMC 17A]
gb|ETY23637.1| preprotein translocase subunit secY [Escherichia coli BIDMC 15]
gb|ETY29655.1| preprotein translocase subunit secY [Escherichia coli BIDMC 9]
gb|ETY30904.1| preprotein translocase subunit secY [Escherichia coli BIDMC 3]
gb|ETY37575.1| preprotein translocase subunit secY [Escherichia coli BIDMC 2B]
gb|ETY41137.1| preprotein translocase subunit SecY [Escherichia coli BWH 40]
gb|ETY46782.1| preprotein translocase subunit secY [Escherichia coli BWH 34]
gb|ETY54790.1| preprotein translocase subunit secY [Escherichia coli BIDMC 49b]
gb|ETY57407.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 49a]
gb|ETY62608.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 6]
emb|CDL47388.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli
ISC41]
gb|EWC53717.1| preprotein translocase subunit SecY [Escherichia coli EC096/10]
gb|EWY51132.1| preprotein translocase subunit SecY [Escherichia coli MP1]
gb|AHM29620.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AHM32873.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AHM37476.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AHM45542.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AHM50142.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AHM54586.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB44846.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB44982.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB49733.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB59118.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB61249.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYB65702.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYD79970.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S3_C1]
gb|EYD80790.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S1_C1]
gb|EYD82197.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S3_C2]
gb|EYD95413.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S4_C3]
gb|EYD99970.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S4_C1]
gb|EYE08919.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S4_C2]
gb|EYE10219.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S3_C3]
gb|EYE17064.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S1_C3]
gb|EYE18048.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S3_C2]
gb|EYE20488.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S3_C1]
gb|EYE33069.1| preprotein translocase, SecY subunit [Escherichia coli 1-110-08_S1_C1]
gb|EYT07080.1| preprotein translocase subunit secY [Escherichia coli K02]
gb|EYU72516.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-4254]
gb|EYU78417.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4221]
gb|EYU82903.1| preprotein translocase subunit SecY [Escherichia coli O26:NM str.
2010C-4347]
gb|EYU90057.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4086]
gb|EYU94884.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-3977]
gb|EYU96320.1| preprotein translocase subunit SecY [Escherichia coli O45:H2 str.
2010C-3876]
gb|EYV06147.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-3609]
gb|EYV07373.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV10373.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3526]
gb|EYV22244.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3521]
gb|EYV24009.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3517]
gb|EYV26242.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3516]
gb|EYV28106.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3518]
gb|EYV36184.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3510]
gb|EYV37499.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3509]
gb|EYV39267.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3511]
gb|EYV50346.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3507]
gb|EYV64679.1| preprotein translocase subunit SecY [Escherichia coli O103:H11 str.
2010C-3214]
gb|EYV66968.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2009EL2109]
gb|EYV71008.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2009EL1705]
gb|EYV71834.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2009EL1412]
gb|EYV76825.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2009C-4659]
gb|EYV79924.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5806]
gb|EYV86593.1| preprotein translocase subunit SecY [Escherichia coli O86:H34 str.
99-3124]
gb|EYV88341.1| preprotein translocase subunit SecY [Escherichia coli O6:H16 str.
99-3165]
gb|EYV92911.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F7350]
gb|EYV99898.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2288]
gb|EYW03843.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2312]
gb|EYW10626.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2289]
gb|EYW15496.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2286]
gb|EYW19499.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2287]
gb|EYW25346.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2114]
gb|EYW29571.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2112]
gb|EYW31186.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2111]
gb|EYW36674.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2113]
gb|EYW44920.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2108]
gb|EYW45809.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2109]
gb|EYW48552.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2107]
gb|EYW58755.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2105]
gb|EYW63105.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2106]
gb|EYW66045.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2104]
gb|EYW72393.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2103]
gb|EYW77191.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2101]
gb|EYW78907.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2099]
gb|EYW87649.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
08-4487]
gb|EYW88904.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
08-4169]
gb|EYW99386.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
08-4270]
gb|EYX04944.1| preprotein translocase subunit SecY [Escherichia coli O118:H16 str.
08-3651]
gb|EYX07104.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
08-3527]
gb|EYX11087.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
08-3037]
gb|EYX13274.1| preprotein translocase subunit SecY [Escherichia coli O69:H11 str.
07-4281]
gb|EYX21189.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2097]
gb|EYX21454.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2098]
gb|EYX30910.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2096]
gb|EYX35362.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2094]
gb|EYX39284.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2093]
gb|EYX43304.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2092]
gb|EYX47315.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2091]
gb|EYX52654.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2090]
gb|EYX58912.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
2011EL-1675A]
gb|EYX69066.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-1107]
gb|EYX71967.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2011C-3632]
gb|EYX77703.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2011C-3679]
gb|EYX89001.1| preprotein translocase subunit SecY [Escherichia coli O103:H2 str.
2011C-3750]
gb|EYX92088.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3537]
gb|EYX94515.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2011C-3573]
gb|EYY01516.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3500]
gb|EYY05243.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2011C-3362]
gb|EYY05899.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3216]
gb|EYY17357.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2011C-3170]
gb|EYY18670.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3108]
gb|EYY25040.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3072]
gb|EYY30310.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010EL1058]
gb|EYY32372.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-4989]
gb|EYY37694.1| preprotein translocase subunit SecY [Escherichia coli O153:H2 str.
2010C-5034]
gb|EYY45414.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2010C-4979C1]
gb|EYY45754.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-4966]
gb|EYY54257.1| preprotein translocase subunit SecY [Escherichia coli O165:H25 str.
2010C-4874]
gb|EYY60319.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-4824]
gb|EYY63909.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4818]
gb|EYY64654.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4799]
gb|EYY75485.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4735]
gb|EYY76076.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4746]
gb|EYY82564.1| preprotein translocase subunit SecY [Escherichia coli O26:NM str.
2010C-4788]
gb|EYY87010.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-4732]
gb|EYY89063.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4715]
gb|EYY89350.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4622]
gb|EYZ03835.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-4592]
gb|EYZ10163.1| preprotein translocase subunit SecY [Escherichia coli O177:NM str.
2010C-4558]
gb|EYZ14659.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-4557C2]
gb|EYZ23433.1| preprotein translocase subunit SecY [Escherichia coli O103:H2 str.
2010C-4433]
gb|EYZ24771.1| preprotein translocase subunit SecY [Escherichia coli O103:H25 str.
2010C-4529]
gb|EYZ26074.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
07-3091]
gb|EYZ26698.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
07-3391]
gb|EYZ34414.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
06-4039]
gb|EYZ40297.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
06-3822]
gb|EYZ40569.1| preprotein translocase subunit SecY [Escherichia coli O91:H14 str.
06-3691]
gb|EYZ43173.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
06-3745]
gb|EYZ55568.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str.
06-3555]
gb|EYZ59181.1| preprotein translocase subunit SecY [Escherichia coli O79:H7 str.
06-3501]
gb|EYZ62661.1| preprotein translocase subunit SecY [Escherichia coli O118:H16 str.
06-3612]
gb|EYZ70084.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
06-3484]
gb|EYZ70754.1| preprotein translocase subunit SecY [Escherichia coli O69:H11 str.
06-3325]
gb|EYZ78712.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
04-3211]
gb|EYZ79806.1| preprotein translocase subunit SecY [Escherichia coli O118:H16 str.
06-3256]
gb|EYZ81419.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
06-3003]
gb|EYZ93821.1| preprotein translocase subunit SecY [Escherichia coli O119:H4 str.
03-3458]
gb|EZA00619.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
03-3484]
gb|EZA00928.1| preprotein translocase subunit SecY [Escherichia coli O174:H21 str.
03-3269]
gb|EZA06161.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
03-3227]
gb|EZA14787.1| preprotein translocase subunit SecY [Escherichia coli O81:NM str.
02-3012]
gb|EZA18705.1| preprotein translocase subunit SecY [Escherichia coli O113:H21 str.
07-4224]
gb|EZA30957.1| preprotein translocase subunit SecY [Escherichia coli O45:H2 str.
01-3147]
gb|EZA37627.1| preprotein translocase subunit SecY [Escherichia coli O174:H8 str.
04-3038]
gb|EZA39411.1| preprotein translocase subunit SecY [Escherichia coli O103:H11 str.
04-3023]
gb|EZA43676.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
05-3646]
gb|EZA66183.1| preprotein translocase subunit SecY [Escherichia coli O104:H21 str.
94-3025]
gb|EZA68109.1| preprotein translocase subunit SecY [Escherichia coli O157:H16 str.
98-3133]
gb|EZA75302.1| preprotein translocase subunit SecY [Escherichia coli O6:H16 str.
F5656C1]
gb|EZA78427.1| preprotein translocase subunit SecY [Escherichia coli O25:NM str.
E2539C1]
gb|EZA84006.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
F6627]
gb|EZA87832.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F6142]
gb|EZA91627.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
F6714]
gb|EZA97343.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F6750]
gb|EZA98821.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F6749]
gb|EZB06952.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F6751]
gb|EZB10839.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F7377]
gb|EZB11874.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F7384]
gb|EZB20658.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
F7410]
gb|EZB23476.1| preprotein translocase subunit SecY [Escherichia coli O169:H41 str.
F9792]
gb|EZB30031.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
G5303]
gb|EZB38769.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
H2498]
gb|EZB40180.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
H2495]
gb|EZB47893.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1420]
gb|EZB50954.1| preprotein translocase subunit SecY [Escherichia coli O15:H18 str.
K1516]
gb|EZB51795.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1792]
gb|EZB52214.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1793]
gb|EZB66724.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1845]
gb|EZB75373.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1796]
gb|EZB76033.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1795]
gb|EZB82045.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2188]
gb|EZB87700.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1927]
gb|EZB92021.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K1921]
gb|EZB96300.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2192]
gb|EZB98843.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2324]
gb|EZC02894.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2191]
gb|EZC17471.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2581]
gb|EZC20017.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2622]
gb|EZC23252.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2854]
gb|EZC24735.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K4396]
gb|EZC25338.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K2845]
gb|EZC34079.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K4405]
gb|EZC43570.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K4406]
gb|EZC46893.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
K5198]
gb|EZC48368.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K4527]
gb|EZC55343.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5418]
gb|EZC57742.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
K5269]
gb|EZC69583.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5448]
gb|EZC75951.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5453]
gb|EZC76291.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5449]
gb|EZC82466.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5460]
gb|EZC84302.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5467]
gb|EZC93800.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5602]
gb|EZC98349.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5607]
gb|EZD03428.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5609]
gb|EZD08272.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K5852]
gb|EZD14432.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K6676]
gb|EZD16900.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K6590]
gb|EZD24085.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K6687]
gb|EZD40591.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
K6895]
gb|EZD59095.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
K6908]
gb|EZD71547.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
K7140]
gb|EZD78068.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
08-4529]
gb|EZD78419.1| preprotein translocase subunit SecY [Escherichia coli O39:NM str.
F8704-2]
gb|EZD80168.1| preprotein translocase subunit SecY [Escherichia coli O157:NM str.
08-4540]
gb|EZD96205.1| preprotein translocase subunit SecY [Escherichia coli O91:H14 str.
2009C-3227]
gb|EZD99976.1| preprotein translocase subunit SecY [Escherichia coli O145:H28 str.
2009C-3292]
gb|EZE00281.1| preprotein translocase subunit SecY [Escherichia coli O69:H11 str.
08-4661]
gb|EZE01382.1| preprotein translocase subunit SecY [Escherichia coli O103:H2 str.
2009C-3279]
gb|EZE12822.1| preprotein translocase subunit SecY [Escherichia coli O121:H7 str.
2009C-3299]
gb|EZE17488.1| preprotein translocase subunit SecY [Escherichia coli O69:H11 str.
2009C-3601]
gb|EZE20024.1| preprotein translocase subunit SecY [Escherichia coli O123:H11 str.
2009C-3307]
gb|EZE21757.1| preprotein translocase subunit SecY [Escherichia coli O45:H2 str.
2009C-3686]
gb|EZE35831.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2009C-4006]
gb|EZE37335.1| preprotein translocase subunit SecY [Escherichia coli O91:NM str.
2009C-3745]
gb|EZE38444.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2009C-4050]
gb|EZE41922.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2009C-4052]
gb|EZE54479.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2009C-4258]
gb|EZE56603.1| preprotein translocase subunit SecY [Escherichia coli O118:H16 str.
2009C-4446]
gb|EZE62733.1| preprotein translocase subunit SecY [Escherichia coli O91:H21 str.
2009C-4646]
gb|EZE65780.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2009C-4750]
gb|EZE71958.1| preprotein translocase subunit SecY [Escherichia coli O45:H2 str.
2009C-4780]
gb|EZE79072.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2009EL1302]
gb|EZE87947.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2009EL1913]
gb|EZE89767.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2009EL1449]
gb|EZE95504.1| preprotein translocase subunit SecY [Escherichia coli O145:NM str.
2010C-3508]
gb|EZE96697.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2010C-3794]
gb|EZF01099.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2313]
gb|EZF01261.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
2011EL-2290]
gb|EZG30198.1| preprotein translocase subunit SecY [Escherichia coli E1728]
gb|EZG45569.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
03-3500]
gb|EZG47161.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
06-3464]
gb|EZG57036.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-4819]
gb|EZG57913.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-4430]
gb|EZG67481.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-4834]
gb|EZG73734.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-5028]
gb|EZG79682.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010EL-1699]
gb|EZG80220.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3270]
gb|EZG92022.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3282]
gb|EZG94019.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3506]
gb|EZH00211.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3387]
gb|EZH05945.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3655]
gb|EZH08205.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2009C-3689]
gb|EZH13872.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2009C-3612]
gb|EZH21614.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2009C-3996]
gb|EZH22611.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2009C-4760]
gb|EZH30009.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2009C-4826]
gb|EZH35741.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-3051]
gb|EZH38662.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-3871]
gb|EZH42622.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-3472]
gb|EZH47177.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-3902]
gb|EZH52010.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2010C-4244]
gb|EZJ16983.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S4_C3]
gb|EZJ17517.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S4_C3]
gb|EZJ26829.1| preprotein translocase, SecY subunit [Escherichia coli 1-392-07_S4_C2]
gb|EZJ33624.1| preprotein translocase, SecY subunit [Escherichia coli 1-250-04_S4_C2]
gb|EZJ39234.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S4_C2]
gb|EZJ59168.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S4_C1]
gb|EZJ62649.1| preprotein translocase, SecY subunit [Escherichia coli 1-250-04_S4_C1]
gb|EZJ67381.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S4_C1]
gb|EZJ90165.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S3_C1]
gb|EZJ93231.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S1_C3]
gb|EZJ95341.1| preprotein translocase, SecY subunit [Escherichia coli 1-250-04_S1_C3]
gb|EZK06091.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S1_C3]
gb|EZK16412.1| preprotein translocase, SecY subunit [Escherichia coli 1-176-05_S1_C2]
gb|EZK27062.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S1_C1]
gb|EZK29245.1| preprotein translocase, SecY subunit [Escherichia coli 2-005-03_S1_C2]
gb|EZK36774.1| preprotein translocase, SecY subunit [Escherichia coli 2-005-03_S1_C1]
gb|EZQ21113.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
2010C-3053]
gb|EZQ22633.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
2009EL-2169]
gb|EZQ34722.1| preprotein translocase subunit SecY [Escherichia coli O26:H1 str.
2009C-4747]
gb|EZQ37230.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
2009C-4126]
gb|EZQ40768.1| preprotein translocase subunit SecY [Escherichia coli O111:H8 str.
2011C-3453]
gb|EZQ49725.1| preprotein translocase subunit SecY [Escherichia coli O157: str.
2010EL-2045]
gb|EZQ54970.1| preprotein translocase subunit SecY [Escherichia coli O157: str.
2010EL-2044]
gb|EZQ55783.1| preprotein translocase subunit secY [Escherichia coli BIDMC 83]
gb|EZQ58931.1| preprotein translocase subunit secY [Escherichia coli BIDMC 82]
gb|AHY66998.1| Preprotein translocase secY subunit [Escherichia coli O145:H28 str.
RM12761]
gb|AHY72732.1| Preprotein translocase secY subunit [Escherichia coli O145:H28 str.
RM12581]
gb|KCW94571.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDA56360.1| preprotein translocase, SecY subunit [Escherichia coli 2-011-08_S1_C1]
gb|KDA66749.1| preprotein translocase, SecY subunit [Escherichia coli 1-182-04_S1_C2]
gb|KDA71987.1| preprotein translocase, SecY subunit [Escherichia coli 2-005-03_S3_C2]
gb|KDA77571.1| preprotein translocase, SecY subunit [Escherichia coli 2-011-08_S3_C2]
emb|CDP70360.1| Protein translocase subunit SecY [Escherichia coli]
emb|CDP67329.1| Protein translocase subunit SecY [Escherichia coli D6-113.11]
emb|CDP76751.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
gb|KDF64848.1| preprotein translocase subunit secY [Escherichia coli BIDMC 59]
gb|KDF71958.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 58]
gb|KDF83395.1| preprotein translocase subunit secY [Escherichia coli BIDMC 62]
gb|KDF84442.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 64]
gb|KDF85297.1| preprotein translocase subunit secY [Escherichia coli BIDMC 63]
gb|KDF94442.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 65]
gb|KDF99841.1| preprotein translocase subunit secY [Escherichia coli BIDMC 70]
gb|KDG04774.1| preprotein translocase subunit secY [Escherichia coli BIDMC 72]
gb|KDG05110.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 71]
gb|KDG14712.1| preprotein translocase subunit secY [Escherichia coli BIDMC 73]
gb|KDG18783.1| preprotein translocase subunit secY [Escherichia coli BIDMC 74]
gb|KDG21646.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 75]
gb|KDG25642.1| preprotein translocase subunit secY [Escherichia coli BIDMC 76]
gb|KDG38946.1| preprotein translocase subunit SecY [Escherichia coli BIDMC 78]
gb|KDG41051.1| preprotein translocase subunit secY [Escherichia coli BIDMC 77]
gb|KDG43082.1| preprotein translocase subunit secY [Escherichia coli BIDMC 79]
gb|KDG47471.1| preprotein translocase subunit SecY [Escherichia coli CHS 68]
gb|KDG55802.1| preprotein translocase subunit secY [Escherichia coli CHS 77]
gb|KDG57961.1| preprotein translocase subunit secY [Escherichia coli CHS 69]
gb|KDG63096.1| preprotein translocase subunit SecY [Escherichia coli MGH 57]
gb|KDG66970.1| preprotein translocase subunit SecY [Escherichia coli UCI 51]
gb|KDG72343.1| preprotein translocase subunit secY [Escherichia coli MGH 58]
gb|KDG74978.1| preprotein translocase subunit secY [Escherichia coli UCI 53]
gb|KDG82621.1| preprotein translocase subunit SecY [Escherichia coli UCI 57]
gb|KDG83067.1| preprotein translocase subunit SecY [Escherichia coli UCI 58]
gb|KDG92161.1| preprotein translocase subunit secY [Escherichia coli UCI 65]
gb|KDG94189.1| preprotein translocase subunit secY [Escherichia coli UCI 66]
gb|KDM70822.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDM74089.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDM82069.1| preprotein translocase subunit SecY [Escherichia coli O145:H28 str.
4865/96]
gb|KDM85281.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDN05077.1| Preprotein translocase secY subunit [Escherichia coli]
emb|CDN84039.1| putative ATPase subunit of translocase [Escherichia coli O25b:H4-ST131]
gb|KDO89012.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDP15510.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KDS97594.1| preprotein translocase, SecY subunit [Escherichia coli 2-011-08_S1_C3]
gb|KDT03435.1| preprotein translocase, SecY subunit [Escherichia coli 2-011-08_S4_C1]
gb|KDT10095.1| preprotein translocase, SecY subunit [Escherichia coli 2-052-05_S1_C3]
gb|KDT12705.1| preprotein translocase, SecY subunit [Escherichia coli 2-052-05_S3_C1]
gb|KDT30984.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S1_C1]
gb|KDT53206.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S4_C3]
gb|KDT70880.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S3_C1]
gb|KDT72314.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S3_C3]
gb|KDT77637.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S1_C2]
gb|KDT83319.1| preprotein translocase, SecY subunit [Escherichia coli 3-475-03_S4_C1]
gb|KDT84862.1| preprotein translocase, SecY subunit [Escherichia coli 3-475-03_S1_C1]
gb|KDT91352.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S4_C1]
gb|KDU07080.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S3_C3]
gb|KDU08381.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S3_C2]
gb|KDU19619.1| preprotein translocase, SecY subunit [Escherichia coli 3-267-03_S1_C1]
gb|KDU28340.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S4_C2]
gb|KDU36087.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S1_C3]
gb|KDU44277.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S1_C1]
gb|KDU51840.1| preprotein translocase, SecY subunit [Escherichia coli 3-475-03_S4_C2]
gb|KDU62684.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S1_C1]
gb|KDU65546.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S4_C3]
gb|KDV12436.1| preprotein translocase subunit SecY [Escherichia coli O78:H12 str.
00-3279]
gb|KDV16117.1| preprotein translocase subunit SecY [Escherichia coli O111:NM str.
01-3076]
gb|KDV33658.1| preprotein translocase subunit SecY [Escherichia coli O69:H11 str.
07-3763]
gb|KDV36913.1| preprotein translocase subunit SecY [Escherichia coli O145:H25 str.
07-3858]
gb|KDV41074.1| preprotein translocase subunit SecY [Escherichia coli O146:H21 str.
2010C-3325]
gb|KDV45096.1| preprotein translocase subunit SecY [Escherichia coli O91:H21 str.
2009C-3740]
gb|KDV53715.1| preprotein translocase subunit SecY [Escherichia coli O121:H19 str.
2011C-3609]
gb|KDV58517.1| preprotein translocase subunit SecY [Escherichia coli O45:H2 str.
2010C-4211]
gb|KDV63339.1| preprotein translocase subunit SecY [Escherichia coli O128:H2 str.
2011C-3317]
gb|KDV68759.1| preprotein translocase subunit SecY [Escherichia coli O26:H11 str.
2011C-3274]
gb|KDV74415.1| preprotein translocase subunit SecY [Escherichia coli O118:H16 str.
07-4255]
gb|KDV78815.1| preprotein translocase, SecY subunit [Escherichia coli 2-052-05_S3_C3]
gb|KDV79897.1| preprotein translocase, SecY subunit [Escherichia coli 2-052-05_S4_C2]
gb|KDV98925.1| preprotein translocase, SecY subunit [Escherichia coli 2-156-04_S3_C1]
gb|KDW14029.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S3_C1]
gb|KDW14906.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S1_C1]
gb|KDW16819.1| preprotein translocase, SecY subunit [Escherichia coli 2-156-04_S4_C1]
gb|KDW29037.1| preprotein translocase, SecY subunit [Escherichia coli 2-156-04_S3_C2]
gb|KDW29335.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S1_C2]
gb|KDW38239.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S1_C3]
gb|KDW51996.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S1_C3]
gb|KDW63835.1| preprotein translocase, SecY subunit [Escherichia coli 2-005-03_S3_C3]
gb|KDW77612.1| preprotein translocase, SecY subunit [Escherichia coli 1-392-07_S1_C2]
gb|KDW91489.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S1_C2]
gb|KDW96473.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S3_C2]
gb|KDX19251.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S3_C3]
gb|KDX25167.1| preprotein translocase, SecY subunit [Escherichia coli 1-250-04_S1_C2]
gb|KDX39129.1| preprotein translocase, SecY subunit [Escherichia coli 2-156-04_S4_C3]
gb|KDX42313.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S3_C2]
gb|KDX48272.1| preprotein translocase, SecY subunit [Escherichia coli 2-177-06_S4_C1]
gb|KDX53930.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S3_C1]
gb|KDX63538.1| preprotein translocase, SecY subunit [Escherichia coli 2-210-07_S4_C3]
gb|KDX64083.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S1_C1]
gb|KDX72194.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S1_C2]
gb|KDX84369.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S3_C3]
gb|KDX86689.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S4_C2]
gb|KDX92696.1| preprotein translocase, SecY subunit [Escherichia coli 2-316-03_S3_C1]
gb|KDX97193.1| preprotein translocase, SecY subunit [Escherichia coli 2-316-03_S3_C2]
gb|KDY08138.1| preprotein translocase, SecY subunit [Escherichia coli 2-316-03_S4_C1]
gb|KDY24894.1| preprotein translocase, SecY subunit [Escherichia coli 2-427-07_S1_C2]
gb|KDY41020.1| preprotein translocase, SecY subunit [Escherichia coli 2-427-07_S4_C2]
gb|KDY48312.1| preprotein translocase, SecY subunit [Escherichia coli 2-427-07_S4_C1]
gb|KDY51766.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S3_C1]
gb|KDY58713.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S3_C2]
gb|KDY60596.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S3_C3]
gb|KDY73021.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S4_C3]
gb|KDY93535.1| preprotein translocase, SecY subunit [Escherichia coli 2-474-04_S3_C2]
gb|KDY99976.1| preprotein translocase, SecY subunit [Escherichia coli 2-474-04_S1_C2]
gb|KDZ00874.1| preprotein translocase, SecY subunit [Escherichia coli 2-474-04_S4_C2]
gb|KDZ09705.1| preprotein translocase, SecY subunit [Escherichia coli 2-474-04_S4_C3]
gb|KDZ23180.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S1_C2]
gb|KDZ30273.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S1_C3]
gb|KDZ37471.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S4_C2]
gb|KDZ40422.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S3_C1]
gb|KDZ46445.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S4_C3]
gb|KDZ62418.1| preprotein translocase, SecY subunit [Escherichia coli 3-073-06_S3_C1]
gb|KDZ62479.1| preprotein translocase, SecY subunit [Escherichia coli 3-073-06_S3_C2]
gb|KDZ72573.1| preprotein translocase, SecY subunit [Escherichia coli 3-073-06_S4_C2]
gb|KDZ86267.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S1_C3]
gb|KDZ87661.1| preprotein translocase, SecY subunit [Escherichia coli 3-105-05_S1_C2]
gb|KEJ07325.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S4_C2]
gb|KEJ08248.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S4_C1]
gb|KEJ23836.1| preprotein translocase, SecY subunit [Escherichia coli 2-316-03_S1_C2]
gb|KEJ27982.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S4_C3]
gb|KEJ37803.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S1_C3]
gb|KEJ44476.1| preprotein translocase, SecY subunit [Escherichia coli 2-427-07_S4_C3]
gb|KEJ47900.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S4_C1]
gb|KEJ57380.1| preprotein translocase, SecY subunit [Escherichia coli 3-020-07_S3_C2]
gb|KEJ57896.1| preprotein translocase, SecY subunit [Escherichia coli 3-267-03_S4_C1]
gb|KEJ72527.1| preprotein translocase, SecY subunit [Escherichia coli 5-366-08_S1_C3]
gb|KEK74067.1| preprotein translocase, SecY subunit [Escherichia coli 3-475-03_S3_C1]
gb|KEK76840.1| preprotein translocase, SecY subunit [Escherichia coli 3-475-03_S1_C2]
gb|KEK91082.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S1_C2]
gb|KEK93233.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S1_C3]
gb|KEK96452.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S3_C3]
gb|KEL07131.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S4_C2]
gb|KEL07983.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S3_C2]
gb|KEL14334.1| preprotein translocase, SecY subunit [Escherichia coli 4-203-08_S3_C1]
gb|KEL21876.1| preprotein translocase, SecY subunit [Escherichia coli 3-373-03_S4_C3]
gb|KEL23007.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S4_C2]
gb|KEL32085.1| preprotein translocase, SecY subunit [Escherichia coli 5-366-08_S4_C2]
gb|KEL36554.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S4_C1]
gb|KEL41851.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S3_C3]
gb|KEL48693.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S3_C1]
gb|KEL57670.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S1_C3]
gb|KEL61363.1| preprotein translocase, SecY subunit [Escherichia coli 5-172-05_S4_C3]
gb|KEL70783.1| preprotein translocase, SecY subunit [Escherichia coli 5-366-08_S3_C3]
gb|KEL87982.1| preprotein translocase, SecY subunit [Escherichia coli 5-366-08_S3_C1]
gb|KEL89957.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S3_C1]
gb|KEL99165.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S3_C3]
gb|KEM03286.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S4_C2]
gb|KEM04309.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S4_C1]
gb|KEM11480.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S1_C2]
gb|KEM19325.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S3_C1]
gb|KEM28221.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S3_C2]
gb|KEM29672.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S4_C2]
gb|KEM46102.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S4_C3]
gb|KEM50839.1| preprotein translocase, SecY subunit [Escherichia coli 6-175-07_S1_C3]
gb|KEM58078.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S4_C3]
gb|KEM59076.1| preprotein translocase, SecY subunit [Escherichia coli 6-319-05_S3_C3]
gb|KEM60481.1| preprotein translocase, SecY subunit [Escherichia coli 7-233-03_S1_C2]
gb|KEM70314.1| preprotein translocase, SecY subunit [Escherichia coli 7-233-03_S3_C1]
gb|KEN21916.1| preprotein translocase, SecY subunit [Escherichia coli 7-233-03_S3_C2]
gb|KEN22448.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S1_C1]
gb|KEN31624.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S3_C3]
gb|KEN38134.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S3_C1]
gb|KEN49218.1| preprotein translocase, SecY subunit [Escherichia coli 7-233-03_S4_C3]
gb|KEN52789.1| preprotein translocase, SecY subunit [Escherichia coli 6-537-08_S1_C3]
gb|KEN64795.1| preprotein translocase, SecY subunit [Escherichia coli 1-392-07_S4_C3]
gb|KEN83267.1| preprotein translocase, SecY subunit [Escherichia coli 2-474-04_S4_C1]
gb|KEN87446.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S3_C1]
gb|KEN90019.1| preprotein translocase, SecY subunit [Escherichia coli 2-222-05_S3_C2]
gb|KEN97399.1| preprotein translocase, SecY subunit [Escherichia coli 1-392-07_S4_C1]
gb|KEO07102.1| preprotein translocase, SecY subunit [Escherichia coli 8-415-05_S1_C2]
gb|KEO21974.1| preprotein translocase, SecY subunit [Escherichia coli 5-366-08_S4_C1]
gb|KEO27264.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S1_C1]
gb|KEO37293.1| preprotein translocase, SecY subunit [Escherichia coli 2-460-02_S1_C2]
gb|AID80432.1| preprotein translocase subunit SecY [Escherichia coli Nissle 1917]
gb|KEO96355.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP00772.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP02934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP08993.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP16122.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP16773.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KEP77754.1| preprotein translocase subunit SecY [Escherichia coli E1140]
gb|AIF38585.1| preprotein translocase subunit SecY [Escherichia coli KLY]
gb|AIF63441.1| preprotein translocase subunit SecY [Escherichia coli B7A]
emb|CDU34520.1| Protein translocase subunit SecY [Escherichia coli D6-113.11]
emb|CDU37551.1| Protein translocase subunit SecY [Escherichia coli]
gb|AIF95836.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
SS17]
gb|AIG70665.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
EDL933]
gb|KFB96761.1| preprotein translocase subunit [Escherichia coli DSM 30083 = JCM 1649 =
ATCC 11775]
gb|KFD78013.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFF38542.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFF53393.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH75447.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH76588.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH77475.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH88756.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH90134.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFH98774.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AIL17571.1| preprotein translocase, SecY subunit [Escherichia coli ATCC 25922]
gb|AIL37634.1| preprotein translocase, SecY subunit [Shigella flexneri 2003036]
gb|AIL42579.1| preprotein translocase, SecY subunit [Shigella flexneri Shi06HN006]
gb|KFV22728.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFV26625.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFV30338.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KFV37448.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CEE06302.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|AIN33632.1| preprotein translocase membrane subunit [Escherichia coli BW25113]
gb|KFZ97956.1| preprotein translocase, SecY subunit [Shigella flexneri]
gb|KGA85688.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CDY63737.1| SecY, subunit of SecEGY-Secretion Complex and Sec Protein Secretion
Complex [Escherichia coli]
emb|CDZ22075.1| SecY, subunit of SecEGY-Secretion Complex and Sec Protein Secretion
Complex [Escherichia coli]
gb|KGI46751.1| Preprotein translocase secY subunit [Escherichia coli]
gb|AIT36455.1| preprotein translocase subunit SecY [Escherichia coli FAP1]
gb|KGL68677.1| preprotein translocase membrane subunit [Escherichia coli NCTC 50110]
gb|KGM62001.1| Preprotein translocase subunit SecY [Escherichia coli G3/10]
gb|KGM66662.1| Preprotein translocase subunit SecY [Escherichia coli]
gb|KGM71788.1| Preprotein translocase subunit SecY [Escherichia coli]
gb|KGM75678.1| Preprotein translocase subunit SecY [Escherichia coli]
gb|KGM83980.1| Preprotein translocase subunit SecY [Escherichia coli]
gb|KGM85336.1| Preprotein translocase subunit SecY [Escherichia coli]
gb|KGP14460.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGP15290.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGP43286.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGP46773.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGT22758.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGT24874.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KGT29555.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CDX08724.1| preprotein translocase subunit SecY,hypothetical protein,preprotein
translocase subunit SecY,Preprotein translocase subunit
SecY,preprotein translocase, SecY subunit,SecY translocase
[Shigella flexneri]
gb|AIX65248.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHD33755.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHD44554.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHD48736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHD51559.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG72365.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG72938.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG76805.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG84716.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG91726.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHG94604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH03619.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH04085.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH07970.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH13926.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH26491.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH27006.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH39017.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH45703.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH46432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH49922.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH53018.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH58688.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH59881.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH65591.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH73130.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH75145.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH75644.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH93341.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH95497.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH98548.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHH98710.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI05837.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI12607.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI13193.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI23804.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI26447.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI27240.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI38925.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI41419.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI48060.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI50515.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI52189.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI55552.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI63938.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI71865.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI73689.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI75413.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI83853.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI91325.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI92469.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHI99030.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHJ04995.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHJ11466.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHJ18546.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHJ20159.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KHJ23143.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AIZ84347.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AIZ88925.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AIZ89697.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|AJA28299.1| Preprotein translocase secY subunit [Escherichia coli O157:H7 str.
SS52]
gb|KHO58637.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CEK07312.1| preprotein translocase membrane subunit [Escherichia coli O26:H11]
gb|AJB36510.1| preprotein translocase membrane subunit [Escherichia coli APEC IMT5155]
gb|AJB53320.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CCQ30821.2| preprotein translocase membrane subunit [Escherichia coli]
gb|KIE65217.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIE65278.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIE76151.1| preprotein translocase subunit SecY [Escherichia coli RS218]
gb|KIE76194.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG27168.1| preprotein translocase subunit SecY [Escherichia coli C691-71 (14b)]
gb|KIG33546.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG42284.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG49984.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG60290.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG61488.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG64334.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG78125.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG79608.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG83406.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG84814.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIG94013.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH03163.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH03231.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH09002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH11262.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH21126.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH21931.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH22866.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIH35537.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AJE57860.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KII00922.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AJF58108.1| preprotein translocase membrane subunit [Escherichia coli 1303]
gb|AJF78405.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIN83447.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AJG10318.1| preprotein translocase membrane subunit [Escherichia coli ECC-1470]
gb|KIO41874.1| preprotein translocase subunit SecY [Escherichia coli O139:H28 str.
E24377A]
gb|AJH11920.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIO85869.1| preprotein translocase, SecY subunit [Escherichia coli 97.0264]
gb|KIQ42372.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIQ44805.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AJM75499.1| preprotein translocase subunit SecY [Escherichia coli RS218]
gb|AJO85358.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIY26211.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ08068.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ65597.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ69034.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ73366.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ78003.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ83585.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ85639.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ91336.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ97045.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KIZ98369.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJA04637.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD60250.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD64479.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD71751.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD72337.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD83343.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD86555.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJD93234.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJG95061.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJG98875.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJH08825.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJH99429.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJI09416.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJI17226.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJJ45753.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJJ75162.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KJJ79929.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KJW26893.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW30037.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW32615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW43048.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW43098.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW44580.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW54218.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW59138.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW69520.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJW72007.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KJY12677.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKA92479.1| protein translocase subunit SecY [Escherichia coli VR50]
emb|CQR82717.1| preprotein translocase membrane subunit [Escherichia coli K-12]
gb|KKA58711.1| preprotein translocase, SecY subunit [Escherichia coli 9.1649]
gb|AKC14548.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKD93398.1| preprotein translocase subunit SecY [Escherichia coli K-12]
gb|KKF75437.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|KKF85485.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|KKJ20047.1| preprotein translocase subunit SecY [Escherichia coli MRSN 10204]
gb|AKE87296.1| preprotein translocase subunit SecY [Escherichia coli O104:H4 str.
C227-11]
gb|KKK00916.1| preprotein translocase subunit SecY [Escherichia coli NB8]
gb|KKK31223.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KKO25378.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KKO29510.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KKO34476.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KKO38558.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKF22482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKF57062.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AKF61202.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AKF65340.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AKF69480.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AKF73619.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KLD43916.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLD45517.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG28878.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG37517.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG46085.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG46364.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG53280.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG59063.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG61630.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG67951.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG70960.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG81155.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG88539.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLG91420.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH00996.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH02338.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH09723.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH10413.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH13664.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH20653.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH22419.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH31219.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH34036.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH40944.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH46479.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH54258.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH57160.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH61852.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH63079.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH66790.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH76733.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH87630.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH90635.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLH91218.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKI68292.1| preprotein translocase subunit SecY [Shigella boydii]
gb|AKK14905.1| preprotein translocase membrane subunit protein [Escherichia coli K-12]
gb|AKK19039.1| preprotein translocase membrane subunit protein [Escherichia coli K-12]
gb|AKK50131.1| preprotein translocase membrane subunit [Escherichia coli PCN033]
gb|AKK41519.1| preprotein translocase subunit SecY [Escherichia coli APEC O2-211]
gb|AKK44467.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKK55789.1| preprotein translocase subunit SecY [Shigella flexneri G1663]
gb|AKM36842.1| preprotein translocase membrane subunit [Escherichia coli PCN061]
gb|KLU95539.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KLW96723.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX00122.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX00691.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX14585.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX18957.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX27249.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX30069.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX32881.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX44736.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX47968.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX51769.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX53699.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX63275.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX64263.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX69882.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX73506.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX81471.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX85035.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX91838.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX94232.1| protein translocase subunit SecY [Escherichia coli]
gb|KLX98463.1| protein translocase subunit SecY [Escherichia coli]
gb|KLY05062.1| protein translocase subunit SecY [Escherichia coli]
gb|KME66835.1| protein translocase subunit SecY [Escherichia coli]
gb|AKN49158.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKO54471.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKP86271.1| preprotein translocase subunit SecY [Escherichia coli ACN001]
emb|CEP58812.1| preprotein translocase subunit SecY [Shigella flexneri 2a]
gb|KMV37399.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KMV42149.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KMV43982.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KMV45708.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KMV56327.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KMV59363.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKR22107.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKR26462.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKR30938.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNA42162.1| preprotein translocase [Escherichia coli M114]
gb|KNF11552.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF13386.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF17615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF27137.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF27883.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF30743.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF38124.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF43087.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF53944.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF55067.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF65556.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF69738.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF71291.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF73159.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF82927.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF90074.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF94627.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNF98123.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG04161.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG05763.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG06995.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG19855.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG21652.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG30186.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG34231.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNG34392.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNX99134.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY52946.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY54837.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY56835.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY67530.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY69734.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY76440.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY84681.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY85875.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY95931.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY96408.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNY98413.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNZ12183.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNZ13823.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNZ18688.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNZ21419.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KNZ97805.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOA24474.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOA30809.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOA34899.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CTX15263.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX13801.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX18417.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX25102.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR57304.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR62273.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU78289.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU97110.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR78222.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV79736.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS52566.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR54243.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR68568.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW15865.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS31262.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW05320.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT57261.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW02641.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU19782.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT58329.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW20977.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS83745.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU28442.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT81241.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV49352.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS19250.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX09184.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU34731.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW43032.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS69305.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW62939.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU42746.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS54192.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS56041.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU07967.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS79923.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW28066.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT33820.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTR55124.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT62197.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS10051.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW12863.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW70429.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW24321.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX10197.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW53260.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT23764.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW06300.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW82249.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT44225.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV92693.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT22232.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT54531.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT35599.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW57616.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW26777.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT25236.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU40436.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW40763.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT43454.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT52947.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV73602.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT45168.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT01676.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU64980.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS91422.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT02218.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT06455.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW60610.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW76350.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT12582.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV82787.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT90380.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW90426.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU32619.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW25708.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU33143.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV77547.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT75373.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW05894.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS87370.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT29089.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT65079.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV59152.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW16083.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW48264.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV84365.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW84020.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW72038.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT08485.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS04315.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT33961.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV19020.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT94168.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW62846.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT70729.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW55180.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT03272.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW42712.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW58558.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT62482.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW51906.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT06020.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS11166.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTS50714.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT63197.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW87203.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW56539.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT06661.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU17892.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV93005.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW45851.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTU05456.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTW21128.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT45495.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV92125.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT40611.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTV21692.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT47796.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTT99292.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY51651.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY86035.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY14149.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY92806.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY26800.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ48665.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY74089.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ17449.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ73092.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ48043.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ81961.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY99991.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ77903.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ59759.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ18670.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ32097.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY22712.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ21531.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY91529.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY92980.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ33011.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY41227.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY44449.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ60663.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY93793.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ31523.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ56412.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY43443.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY82792.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ77470.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ75872.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ74031.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ14621.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ72040.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ08710.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ97137.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ02374.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ01441.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ34550.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ40779.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ93707.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ93690.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTZ96509.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA16465.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA15439.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA13326.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA16140.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA48586.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA64032.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA52459.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA63649.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA53435.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA48771.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA42311.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CUA50863.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KOR04400.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALB33323.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALD23316.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALD38272.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALD28551.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUH57548.1| preprotein translocase membrane subunit [Escherichia coli KRX]
gb|KOZ03669.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ03727.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ10895.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ21099.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ23310.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ28760.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ35361.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ40683.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ41446.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ52949.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ57585.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ58180.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ68820.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ69268.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ78228.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ84177.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ89305.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KOZ95406.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUK12000.1| preprotein translocase subunit SecY [Achromobacter sp. ATCC35328]
gb|KPH29593.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPH29902.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPH41071.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPH49228.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUQ98548.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli]
emb|CTX98082.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY09746.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY04366.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX44875.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX84761.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX97251.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY23386.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY25886.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY62571.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX40924.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY10275.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX93358.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX60475.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX32329.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTY55700.1| preprotein translocase membrane subunit [Escherichia coli]
emb|CTX54448.1| preprotein translocase membrane subunit [Escherichia coli]
gb|ALH92551.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|ALI39018.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|ALI43418.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALI47814.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO05906.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO07026.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO15619.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO17709.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO25883.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO40439.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO41260.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO51370.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO55020.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO57379.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO64105.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO64503.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO76596.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO78728.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO86186.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO88062.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPO91257.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP00192.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP01524.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP12661.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP14114.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP19452.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP20644.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP31513.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP34098.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP43888.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP45703.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPP51741.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KPQ49183.1| Protein translocase subunit SecY [Escherichia coli TW10598]
gb|KQB24170.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQC23845.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQI74376.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQI78617.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQI83442.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQI94546.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQI95280.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ04034.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ08422.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ12431.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ14000.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ20802.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ27406.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ28913.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ36812.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ36913.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQJ46624.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALL88610.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALL91480.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KQL79482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KRQ06656.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|KRR50270.1| preprotein translocase subunit SecY [Escherichia coli VL2732]
gb|KRR51477.1| preprotein translocase subunit SecY [Escherichia coli K71]
gb|KRR56671.1| preprotein translocase subunit SecY [Escherichia coli VL2874]
gb|ALN47351.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KRT20066.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KRV70425.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KRV96598.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KRV96744.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KST29604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KST30061.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALQ57705.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALQ75079.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSW81881.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSX79638.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSX91985.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY00912.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY16879.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY25615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY50645.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY56358.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY80629.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY82725.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSY83955.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSZ04390.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KSZ19681.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CRL89593.1| preprotein translocase membrane subunit [Escherichia coli]
gb|ALT51182.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG77201.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG77477.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG77593.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG87068.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG87144.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG87428.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUG99733.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH01432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH05073.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH12492.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH13770.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH20432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH21305.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUH27545.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALV70800.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALX54190.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALX59397.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ALY14837.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUW83364.1| preprotein translocase membrane subunit [Escherichia coli]
gb|KUR23866.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUR34606.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUR86936.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUR87083.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUR88609.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUR97725.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS01955.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS07845.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS11431.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS11864.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS23290.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS26735.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS30620.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS36551.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS41045.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS46032.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS55053.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS55113.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS57721.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS66855.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS69321.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS75946.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS77187.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS79587.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS89808.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS96353.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUS97694.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT01205.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT07181.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT11785.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT18445.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT19550.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT28236.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT30881.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT35133.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT41534.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT46742.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT55270.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT56238.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT60460.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT63288.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT68399.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT74180.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT81843.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT86293.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT95121.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUT96544.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU02665.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU06904.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU11945.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU17424.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU19009.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU20987.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU26122.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU31051.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU39967.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU46250.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU51071.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU52625.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU55736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU66280.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU66587.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU67813.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU77808.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU79363.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU85131.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU95562.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUU96443.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV07533.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV11007.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV14608.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV20435.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV24076.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV26372.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV28112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV36020.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV41609.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV47138.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV53208.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV54073.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV63141.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV66707.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV69445.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV69933.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV78656.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV83959.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV86328.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV94972.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV98752.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUV98849.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW06127.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW15787.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW19808.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW22594.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW28468.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW29308.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW40997.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW41109.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW42009.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW55984.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW58293.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW59861.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW66609.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW73427.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW76543.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW84515.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW86593.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW92148.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUW92719.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX03211.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX06077.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX08630.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX15425.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX17604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX24118.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX29963.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX32972.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX37914.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX41627.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX48520.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX52223.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX57282.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX62056.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX66020.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX73196.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX80030.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX84343.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX88449.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX93940.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUX96619.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUY01725.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KUY09326.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KVI13322.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KVI16565.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KVI16791.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KWV19100.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMB52635.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KWW04011.1| preprotein translocase subunit SecY [Escherichia fergusonii]
gb|KWW04062.1| preprotein translocase subunit SecY [Escherichia fergusonii]
gb|KWW06057.1| preprotein translocase subunit SecY [Escherichia fergusonii]
gb|AMC96188.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|KXC10352.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMG81425.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AMH23927.1| preprotein translocase subunit SecY [Escherichia coli B]
gb|AMH28244.1| preprotein translocase subunit SecY [Escherichia coli B]
gb|AMH31903.1| preprotein translocase subunit SecY [Escherichia coli K-12]
gb|AMH36625.1| preprotein translocase subunit SecY [Escherichia coli K-12]
gb|KXG55188.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXG56716.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXG60025.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXG69655.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMF90078.1| protein translocase subunit SecY [Escherichia coli]
gb|KXG98393.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|KXH00917.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|KXH94147.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXH94224.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXH96084.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXI06315.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUW22974.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AML00211.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|AML06550.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AML11227.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AML16244.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AML21181.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK86544.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK86909.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK88008.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK90961.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK91966.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXK93417.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL14182.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL15001.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL18005.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL20029.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL32876.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL38232.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL68918.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL69849.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL70137.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL70800.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL72296.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL78710.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL85924.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL97171.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL98341.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM16803.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM17743.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM20263.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM22002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM22379.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM35936.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM37261.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM43932.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM46583.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM51698.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM54919.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM66387.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM70870.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM73341.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM77636.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM92283.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM94860.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXM99209.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN03391.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN08821.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN16352.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN17482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN30339.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN31076.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN32569.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN38108.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN46323.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN49483.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN53042.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXN64338.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP15572.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP15632.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP19990.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP29789.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP29931.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP37640.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP44810.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP46457.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP46522.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP55094.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP64219.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP67245.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP72787.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP73786.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP80104.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXP98746.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ01183.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ03139.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ04998.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ05058.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ14154.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ15672.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ25448.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ31399.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ34799.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ40233.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ43242.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ51283.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ53415.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ65202.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ69419.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ70120.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ76227.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ81069.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ83168.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ88448.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ89093.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXQ92584.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR01816.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR03161.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR06075.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR16056.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR19757.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR22275.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR28736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR29291.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR42064.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR43564.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR54660.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR59899.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR65650.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR67722.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR69904.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR77668.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR78196.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR86988.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR87830.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXR92605.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXS02015.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMM38238.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMM77701.1| preprotein translocase subunit SecY [Shigella flexneri 1a]
emb|CUU95512.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AMN59607.1| preprotein translocase subunit SecY [Shigella flexneri 2a]
gb|AMN64438.1| preprotein translocase subunit SecY [Shigella flexneri 4c]
gb|KXU67288.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXU69409.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXU77803.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CUX82810.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AMQ53107.1| preprotein translocase subunit SecY [Escherichia coli JJ1887]
gb|AMR24813.1| preprotein translocase subunit SecY [Shigella sp. PAMC 28760]
gb|KYL38427.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYN55741.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYN56084.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYO61539.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYO62257.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR03969.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR07463.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR08394.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR24522.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR27873.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR28794.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR35591.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR40624.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR43443.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR54816.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR55194.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR62894.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR70387.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR75006.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR86407.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR88651.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR89972.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYR98916.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS06236.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS11095.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS13529.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS16523.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS26806.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS27146.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS36934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS39041.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS42330.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS50779.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS55604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS57294.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS63413.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS65642.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS74190.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS80436.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYS97051.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT00017.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT00816.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT02916.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT09187.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT15947.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT24191.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT25146.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT36707.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT37300.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT42445.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT45219.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT49557.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT59111.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT60082.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT64780.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT78081.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT84473.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT90051.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT90661.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT90931.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYT93740.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU04836.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU07620.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU12791.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU14388.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU20763.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU29253.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU30197.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU34899.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU35373.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU46436.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU56783.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU57351.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU67106.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU73395.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU74605.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU83113.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU87820.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU88891.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYU93333.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV01860.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV04568.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV12217.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV12739.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV23642.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV37771.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV37993.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV41158.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV46032.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV46210.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV50515.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV64686.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV75969.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV77918.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV80018.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV80181.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV81281.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV94510.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYV99172.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW01217.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW04399.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW15645.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW16551.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW19377.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW27804.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW33082.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW38212.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW48861.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW49880.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW50973.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW55219.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW60510.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW69148.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW73738.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYW79675.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMU83869.1| preprotein translocase subunit SecY [Escherichia coli str. Sanji]
gb|KYZ88511.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYZ92177.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KYZ95126.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMW43072.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMW48492.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMX14030.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMX30864.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMX34604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AMX41326.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZF28751.1| preprotein translocase subunit SecY [Escherichia coli APEC O2]
gb|KZG97314.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZG97394.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH05576.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH05697.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH13989.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH19274.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH25448.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH28780.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH33382.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH39446.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH43658.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH48406.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH56890.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH65683.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH67899.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH74384.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH74657.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH79501.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH88692.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH95196.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI01039.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI07696.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI08193.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI15779.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI19158.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI23249.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI26888.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI36470.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI38025.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI42439.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI50353.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI56133.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI56432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI67892.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI67934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI74342.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI85739.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI92389.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI98112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZI98206.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ04897.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ11029.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ17635.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ21043.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ26790.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ28279.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ29473.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ37196.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ42300.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ51333.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ54934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ58089.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ64703.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ71736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ72207.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ80639.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ81697.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ90618.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ97893.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZJ98661.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO60800.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO65236.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO69929.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO73823.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO78222.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO82604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZO83059.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZP38096.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZP41300.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZP45149.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAB98691.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC02520.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC10531.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC11922.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC18893.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC22407.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC29596.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC33620.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC39337.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAC42445.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OAE53711.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAE69724.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF22934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF25923.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF31410.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF38269.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF46980.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF48320.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF53534.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAF91826.1| Preprotein translocase subunit secY [Escherichia coli PCN009]
gb|OAF91886.1| Preprotein translocase subunit secY [Escherichia coli PCN079]
gb|OAI33186.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANE59612.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANE64300.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAJ79277.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAJ83950.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAM47434.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SAP99134.1| preprotein translocase subunit SecY [Klebsiella oxytoca]
gb|OAN07387.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|OAO37496.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO41862.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO42957.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO57116.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO63113.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO65644.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAO71394.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANG70728.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|ANG76224.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|ANG81907.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|OAP66668.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAR84912.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAR87928.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAS06423.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAS90205.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAV57606.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANJ33441.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANJ39809.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OAY14975.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANK03778.1| secY [Escherichia coli O25b:H4]
gb|ANK07674.1| preprotein translocase subunit SecY [Escherichia coli]
emb|CTQ83728.1| preprotein translocase membrane subunit [Escherichia coli]
gb|ANK50417.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANM84073.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANK34120.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OBU89676.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANO91220.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANP09301.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANP20131.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANP34252.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANO79856.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANQ02649.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANO28103.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANR83123.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OBZ45295.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OBZ46774.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OBZ47880.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SCA73156.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCJ85493.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCJ90288.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCJ94104.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCJ97128.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCK01734.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANV96072.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCK70934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANW30001.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ANW42209.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|OCO65164.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCQ13243.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCQ22366.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCQ32322.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCQ46784.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS56721.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS63411.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS63749.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS71587.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS76405.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCS78135.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCT06297.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCW51537.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OCW78973.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOD09601.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODA86648.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODB46076.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODB51561.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODG68781.1| preprotein translocase subunit SecY [Shigella sp. FC1661]
gb|ODG81380.1| preprotein translocase subunit SecY [Shigella sp. FC1882]
gb|ODG82222.1| preprotein translocase subunit SecY [Shigella sp. FC1764]
gb|ODH14430.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODH20450.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODH27565.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODH30551.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODH38697.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODJ14650.1| preprotein translocase subunit SecY [Shigella sp. FC1172]
gb|ODJ26716.1| preprotein translocase subunit SecY [Shigella sp. FC2383]
gb|ODJ35936.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODJ40467.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOM43488.1| Preprotein translocase secY subunit [Escherichia coli]
gb|AOM56088.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOM59801.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOM71814.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ODQ09844.1| preprotein translocase subunit SecY [Shigella sp. FC1544]
gb|ODQ12185.1| preprotein translocase subunit SecY [Shigella sp. FC1056]
gb|ODQ14422.1| preprotein translocase subunit SecY [Shigella sp. FC1139]
gb|AOO71504.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEB95597.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEG27338.1| preprotein translocase subunit SecY [Shigella sp. FC2117]
gb|OEG28041.1| preprotein translocase subunit SecY [Shigella sp. FC2175]
gb|OEG28287.1| preprotein translocase subunit SecY [Shigella sp. FC2125]
gb|OEG40021.1| preprotein translocase subunit SecY [Shigella sp. FC2710]
gb|OEG40827.1| preprotein translocase subunit SecY [Shigella sp. FC2531]
gb|OEG41329.1| preprotein translocase subunit SecY [Shigella sp. FC2541]
gb|OEG51140.1| preprotein translocase subunit SecY [Shigella sp. FC3196]
gb|OEG65490.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOR21517.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI00561.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI07270.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI11481.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI18154.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI19374.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI27089.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI29288.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI32391.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI46350.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI46956.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI49067.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI50234.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI56944.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI66480.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEI95678.1| preprotein translocase subunit SecY [Shigella sp. FC1567]
gb|OEI97443.1| preprotein translocase subunit SecY [Shigella sp. FC1708]
gb|OEJ00022.1| preprotein translocase subunit SecY [Shigella sp. FC1737]
gb|OEL39519.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL42340.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL54007.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL54552.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL56353.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL67166.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL67300.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL70988.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL77480.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL79645.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL86837.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL91064.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEL91919.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM01050.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM06226.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM06858.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM18637.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM19538.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM25036.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM25180.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM35218.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM40296.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM45991.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM46540.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM56269.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM57946.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM63762.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM68208.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM71017.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM76044.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM82388.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM90028.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM90272.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEM98253.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN04618.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN07111.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN15194.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN15808.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN21093.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN26470.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN31394.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN33415.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN41732.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN47991.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN51374.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN51471.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN61063.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN66512.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN70957.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN73398.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN76950.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN80776.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN89673.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEN92183.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEO00508.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEO02329.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEO02372.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEO14068.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OEO14301.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOT30988.1| Preprotein translocase secY subunit [Escherichia coli]
gb|AOV19801.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV25156.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV30507.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV35876.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV41287.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV46636.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|AOV52047.1| preprotein translocase subunit SecY [Escherichia coli O157:H7]
gb|OFE25175.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SDP16170.1| protein translocase subunit secY/sec61 alpha [Shigella sonnei]
gb|AOX50400.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AOX55803.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OHV07088.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OHW32771.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SER30279.1| protein translocase subunit secY/sec61 alpha [Escherichia coli]
gb|APA24659.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII50959.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII55719.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APA40338.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII80867.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII91645.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII93859.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII97032.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OII98745.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIJ08279.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SCQ12028.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIU78567.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIU79979.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APC54116.1| preprotein translocase subunit SecY [Escherichia coli str. K-12 substr.
W3110]
gb|OIY22215.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY30624.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY37483.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY39193.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY42062.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY49688.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY54033.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY54518.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY65142.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY70795.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY76152.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY79074.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY91240.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY91385.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY92904.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIY95562.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ09864.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ10791.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ22546.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ23187.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ24059.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ30101.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ69987.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ74207.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ83305.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ84556.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OIZ93083.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF21157.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF25067.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF26718.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF36779.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF38749.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF47466.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF53729.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF54792.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF63560.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJF86731.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SHD56751.1| preprotein translocase membrane subunit [Escherichia coli]
gb|APE55029.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APE59981.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APE64860.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APE69696.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APE78053.1| Preprotein translocase secY subunit [Escherichia coli]
gb|APE90233.1| Preprotein translocase secY subunit [Escherichia coli]
gb|OJH21421.1| preprotein translocase subunit SecY [Escherichia coli NA114]
gb|APG34866.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API00340.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API05941.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API11492.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API17093.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API22742.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API28235.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API33898.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API39467.1| preprotein translocase subunit SecY [Escherichia coli]
gb|API49217.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK10025.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK12124.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK14637.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK23374.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK31393.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK32718.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK35432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK46473.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK49169.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK57673.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK58645.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK69002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK70529.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK73033.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK78521.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK89611.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK89740.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJK98471.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL00600.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL03577.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL17403.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL19036.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL25990.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL30505.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL34112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL40785.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL44660.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL47855.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL50692.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL56400.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL61838.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL70604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL71251.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL79322.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL85628.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJL89912.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM00890.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM01303.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM01752.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM12220.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM12721.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM17792.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM27595.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM36161.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM39608.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM42893.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM44640.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM45032.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM61762.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM61986.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM70615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM72474.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM73047.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM82480.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM85222.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM89770.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJM99334.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN02840.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN04568.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN15228.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN17346.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN21119.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN27322.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN29738.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN37733.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN39776.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN49479.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN50880.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN52761.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN63670.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN70958.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN73457.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN81046.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN89098.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN92266.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJN94413.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO03940.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO07006.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO13944.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO16821.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO19039.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO28099.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO31305.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO32620.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO40732.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO51047.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO56659.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO56703.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO64131.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO66072.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO72521.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO87225.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO93434.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO93918.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJO96017.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP03864.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP04966.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP10344.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP17576.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP20054.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP27674.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP44736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP46868.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP55782.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP59215.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP63681.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP65156.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP75851.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP79408.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP84492.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP86358.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP94081.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJP97243.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ02541.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ08600.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ17218.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ20410.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ21152.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ30533.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ42507.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ44846.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ59506.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ72910.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ82597.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ90652.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ91534.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJQ93138.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR04726.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR07567.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR14193.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR14277.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR18592.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR26692.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR32488.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR42016.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR42060.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR50665.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR57875.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR64299.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR69174.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR72059.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR81812.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR84567.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR88849.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJR91178.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS00863.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS01655.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS08683.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS20009.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS28482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS29690.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS33140.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS34704.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS43256.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS45092.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS56009.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS58143.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS67386.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS67594.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS74768.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS79462.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJS86721.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OJZ30583.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ55725.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ63873.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ66712.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ70774.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ78691.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ83893.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ85511.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ89768.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APJ96611.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK01903.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK04724.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK12590.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK17239.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK18065.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK20974.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK25497.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK30354.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK36550.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK40811.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK42187.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK48465.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK51896.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK55607.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK60668.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK65125.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK72152.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK75006.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK81559.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK84638.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK90506.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK94223.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APK99304.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL05014.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL08569.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL14797.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL18423.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL25447.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL26656.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL33371.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL40337.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL45347.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL49769.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL57289.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL61529.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL64418.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL72041.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL75623.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL79590.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL84975.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL88968.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APL51800.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKA62197.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKB70495.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKB73506.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKB84474.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKB91201.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKB94026.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKL77929.1| protein translocase subunit SecY [Escherichia coli]
gb|OKL97370.1| protein translocase subunit SecY [Escherichia coli]
gb|OKO60280.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKP61483.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT05512.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT08054.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT15647.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT23033.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT32460.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT32541.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT46140.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT49650.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT58825.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT76862.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT77691.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT85026.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKT91821.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU00602.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU06647.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU14763.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU30076.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU40243.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU44309.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU44732.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU45168.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU57644.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU78664.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU83410.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU95330.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU95973.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKU98122.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV11603.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV18792.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV19489.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV26632.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV33098.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV37410.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV40735.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV41218.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV52730.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV67770.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV69807.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV80799.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV82708.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKV86615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW01719.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW07250.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW12345.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW15359.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW18736.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW27400.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW51006.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW51379.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW62510.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW68854.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW79109.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW81834.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW87994.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW90539.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKW94328.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX06316.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX08301.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX19046.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX25168.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX36311.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX44023.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX48628.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX53862.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OKX64671.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APQ19837.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLL61204.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APT00921.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLN80146.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLO95261.1| preprotein translocase subunit SecY [Escherichia coli]
gb|APT60665.1| protein translocase subunit SecY [Escherichia coli]
gb|OLR31422.1| preprotein translocase subunit SecY [Escherichia coli O25b:H4-ST131]
gb|OLR84246.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS67591.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS72541.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS79711.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS81485.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS85950.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS88561.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLS96552.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLY55101.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OLY88776.1| preprotein translocase subunit SecY [Escherichia coli O157:H43]
gb|OMG98413.1| protein translocase subunit SecY [Escherichia coli]
gb|OMH01070.1| protein translocase subunit SecY [Escherichia coli]
gb|OMH08421.1| protein translocase subunit SecY [Escherichia coli]
gb|APW92431.1| protein translocase subunit SecY [Escherichia coli]
gb|OMI45049.1| preprotein translocase subunit SecY [Escherichia coli N37058PS]
gb|OMI46636.1| preprotein translocase subunit SecY [Escherichia coli N37122PS]
gb|OMI57854.1| preprotein translocase subunit SecY [Escherichia coli N40607]
gb|OMI58300.1| preprotein translocase subunit SecY [Escherichia coli N40513]
gb|OMI63107.1| preprotein translocase subunit SecY [Escherichia coli N36410PS]
gb|OMI64418.1| preprotein translocase subunit SecY [Escherichia coli N37139PS]
gb|OMI73853.1| preprotein translocase subunit SecY [Escherichia coli N36254PS]
gb|ONF82480.1| protein translocase subunit SecY [Escherichia coli]
gb|ONG17466.1| protein translocase subunit SecY [Escherichia coli]
gb|ONG21339.1| protein translocase subunit SecY [Escherichia coli]
gb|ONG29308.1| protein translocase subunit SecY [Escherichia coli]
emb|SJK90204.1| preprotein translocase membrane subunit [Escherichia coli]
gb|ONK36121.1| protein translocase subunit SecY [Escherichia coli]
gb|ONK38409.1| protein translocase subunit SecY [Escherichia coli]
gb|ONN32830.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOC69393.1| protein translocase subunit SecY [Escherichia coli]
gb|OOC72417.1| protein translocase subunit SecY [Escherichia coli]
gb|OOC76258.1| protein translocase subunit SecY [Escherichia coli]
gb|OOD48808.1| protein translocase subunit SecY [Escherichia coli]
gb|AQP93198.1| protein translocase subunit SecY [Escherichia coli]
gb|OOG30161.1| protein translocase subunit SecY [Escherichia coli]
gb|OOH57989.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOH61728.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOH84446.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI11822.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI13631.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI17741.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI27284.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI27365.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI27466.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI41017.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI42799.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI48971.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI53826.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI60173.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI66506.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI67554.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI74087.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI77014.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI85517.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI87123.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI94558.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOI99132.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ02533.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ08525.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ14383.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ15255.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ24877.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ26856.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ29316.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ39404.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ45304.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ46363.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ54485.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ56737.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ65703.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ69238.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ69298.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ79477.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ81111.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ86558.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ93197.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOJ98851.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK00421.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK09954.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK10015.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK19041.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK25478.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK28482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOK29198.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OOM83404.1| protein translocase subunit SecY [Escherichia coli]
gb|OON47690.1| protein translocase subunit SecY [Escherichia coli]
gb|OON73517.1| protein translocase subunit SecY [Escherichia coli]
gb|AQU01057.1| protein translocase subunit SecY [Escherichia coli]
gb|AQU94377.1| protein translocase subunit SecY [Escherichia coli]
gb|OOO75332.1| protein translocase subunit SecY [Shigella boydii]
gb|OOO89321.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|OOO90514.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|OOO93657.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|OOO99055.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP04161.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP15775.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP16160.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP20284.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP27027.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP31554.1| protein translocase subunit SecY [Shigella flexneri]
gb|OOP39534.1| protein translocase subunit SecY [Shigella flexneri]
gb|AQV18721.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV25269.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV29418.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV34696.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV40630.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV47044.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV54015.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV56600.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV63568.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV69317.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV73746.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV81587.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV84845.1| protein translocase subunit SecY [Escherichia coli]
gb|AQV87751.1| protein translocase subunit SecY [Escherichia coli]
gb|AQW00386.1| protein translocase subunit SecY [Escherichia coli]
gb|AQW07526.1| protein translocase subunit SecY [Escherichia coli]
gb|AQW12239.1| protein translocase subunit SecY [Escherichia coli]
gb|AQW20204.1| protein translocase subunit SecY [Escherichia coli]
gb|OOV68425.1| protein translocase subunit SecY [Escherichia coli]
gb|OOW22269.1| protein translocase subunit SecY [Escherichia coli]
gb|OOW25027.1| protein translocase subunit SecY [Escherichia coli]
gb|AQX98573.1| protein translocase subunit SecY [Escherichia coli NU14]
gb|OPH56800.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|OPH64019.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|OPH69007.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|OPI32842.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI39082.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI44002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI47279.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI52666.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI53566.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI63358.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI70305.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI74920.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI75462.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI80115.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI86989.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI92454.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPI96241.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ05855.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ07771.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ13787.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ14251.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ26239.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ32194.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ36607.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ38823.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ43346.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ43389.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OPJ49676.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AQZ28860.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AQZ75522.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AQZ84488.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA00602.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA09682.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA18375.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA31066.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA37517.1| protein translocase subunit SecY [Escherichia coli]
gb|ARA62180.1| protein translocase subunit SecY [Escherichia coli]
gb|ARD53077.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARD78598.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARD82468.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARE46004.1| protein translocase subunit SecY [Escherichia coli C]
dbj|BAX12747.1| preprotein translocase subunit SecY [Escherichia coli]
dbj|BAX17855.1| preprotein translocase subunit SecY [Escherichia coli]
dbj|BAX22729.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ORC96159.1| protein translocase subunit SecY [Escherichia coli]
gb|ORC97285.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD05489.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD14470.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD16398.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD24631.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD27002.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD36308.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD38440.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD53072.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD60103.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD68770.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD72554.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD85039.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD86294.1| protein translocase subunit SecY [Escherichia coli]
gb|ORD88316.1| protein translocase subunit SecY [Escherichia coli]
gb|ORE73891.1| protein translocase subunit SecY [Escherichia coli]
gb|ORE74704.1| protein translocase subunit SecY [Escherichia coli]
gb|ARH98916.1| preprotein translocase membrane subunit [Escherichia coli]
gb|ORJ74684.1| protein translocase subunit SecY [Escherichia coli]
gb|ORR79665.1| protein translocase subunit SecY [Escherichia coli]
gb|ORR79714.1| protein translocase subunit SecY [Escherichia coli]
gb|ORR88120.1| protein translocase subunit SecY [Escherichia coli]
gb|ORR91531.1| protein translocase subunit SecY [Escherichia coli]
gb|ORR92443.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS02877.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS04201.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS07280.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS15722.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS19020.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS20448.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS29642.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS32331.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS32976.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS52772.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS53896.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS57821.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS59816.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS65520.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS67835.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS73232.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS73332.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS82257.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS88657.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS88718.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS99313.1| protein translocase subunit SecY [Escherichia coli]
gb|ORS99945.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT04112.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT13367.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT17169.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT17230.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT28141.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT31451.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT37829.1| protein translocase subunit SecY [Escherichia coli]
gb|ORT42850.1| protein translocase subunit SecY [Escherichia coli]
emb|SMB22499.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli]
emb|SMB22498.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli]
gb|OSB87532.1| protein translocase subunit SecY [Escherichia coli]
gb|OSB89991.1| protein translocase subunit SecY [Escherichia coli]
gb|OSC09170.1| protein translocase subunit SecY [Escherichia coli]
gb|OSC15780.1| protein translocase subunit SecY [Escherichia coli]
gb|OSC20265.1| protein translocase subunit SecY [Escherichia coli]
emb|SMH30052.1| protein translocase subunit secY/sec61 alpha [Escherichia coli]
gb|ARJ94530.1| protein translocase subunit SecY [Escherichia coli]
gb|OSK01171.1| preprotein translocase membrane subunit [Escherichia coli SHECO001]
gb|OSK08571.1| hypothetical protein EAOG_03510 [Escherichia coli R527]
gb|OSK10498.1| preprotein translocase, SecY subunit [Escherichia coli FVEC1465]
gb|OSK20090.1| preprotein translocase, SecY subunit [Escherichia coli M056]
gb|OSK23135.1| preprotein translocase, SecY subunit [Escherichia coli TA144]
gb|OSK24237.1| preprotein translocase, SecY subunit [Escherichia coli B574]
gb|OSK34289.1| preprotein translocase, SecY subunit [Escherichia coli E267]
gb|OSK36226.1| preprotein translocase, SecY subunit [Escherichia coli B671]
gb|OSK38869.1| preprotein translocase, SecY subunit [Escherichia coli B108]
gb|OSK48018.1| preprotein translocase, SecY subunit [Escherichia coli H588]
gb|OSK50491.1| preprotein translocase, SecY subunit [Escherichia coli H413]
gb|OSK59568.1| preprotein translocase, SecY subunit [Escherichia coli E560]
gb|OSK61259.1| preprotein translocase, SecY subunit [Escherichia coli B921]
gb|OSK64656.1| preprotein translocase, SecY subunit [Escherichia coli E1114]
gb|OSK71438.1| preprotein translocase, SecY subunit [Escherichia coli H223]
gb|OSK73814.1| preprotein translocase, SecY subunit [Escherichia coli H001]
gb|OSK82279.1| preprotein translocase, SecY subunit [Escherichia coli H378]
gb|OSK83236.1| preprotein translocase, SecY subunit [Escherichia coli B367]
gb|OSK90338.1| preprotein translocase, SecY subunit [Escherichia coli TA447]
gb|OSK96100.1| preprotein translocase, SecY subunit [Escherichia coli E1002]
gb|OSL03138.1| preprotein translocase, SecY subunit [Escherichia coli H386]
gb|OSL03349.1| preprotein translocase, SecY subunit [Escherichia coli H296]
gb|OSL09062.1| preprotein translocase, SecY subunit [Escherichia coli H305]
gb|OSL16399.1| preprotein translocase, SecY subunit [Escherichia coli B175]
gb|OSL21906.1| preprotein translocase, SecY subunit [Escherichia coli TA255]
gb|OSL27041.1| preprotein translocase, SecY subunit [Escherichia coli H617]
gb|OSL34040.1| preprotein translocase, SecY subunit [Escherichia coli TA464]
gb|OSL41556.1| preprotein translocase, SecY subunit [Escherichia coli H461]
gb|OSL45754.1| preprotein translocase, SecY subunit [Escherichia coli H605]
gb|OSL52438.1| preprotein translocase, SecY subunit [Escherichia coli H454]
gb|OSL52649.1| preprotein translocase, SecY subunit [Escherichia coli H383]
gb|OSL58863.1| preprotein translocase, SecY subunit [Escherichia coli H420]
gb|OSL68525.1| preprotein translocase, SecY subunit [Escherichia coli TA054]
gb|OSL68965.1| preprotein translocase, SecY subunit [Escherichia coli TA008]
gb|OSL72964.1| preprotein translocase, SecY subunit [Escherichia coli TA014]
gb|OSL81802.1| preprotein translocase, SecY subunit [Escherichia coli TA249]
gb|OSL88459.1| preprotein translocase, SecY subunit [Escherichia coli T426]
gb|OSL98106.1| preprotein translocase, SecY subunit [Escherichia coli R424]
gb|OSM83856.1| preprotein translocase membrane subunit [Escherichia coli SHECO003]
gb|OSP30395.1| protein translocase subunit SecY [Escherichia coli]
gb|ARM41309.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OSQ40226.1| protein translocase subunit SecY [Escherichia coli]
gb|ARM78059.1| protein translocase subunit SecY [Escherichia coli]
gb|OSY85399.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARQ24500.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTA10161.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTB21313.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB29865.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB31650.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB34378.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB40388.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB44345.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB50486.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB50777.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB59211.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB67774.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB70398.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB75145.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB80937.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB88267.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB93496.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB96753.1| protein translocase subunit SecY [Escherichia coli]
gb|OTB99676.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC09594.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC09907.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC18839.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC24006.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC30917.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC32589.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC36281.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC46745.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC46901.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC52331.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC62021.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC67887.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC69316.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC76141.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC83862.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC84376.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC94675.1| protein translocase subunit SecY [Escherichia coli]
gb|OTC96616.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD03652.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD06003.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD15562.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD18235.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD23938.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD30744.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD33015.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD33384.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD46189.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD48239.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD56625.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD60190.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD64296.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD70103.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD77752.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD78190.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD88044.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD89771.1| protein translocase subunit SecY [Escherichia coli]
gb|OTD94542.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE04689.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE04921.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE14645.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE18296.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE20518.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE29665.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE32891.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE38889.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE45405.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE45924.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE55962.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE62576.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE63268.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE73053.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE77343.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE85067.1| protein translocase subunit SecY [Escherichia coli]
gb|OTE90222.1| protein translocase subunit SecY [Escherichia coli]
gb|ARR33369.1| protein translocase subunit SecY [Escherichia coli]
gb|ARR58003.1| protein translocase subunit SecY [Escherichia coli]
gb|ARR65770.1| protein translocase subunit SecY [Escherichia coli]
gb|OTU94668.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV02256.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV02641.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV11152.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV16109.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV17239.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV36452.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OTV42630.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OUD11912.1| protein translocase subunit SecY [Escherichia coli M4]
gb|OUF52495.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF64424.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF67667.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF70730.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF78750.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF81273.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF85665.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF93870.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF95417.1| protein translocase subunit SecY [Escherichia coli]
gb|OUF98315.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG05236.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG11774.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG14077.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG20358.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG23497.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG32070.1| protein translocase subunit SecY [Escherichia coli]
gb|OUG33569.1| protein translocase subunit SecY [Escherichia coli]
gb|OUJ55440.1| protein translocase subunit SecY [Escherichia coli]
gb|OUJ64522.1| protein translocase subunit SecY [Escherichia coli]
gb|OUJ77733.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUJ87705.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK47738.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK48718.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK65449.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK88946.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK89832.1| protein translocase subunit SecY [Escherichia coli]
gb|OUK89939.1| protein translocase subunit SecY [Escherichia coli]
gb|OUL12433.1| protein translocase subunit SecY [Escherichia coli]
gb|ART18653.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ART26432.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ART42343.1| Sec Translocation Complex [Escherichia coli]
gb|OUP38366.1| protein translocase subunit SecY [Escherichia coli]
gb|OUR43810.1| protein translocase subunit SecY [Escherichia coli]
gb|OUR45873.1| protein translocase subunit SecY [Escherichia coli]
gb|OUR49063.1| protein translocase subunit SecY [Escherichia coli]
gb|ARV29329.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARV34200.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARV48598.1| protein translocase subunit SecY [Escherichia coli]
gb|ARV55097.1| protein translocase subunit SecY [Escherichia coli]
gb|OUZ44285.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ44683.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ50508.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ57737.1| protein translocase subunit SecY [Shigella sonnei]
gb|OUZ63307.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ70875.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ73228.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ81650.1| protein translocase subunit SecY [Shigella flexneri]
gb|OUZ86623.1| protein translocase subunit SecY [Shigella flexneri]
gb|OVA38800.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA39518.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA42646.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA54349.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA60021.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA60420.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA73585.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA78151.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA78654.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA85961.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVA90261.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB00012.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB01888.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB08484.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB09143.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB20681.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB24927.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB25615.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB36887.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB37538.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB45486.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB50813.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB60228.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB60985.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB67705.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB73326.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB79480.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB86486.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB89165.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVB98716.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC00966.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC09326.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC14373.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC18112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC22595.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC26074.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC31858.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC38590.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC42396.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC49204.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC55834.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC56683.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC62575.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC72766.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC78721.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC81112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC86623.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC87797.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVC95591.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD00984.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD05348.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD16706.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD18489.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD19525.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD29969.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD33508.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD36613.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD48304.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD50010.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD58784.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD62141.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD67075.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD70893.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD80792.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD86027.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD89108.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVD95242.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVE04679.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVE20279.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVE24001.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OVE26969.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARW89642.1| protein translocase subunit SecY [Escherichia coli]
gb|ARW90979.1| protein translocase subunit SecY [Escherichia coli]
gb|ARX12505.1| protein translocase subunit SecY [Escherichia coli]
gb|ARX23377.1| protein translocase subunit SecY [Escherichia coli]
gb|ARX28739.1| protein translocase subunit SecY [Escherichia coli]
gb|ARX54795.1| protein translocase subunit SecY [Escherichia coli]
gb|OVG02846.1| protein translocase subunit SecY [Escherichia coli]
gb|OVG48248.1| protein translocase subunit SecY [Escherichia coli]
gb|OVJ57504.1| protein translocase subunit SecY [Escherichia coli]
gb|OVY45184.1| protein translocase subunit SecY [Escherichia coli]
gb|OWB88361.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWB93822.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC02950.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC05364.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC05934.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC09023.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC11028.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC22482.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC25536.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC29888.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC33409.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC45011.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC47383.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC53555.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC55957.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC61666.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC64547.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC78972.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC80919.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC81885.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC85049.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC86224.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC86639.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWC96789.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD01210.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD04938.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD09124.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD13907.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD22764.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD25960.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD30746.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD31657.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD36174.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD42356.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD48714.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD48786.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD52767.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD58171.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD67337.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD75203.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD76164.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD81990.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD87723.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD89070.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWD97734.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE00026.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE05002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE15954.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE17804.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE21859.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE28059.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE30988.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE36823.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE42439.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE47612.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE54317.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE60350.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE61589.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE66491.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE66569.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE77583.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE80650.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE85953.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE87153.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE89548.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWE97735.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF05915.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF08591.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF14059.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF15519.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF21716.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OWF24347.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ARZ84368.1| protein translocase subunit SecY [Escherichia coli]
gb|ARZ87611.1| protein translocase subunit SecY [Escherichia coli]
gb|ASA41010.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG40730.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG48623.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG54230.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG55802.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG60809.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG69391.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG71412.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG71866.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG82557.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG86093.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG93827.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG98742.1| protein translocase subunit SecY [Escherichia coli]
gb|OWG99724.1| protein translocase subunit SecY [Escherichia coli]
gb|OWH09102.1| protein translocase subunit SecY [Escherichia coli]
gb|OWH09635.1| protein translocase subunit SecY [Escherichia coli]
gb|OWH09684.1| protein translocase subunit SecY [Escherichia coli]
gb|OWH22375.1| protein translocase subunit SecY [Escherichia coli]
gb|ASA59260.1| protein translocase subunit SecY [Escherichia coli]
gb|ASA64001.1| protein translocase subunit SecY [Escherichia coli]
gb|ASB78610.1| protein translocase subunit SecY [Escherichia coli]
gb|ASC16481.1| protein translocase subunit SecY [Escherichia coli]
gb|OWP95347.1| protein translocase subunit SecY [Escherichia coli]
gb|OWR12217.1| protein translocase subunit SecY [Shigella boydii]
gb|OWR38318.1| protein translocase subunit SecY [Escherichia coli]
gb|OWS78525.1| protein translocase subunit SecY [Escherichia coli]
gb|OWS83499.1| protein translocase subunit SecY [Escherichia coli]
gb|ASE48439.1| protein translocase subunit SecY [Escherichia coli O157]
gb|ASF04140.1| protein translocase subunit SecY [Escherichia coli O104:H4]
gb|ASG47956.1| protein translocase subunit SecY [Escherichia coli]
gb|OWW53072.1| protein translocase subunit SecY [Escherichia coli]
gb|OWW57345.1| protein translocase subunit SecY [Escherichia coli]
gb|OWX80106.1| protein translocase subunit SecY [Escherichia coli]
gb|OWX81166.1| protein translocase subunit SecY [Escherichia coli]
gb|OWX89952.1| protein translocase subunit SecY [Escherichia coli]
gb|OWY49524.1| protein translocase subunit SecY [Escherichia coli]
gb|ASI14760.1| protein translocase subunit SecY [Escherichia coli]
gb|ASI48779.1| Preprotein translocase secY subunit [Escherichia coli]
gb|ASJ28967.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ASJ45212.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXB29408.1| Protein translocase subunit SecY [Shigella flexneri 2a str. 301]
gb|ASL30035.1| protein translocase subunit SecY [Escherichia coli]
gb|ASL57251.1| Preprotein translocase secY subunit [Escherichia coli]
gb|OXJ45491.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ46357.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ55132.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ56518.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ64305.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ68007.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ72805.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ77623.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ84810.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ87710.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ93820.1| protein translocase subunit SecY [Escherichia coli]
gb|OXJ98657.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK03579.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK06353.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK14826.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK19711.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK25592.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK27469.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK34375.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK38464.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK45707.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK50181.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK54829.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK59832.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK65292.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK66665.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK67707.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK80738.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK81907.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK90900.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK92142.1| protein translocase subunit SecY [Escherichia coli]
gb|OXK96646.1| protein translocase subunit SecY [Escherichia coli]
gb|OXL46367.1| protein translocase subunit SecY [Escherichia coli]
gb|OXL56212.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXL58525.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXL64842.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXL69130.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXL71075.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXL81120.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ASO02360.1| protein translocase subunit SecY [Escherichia coli]
gb|ASO77304.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ASO85204.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ASO89981.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ASO94752.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OXU87849.1| protein translocase subunit SecY [Escherichia coli]
gb|OXU89812.1| protein translocase subunit SecY [Escherichia coli]
gb|ASQ58585.1| protein translocase subunit SecY [Shigella flexneri 4c]
gb|ASQ61349.1| protein translocase subunit SecY [Shigella flexneri 1a]
gb|ASQ68907.1| preprotein translocase membrane subunit [Escherichia coli NCCP15648]
gb|ASQ80577.1| protein translocase subunit SecY [Shigella flexneri 1a]
gb|OXV12545.1| protein translocase subunit SecY [Escherichia coli]
gb|OXV17401.1| protein translocase subunit SecY [Escherichia coli]
gb|OXV33252.1| protein translocase subunit SecY [Escherichia coli]
gb|OXV39714.1| protein translocase subunit SecY [Escherichia coli]
gb|OXV47299.1| protein translocase subunit SecY [Escherichia coli]
gb|OXW56806.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXW61130.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXW70544.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXW74337.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXW84327.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXW91275.1| protein translocase subunit SecY [Shigella boydii]
gb|OXW91521.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXX11526.1| protein translocase subunit SecY [Shigella flexneri]
gb|OXZ48873.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ53194.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ54040.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ64128.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ73280.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ75091.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ76880.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ83454.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ84429.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ89544.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ95837.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ96291.1| protein translocase subunit SecY [Escherichia coli]
gb|OXZ96857.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA11417.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA15049.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA15374.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA24322.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA32078.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA32677.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA38377.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA40882.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA45112.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA54117.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA55147.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA55390.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA66283.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA75071.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA77604.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA81024.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA84491.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA91419.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA98476.1| protein translocase subunit SecY [Escherichia coli]
gb|OYA99927.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB03140.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB06817.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB12336.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB18892.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB19333.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB29811.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB33908.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB35808.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB38517.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB49050.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB50138.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB51333.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB63263.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB67413.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB70410.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB75401.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB76493.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB83614.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB89349.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB92794.1| protein translocase subunit SecY [Escherichia coli]
gb|OYB95959.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC04771.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC06581.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC14999.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC15338.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC19140.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC26267.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC31220.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC36952.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC46022.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC49252.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC51800.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC55519.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC60441.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC61335.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC68312.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC73751.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC75243.1| protein translocase subunit SecY [Escherichia coli]
gb|OYC83791.1| protein translocase subunit SecY [Escherichia coli]
gb|OYE16346.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYE20970.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYE54502.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYE55462.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYE59488.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYE74808.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYF38221.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYF69719.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYF69869.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYF89801.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG14898.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG55198.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG59484.1| protein translocase subunit SecY [Escherichia coli]
gb|OYG73860.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG83764.1| protein translocase subunit SecY [Shigella boydii]
gb|OYG83817.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG89468.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG94712.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYG98816.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI05673.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI08388.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI12175.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI16849.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI37145.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI42149.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI54896.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI57677.1| protein translocase subunit SecY [Shigella boydii]
gb|OYI60698.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI61041.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI65953.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI69381.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI79676.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI85958.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYI86642.1| protein translocase subunit SecY [Shigella boydii]
gb|OYJ13713.1| protein translocase subunit SecY [Shigella boydii]
gb|OYJ15007.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ21704.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ23740.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ37045.1| protein translocase subunit SecY [Shigella boydii]
gb|OYJ46007.1| protein translocase subunit SecY [Shigella boydii]
gb|OYJ48061.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ51121.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ66179.1| protein translocase subunit SecY [Escherichia coli]
gb|OYJ66665.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYJ74706.1| protein translocase subunit SecY [Escherichia coli]
gb|OYJ76602.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK18070.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK25413.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK30773.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK40064.1| protein translocase subunit SecY [Escherichia coli]
gb|OYK40252.1| protein translocase subunit SecY [Escherichia coli]
gb|OYK40877.1| protein translocase subunit SecY [Escherichia coli]
gb|OYK55833.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK58084.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK59927.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK65242.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYK66245.1| protein translocase subunit SecY [Shigella boydii]
gb|OYK66376.1| protein translocase subunit SecY [Escherichia coli]
gb|OYL21700.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL26208.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL32519.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL34487.1| protein translocase subunit SecY [Escherichia coli]
gb|OYL37636.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL43913.1| protein translocase subunit SecY [Shigella boydii]
gb|OYL54812.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL63738.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYL82583.1| protein translocase subunit SecY [Escherichia coli]
gb|OYL87189.1| protein translocase subunit SecY [Shigella sonnei]
gb|OYN28862.1| protein translocase subunit SecY [Shigella boydii]
gb|OYN40079.1| protein translocase subunit SecY [Escherichia coli]
gb|OYN43494.1| protein translocase subunit SecY [Escherichia coli]
gb|OYN71331.1| protein translocase subunit SecY [Escherichia coli]
gb|AST64278.1| protein translocase subunit SecY [Escherichia coli]
gb|OYQ55640.1| protein translocase subunit SecY [Shigella sonnei]
emb|SNW08521.1| preprotein translocase membrane subunit [Escherichia coli]
gb|OZC28709.1| preprotein translocase subunit SecY [Escherichia coli]
gb|OZG34673.1| protein translocase subunit SecY [Escherichia coli O157:H7]
gb|OZM85480.1| protein translocase subunit SecY [Escherichia coli]
gb|OZM89646.1| protein translocase subunit SecY [Escherichia coli]
gb|OZM96392.1| protein translocase subunit SecY [Escherichia coli]
gb|OZN00623.1| protein translocase subunit SecY [Escherichia coli]
gb|OZN07186.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO53143.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO57213.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO61938.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO67117.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO72080.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO76969.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO86847.1| protein translocase subunit SecY [Escherichia coli]
gb|OZO91690.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP01337.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP06398.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP11125.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP16322.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP21103.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP26551.1| protein translocase subunit SecY [Escherichia coli]
gb|OZP33481.1| protein translocase subunit SecY [Escherichia coli]
gb|OZR90950.1| protein translocase subunit SecY [Escherichia coli]
gb|OZR95761.1| protein translocase subunit SecY [Escherichia coli]
gb|OZS00907.1| protein translocase subunit SecY [Escherichia coli]
gb|OZS05827.1| protein translocase subunit SecY [Escherichia coli]
gb|OZS10910.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX61218.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX71021.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX73714.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX77083.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX83145.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX86469.1| protein translocase subunit SecY [Escherichia coli]
gb|OZX91670.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY00119.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY03430.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY06865.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY14264.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY20078.1| protein translocase subunit SecY [Escherichia coli]
gb|OZY23955.1| protein translocase subunit SecY [Escherichia coli]
gb|PAB84406.1| protein translocase subunit SecY [Escherichia coli]
gb|PAB86860.1| protein translocase subunit SecY [Escherichia coli]
gb|PAB90029.1| protein translocase subunit SecY [Escherichia coli]
gb|PAB96283.1| protein translocase subunit SecY [Escherichia coli]
gb|PAB99725.1| protein translocase subunit SecY [Escherichia coli]
gb|PAC24498.1| protein translocase subunit SecY [Escherichia coli]
gb|PAL33429.1| protein translocase subunit SecY [Escherichia coli]
gb|PAL33482.1| protein translocase subunit SecY [Escherichia coli]
gb|PAL36163.1| protein translocase subunit SecY [Escherichia coli]
gb|PAL42557.1| protein translocase subunit SecY [Escherichia coli]
gb|PAL57933.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ21488.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ23707.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ24551.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ31906.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ36072.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ42125.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ48245.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ48590.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ58170.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ59604.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ73232.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ77596.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ81795.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ83711.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ93402.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ93592.1| protein translocase subunit SecY [Escherichia coli]
gb|PAQ99412.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS48341.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS50677.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS54807.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS60929.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS67248.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS72896.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS78037.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS80079.1| protein translocase subunit SecY [Escherichia coli]
gb|PAS84820.1| protein translocase subunit SecY [Escherichia coli]
emb|CTP95811.1| Preprotein translocase secY subunit (TC3.A.5.1.1) [Escherichia coli]
gb|ASW61549.1| Sec Translocation Complex [Escherichia coli]
gb|ASX04156.1| protein translocase subunit SecY [Escherichia coli]
gb|PAT80011.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAT81116.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAT84088.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAT93612.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAT94327.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU07367.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU08328.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU14050.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU22320.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU23745.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAU32532.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PAX40976.1| protein translocase subunit SecY [Escherichia coli]
gb|PAX46641.1| protein translocase subunit SecY [Escherichia coli]
gb|PAX57015.1| protein translocase subunit SecY [Escherichia coli]
gb|ASZ43274.1| protein translocase subunit SecY [Escherichia coli]
gb|ASZ47758.1| protein translocase subunit SecY [Escherichia coli]
gb|PAY68057.1| protein translocase subunit SecY [Shigella flexneri]
gb|PAY74058.1| protein translocase subunit SecY [Shigella boydii]
gb|PAY79335.1| protein translocase subunit SecY [Shigella flexneri]
gb|PAY85052.1| protein translocase subunit SecY [Shigella flexneri]
gb|PAY89067.1| protein translocase subunit SecY [Shigella flexneri]
gb|PAY94451.1| protein translocase subunit SecY [Shigella boydii]
gb|PAY98199.1| protein translocase subunit SecY [Shigella boydii]
gb|PAZ23490.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ30176.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ36133.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ39848.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ43656.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ50280.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ55248.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ55674.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ66326.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ69882.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ73288.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ80546.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ87200.1| protein translocase subunit SecY [Escherichia coli]
gb|PAZ93763.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB10220.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB15455.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK06929.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK15830.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK21985.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK28486.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK32416.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK40251.1| protein translocase subunit SecY [Escherichia coli]
gb|PBK45397.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB71451.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB76494.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB81359.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB91281.1| protein translocase subunit SecY [Escherichia coli]
gb|ATB96383.1| protein translocase subunit SecY [Escherichia coli]
gb|ATC01088.1| protein translocase subunit SecY [Escherichia coli]
gb|ATC09431.1| protein translocase subunit SecY [Escherichia coli]
gb|ATC10786.1| protein translocase subunit SecY [Escherichia coli]
gb|ATC15681.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN53535.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN55536.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN56266.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN74623.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN75262.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN85805.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN86581.1| protein translocase subunit SecY [Escherichia coli]
gb|PBN92302.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO10022.1| protein translocase subunit SecY [Shigella sonnei]
gb|PBO42173.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO42519.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO43479.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO57634.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO60898.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO64687.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO68674.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO73339.1| protein translocase subunit SecY [Escherichia coli]
gb|PBO91042.1| protein translocase subunit SecY [Shigella boydii]
gb|PBO93179.1| protein translocase subunit SecY [Shigella sonnei]
gb|PBO93637.1| protein translocase subunit SecY [Escherichia coli]
gb|PBP02736.1| protein translocase subunit SecY [Shigella sonnei]
gb|PBP06563.1| protein translocase subunit SecY [Shigella sonnei]
gb|PBQ37007.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ45063.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ51023.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ55968.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ60370.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ66240.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ71266.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ75781.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ80963.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ86276.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ91725.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ96898.1| protein translocase subunit SecY [Escherichia coli]
gb|PBQ98239.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR06944.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR20575.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR22619.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR28117.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR33210.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR44571.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR49741.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR54747.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR59864.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR65003.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR70545.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR74809.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR80311.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR85996.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR96211.1| protein translocase subunit SecY [Escherichia coli]
gb|PBR96868.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS06252.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS22078.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS27024.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS31945.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS38003.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS40984.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS44694.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS52210.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS56357.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS60007.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS65498.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS73651.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS75006.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS80407.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS85995.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS89763.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS93519.1| protein translocase subunit SecY [Escherichia coli]
gb|PBS99671.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT03818.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT11364.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT16314.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT23050.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT26774.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT28629.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT36022.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT39378.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT40877.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT48863.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT52472.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT56004.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT63843.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT67427.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT73967.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT78671.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT83056.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT88002.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT89763.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT97635.1| protein translocase subunit SecY [Escherichia coli]
gb|PBT98908.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU03489.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU07479.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU12382.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU19845.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU22868.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU27614.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU32432.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU37805.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU41280.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU47904.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU55295.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU56940.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU62208.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU71019.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU75145.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU80308.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU86056.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU92096.1| protein translocase subunit SecY [Escherichia coli]
gb|PBU92142.1| protein translocase subunit SecY [Escherichia coli]
gb|PCD47321.1| protein translocase subunit SecY [Escherichia coli]
gb|PCD53189.1| protein translocase subunit SecY [Escherichia coli]
gb|PCD74458.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG21348.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG26665.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG31448.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG39163.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG41771.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG47042.1| protein translocase subunit SecY [Escherichia coli]
gb|PCG52525.1| protein translocase subunit SecY [Escherichia coli]
gb|ATG08735.1| protein translocase subunit SecY [Escherichia coli]
gb|ATG12110.1| protein translocase subunit SecY [Escherichia coli]
gb|ATG63851.1| protein translocase subunit SecY [Escherichia coli O104:H21 str.
CFSAN002236]
gb|PCM04817.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM06920.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM09235.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM19356.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM20725.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM29013.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PCM34919.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO21964.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO30846.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO54964.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO59227.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO75235.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO80338.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO85801.1| protein translocase subunit SecY [Escherichia coli]
gb|PCO96497.1| protein translocase subunit SecY [Escherichia coli]
gb|PCP02020.1| protein translocase subunit SecY [Escherichia coli]
gb|PCQ50256.1| protein translocase subunit SecY [Escherichia coli]
gb|PCQ81621.1| protein translocase subunit SecY [Escherichia coli]
gb|PCQ87106.1| protein translocase subunit SecY [Escherichia coli]
gb|PCQ92120.1| protein translocase subunit SecY [Escherichia coli]
gb|PCR52294.1| protein translocase subunit SecY [Escherichia coli]
gb|PCR57979.1| protein translocase subunit SecY [Escherichia coli]
gb|PCR62291.1| protein translocase subunit SecY [Escherichia coli]
gb|PCR67425.1| protein translocase subunit SecY [Escherichia coli]
gb|PCR73392.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS28580.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS33729.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS41877.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS45165.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS54256.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS60032.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS64805.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS69454.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS74184.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS80097.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS84032.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS89775.1| protein translocase subunit SecY [Escherichia coli]
gb|PCS95868.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT00153.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT11086.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT15374.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT21538.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT27670.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT30219.1| protein translocase subunit SecY [Escherichia coli]
gb|PCT37067.1| protein translocase subunit SecY [Escherichia coli]
gb|ATH69482.1| protein translocase subunit SecY [Shigella flexneri 1c]
gb|ATI08521.1| protein translocase subunit SecY [Escherichia coli M12]
gb|PDM28929.1| protein translocase subunit SecY [Escherichia coli]
gb|PDM43314.1| protein translocase subunit SecY [Escherichia coli]
gb|PDM85086.1| protein translocase subunit SecY [Escherichia coli]
gb|PDM90235.1| protein translocase subunit SecY [Escherichia coli]
gb|PDM95385.1| protein translocase subunit SecY [Escherichia coli]
gb|PDN00298.1| protein translocase subunit SecY [Escherichia coli]
gb|PDN91293.1| protein translocase subunit SecY [Escherichia coli]
gb|PDN94439.1| protein translocase subunit SecY [Escherichia coli]
gb|PDN98043.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO05775.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO14910.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO18427.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO25611.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO31864.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO34339.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO40863.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO45475.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO48723.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO55108.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO58862.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO61673.1| protein translocase subunit SecY [Escherichia coli]
gb|PDO67060.1| protein translocase subunit SecY [Escherichia coli]
gb|PDS07795.1| protein translocase subunit SecY [Escherichia coli]
gb|PDS12277.1| protein translocase subunit SecY [Escherichia coli]
gb|PDS17831.1| protein translocase subunit SecY [Escherichia coli]
gb|PDT93146.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU03863.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU09407.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU15464.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU19652.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU24881.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU30570.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU36218.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU42166.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU48466.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU54472.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU59882.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU65104.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU70575.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU75971.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU81524.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU87234.1| protein translocase subunit SecY [Escherichia coli]
gb|PDU93372.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV00013.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV04173.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV09596.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV15030.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV22027.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV25999.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV31718.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV37183.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV42422.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV48003.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV55931.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV61407.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV62596.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV68862.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV74429.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV79918.1| protein translocase subunit SecY [Escherichia coli]
gb|PDV92046.1| protein translocase subunit SecY [Escherichia coli]
gb|PEG21304.1| protein translocase subunit SecY [Escherichia coli]
gb|PEH63354.1| protein translocase subunit SecY [Escherichia coli]
gb|PEH93913.1| protein translocase subunit SecY [Escherichia coli]
gb|PEI00640.1| protein translocase subunit SecY [Escherichia coli]
gb|PEI18701.1| protein translocase subunit SecY [Escherichia coli]
gb|PGF63773.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGF64315.1| protein translocase subunit SecY [Escherichia coli]
gb|PGF67395.1| protein translocase subunit SecY [Escherichia coli]
gb|PGF73190.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGF80604.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGF91177.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGF94582.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG05856.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG07295.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG12348.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG17899.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG20546.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG29074.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG32000.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG32551.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG43203.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG48730.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG56581.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG57652.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG60091.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PGG63164.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PHG87951.1| protein translocase subunit SecY [Escherichia coli]
gb|PHG92525.1| protein translocase subunit SecY [Escherichia coli]
gb|PHH31977.1| protein translocase subunit SecY [Escherichia coli]
gb|ATM10141.1| protein translocase subunit SecY [Escherichia coli]
gb|ATM26876.1| protein translocase subunit SecY [Escherichia coli]
gb|ATM83233.1| protein translocase subunit SecY [Escherichia coli]
gb|PHK63584.1| protein translocase subunit SecY [Escherichia coli]
gb|PHK70383.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL24008.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL31657.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL34133.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL38035.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL43049.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL50171.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL53098.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL58371.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL62375.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL72378.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL92879.1| protein translocase subunit SecY [Escherichia coli]
gb|PHL97957.1| protein translocase subunit SecY [Escherichia coli]
gb|PHN12132.1| protein translocase subunit SecY [Escherichia coli]
gb|ATO77989.1| preprotein translocase subunit SecY [Escherichia coli O91 str. RM7190]
gb|PHU43176.1| protein translocase subunit SecY [Shigella flexneri]
gb|PHU47641.1| protein translocase subunit SecY [Shigella flexneri]
gb|PHU52081.1| protein translocase subunit SecY [Shigella flexneri]
gb|PHU56638.1| protein translocase subunit SecY [Shigella flexneri]
gb|PHU71591.1| protein translocase subunit SecY [Shigella boydii]
gb|PHU84732.1| protein translocase subunit SecY [Shigella boydii]
gb|PHU93581.1| protein translocase subunit SecY [Shigella boydii]
gb|PHU97632.1| protein translocase subunit SecY [Shigella boydii]
emb|SLM08410.1| preprotein translocase subunit SecY [Escherichia coli O127:H6]
emb|SNU19783.1| preprotein translocase subunit SecY [Escherichia coli O127:H6]
gb|ATP24706.1| protein translocase subunit SecY [Escherichia coli]
gb|PHW94244.1| protein translocase subunit SecY [Escherichia coli]
gb|PHX01802.1| protein translocase subunit SecY [Escherichia coli]
gb|PIA77921.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PIM06392.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM11347.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM16000.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM21001.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM26220.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM30924.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM36135.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM41429.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM45878.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM59617.1| protein translocase subunit SecY [Escherichia coli]
gb|PIM63934.1| protein translocase subunit SecY [Escherichia coli]
gb|ATU33414.1| protein translocase subunit SecY [Escherichia coli]
gb|ATV10599.1| protein translocase subunit SecY [Escherichia coli]
gb|ATV49204.1| protein translocase subunit SecY [Escherichia coli]
gb|ATV73619.1| protein translocase subunit SecY [Escherichia coli]
gb|PIS72708.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str. USDA
5905]
gb|ATW96095.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX10508.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX16618.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX17882.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX40679.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX48131.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX53084.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX56920.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF55464.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF60586.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF68876.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF69655.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF74271.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF82674.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF83822.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF88082.1| protein translocase subunit SecY [Escherichia coli]
gb|PJF96763.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG01305.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG02707.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG09547.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG11206.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG16364.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG24234.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG27191.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG35036.1| protein translocase subunit SecY [Escherichia coli]
gb|PJG73871.1| protein translocase subunit SecY [Escherichia coli]
gb|ATY20065.1| protein translocase subunit SecY [Escherichia coli]
gb|ATY25388.1| protein translocase subunit SecY [Escherichia coli]
gb|PJH96486.1| protein translocase subunit SecY [Escherichia coli]
gb|PJI57086.1| protein translocase subunit SecY [Escherichia coli]
gb|PJI61464.1| protein translocase subunit SecY [Escherichia coli]
gb|PJN77386.1| protein translocase subunit SecY [Escherichia coli]
gb|PJO15642.1| protein translocase subunit SecY [Escherichia coli]
gb|ATX34015.1| protein translocase subunit SecY [Escherichia coli]
gb|ATZ39916.1| protein translocase subunit SecY [Escherichia coli]
gb|PJR32668.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
TW14313]
gb|PJR38527.1| preprotein translocase subunit SecY [Escherichia coli O55:H7 str.
TB182A]
gb|PJR44084.1| preprotein translocase subunit SecY [Escherichia coli O157:H7 str.
EC1825]
gb|PJW22945.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW28463.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW37784.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW39473.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW48278.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW53173.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW58308.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW63082.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW67958.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW73343.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW77891.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW82685.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW87399.1| protein translocase subunit SecY [Escherichia coli]
gb|PJW98407.1| protein translocase subunit SecY [Escherichia coli]
gb|PJX05265.1| protein translocase subunit SecY [Escherichia coli]
gb|ATZ33108.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PJX77638.1| protein translocase subunit SecY [Escherichia coli]
gb|PJX87772.1| protein translocase subunit SecY [Escherichia coli]
gb|PJX93393.1| protein translocase subunit SecY [Escherichia coli]
gb|PJX96596.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY04254.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY09639.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY15393.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY20944.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY25605.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY28223.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY35544.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY41317.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY42624.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY52541.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY55999.1| protein translocase subunit SecY [Escherichia coli]
gb|PJY58337.1| protein translocase subunit SecY [Escherichia coli]
emb|SMZ43451.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Escherichia coli]
gb|AUA41115.1| protein translocase subunit SecY [Escherichia coli]
gb|AUA43926.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD52387.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD56171.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD61479.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD67452.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD73258.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD85881.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD87349.1| protein translocase subunit SecY [Escherichia coli]
gb|PKD93240.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE04436.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE11157.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE76964.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE84935.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE88086.1| protein translocase subunit SecY [Escherichia coli]
gb|PKE91502.1| protein translocase subunit SecY [Escherichia coli]
gb|PKF02973.1| protein translocase subunit SecY [Escherichia coli]
gb|PKF06120.1| protein translocase subunit SecY [Escherichia coli]
gb|PKF16746.1| protein translocase subunit SecY [Escherichia coli]
gb|PKF54218.1| protein translocase subunit SecY [Escherichia coli]
gb|PKG04625.1| protein translocase subunit SecY [Escherichia coli]
gb|PKI89077.1| protein translocase subunit SecY [Escherichia coli]
gb|PKI95481.1| protein translocase subunit SecY [Escherichia coli]
gb|PKI97738.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ05275.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ14618.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ16308.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ16375.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ30563.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ32073.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ37070.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ41843.1| protein translocase subunit SecY [Escherichia coli]
gb|PKJ50289.1| protein translocase subunit SecY [Escherichia coli]
gb|AUF78392.1| protein translocase subunit SecY [Escherichia coli O121:H19]
gb|AUG18004.1| protein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|PKQ94252.1| protein translocase subunit SecY [Escherichia coli]
gb|PKR61634.1| protein translocase subunit SecY [Escherichia coli]
gb|PKR67437.1| protein translocase subunit SecY [Escherichia coli]
gb|PKR75427.1| protein translocase subunit SecY [Escherichia coli]
gb|AUG66441.1| protein translocase subunit SecY [Escherichia coli]
gb|AUG95203.1| Sec Translocation Complex [Escherichia coli]
gb|PKZ13188.1| protein translocase subunit SecY [Escherichia coli]
gb|PKZ30250.1| protein translocase subunit SecY [Escherichia coli]
gb|PKZ47820.1| protein translocase subunit SecY [Escherichia coli]
gb|PKZ77286.1| protein translocase subunit SecY [Escherichia coli]
gb|PLA85203.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB01566.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB59507.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB65048.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB65988.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB71502.1| protein translocase subunit SecY [Escherichia coli]
gb|PLB75750.1| protein translocase subunit SecY [Escherichia coli]
gb|AUJ89395.1| protein translocase subunit SecY [Escherichia coli]
gb|AUJ97732.1| protein translocase subunit SecY [Escherichia coli]
gb|AUJ99378.1| protein translocase subunit SecY [Escherichia coli]
gb|AUK04852.1| protein translocase subunit SecY [Escherichia coli]
gb|AUK09751.1| protein translocase subunit SecY [Escherichia coli]
gb|AUK20141.1| protein translocase subunit SecY [Escherichia coli]
gb|PLJ80081.1| protein translocase subunit SecY [Escherichia coli]
gb|PLJ81339.1| protein translocase subunit SecY [Escherichia coli]
gb|PLJ88144.1| protein translocase subunit SecY [Escherichia coli]
gb|PLJ96106.1| protein translocase subunit SecY [Escherichia coli]
gb|PLJ97635.1| protein translocase subunit SecY [Escherichia coli]
gb|PLK07552.1| protein translocase subunit SecY [Escherichia coli]
gb|PLK08630.1| protein translocase subunit SecY [Escherichia coli]
gb|PLR05698.1| protein translocase subunit SecY [Escherichia coli]
gb|AUF92738.1| protein translocase subunit SecY [Escherichia coli]
gb|AUL61845.1| protein translocase subunit SecY [Escherichia coli]
gb|AUL68383.1| protein translocase subunit SecY [Escherichia coli]
gb|AUL83217.1| protein translocase subunit SecY [Escherichia coli]
gb|AUL92150.1| protein translocase subunit SecY [Escherichia coli]
gb|AUM06358.1| protein translocase subunit SecY [Escherichia coli]
gb|AUM20746.1| protein translocase subunit SecY [Escherichia coli]
gb|AUN45944.1| protein translocase subunit SecY [Escherichia coli]
gb|PMB59861.1| protein translocase subunit SecY [Escherichia coli]
gb|PMD78099.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PMD88682.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PMD90155.1| preprotein translocase subunit SecY [Escherichia coli]
gb|PME00291.1| preprotein translocase subunit SecY [Escherichia coli]
emb|SOQ98209.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ89482.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOR03700.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ90398.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ63955.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ69879.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ76129.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ83472.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOQ72414.1| preprotein translocase membrane subunit [Escherichia coli]
emb|SOR07292.1| preprotein translocase membrane subunit [Escherichia coli]
gb|AUO34161.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|AUO39996.1| protein translocase subunit SecY [Escherichia coli]
gb|AUO55643.1| protein translocase subunit SecY [Escherichia coli]
gb|PNB89663.1| protein translocase subunit SecY [Escherichia coli]
gb|PNB94490.1| protein translocase subunit SecY [Escherichia coli]
gb|PNC07457.1| protein translocase subunit SecY [Escherichia coli]
gb|PND43330.1| protein translocase subunit SecY [Escherichia coli]
gb|AUQ39145.1| protein translocase subunit SecY [Escherichia coli]
gb|PND67112.1| protein translocase subunit SecY [Escherichia coli]
gb|PND72786.1| protein translocase subunit SecY [Escherichia coli]
gb|PND76284.1| protein translocase subunit SecY [Escherichia coli]
gb|PND84356.1| protein translocase subunit SecY [Escherichia coli]
gb|PNE00038.1| protein translocase subunit SecY [Escherichia coli]
gb|PNL70595.1| protein translocase subunit SecY [Escherichia coli O157]
gb|PNN26726.1| protein translocase subunit SecY [Escherichia coli]
gb|PNO96514.1| protein translocase subunit SecY [Escherichia coli]
gb|PNP02801.1| protein translocase subunit SecY [Shigella flexneri]
gb|PNP62579.1| protein translocase subunit SecY [Escherichia coli]
gb|AUP45010.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AUS36568.1| protein translocase subunit SecY [Escherichia coli]
gb|PNR01178.1| protein translocase subunit SecY [Escherichia coli]
gb|PNR04945.1| protein translocase subunit SecY [Escherichia coli]
gb|PNR11583.1| protein translocase subunit SecY [Escherichia coli]
gb|PNR16438.1| protein translocase subunit SecY [Escherichia coli]
gb|PNR21350.1| protein translocase subunit SecY [Escherichia coli]
gb|PNS26253.1| protein translocase subunit SecY [Escherichia coli]
gb|AUT07421.1| protein translocase subunit SecY [Escherichia coli]
gb|AUN92137.1| protein translocase subunit SecY [Escherichia coli]
gb|PNY39758.1| protein translocase subunit SecY [Escherichia coli]
gb|PNY58082.1| protein translocase subunit SecY [Escherichia coli]
gb|PNY58742.1| protein translocase subunit SecY [Escherichia coli]
gb|PNY65068.1| protein translocase subunit SecY [Escherichia coli]
gb|AUV22268.1| protein translocase subunit SecY [Escherichia coli]
gb|AUV32263.1| protein translocase subunit SecY [Escherichia coli]
gb|POF66618.1| protein translocase subunit SecY [Escherichia coli]
gb|POF71085.1| protein translocase subunit SecY [Escherichia coli]
gb|POF75850.1| protein translocase subunit SecY [Escherichia coli]
gb|POF81228.1| protein translocase subunit SecY [Escherichia coli]
gb|AUU30307.1| protein translocase subunit SecY [Shigella flexneri]
gb|POH45118.1| protein translocase subunit SecY [Escherichia coli]
gb|POH76532.1| protein translocase subunit SecY [Escherichia coli]
gb|POH98636.1| protein translocase subunit SecY [Escherichia coli]
gb|POI01901.1| protein translocase subunit SecY [Escherichia coli]
gb|POI03793.1| protein translocase subunit SecY [Escherichia coli]
gb|POI08391.1| protein translocase subunit SecY [Escherichia coli]
gb|POI09743.1| protein translocase subunit SecY [Escherichia coli]
gb|POL44991.1| protein translocase subunit SecY [Escherichia coli]
gb|POL55592.1| protein translocase subunit SecY [Escherichia coli]
gb|POL56506.1| protein translocase subunit SecY [Escherichia coli]
gb|POL66120.1| protein translocase subunit SecY [Escherichia coli]
gb|POL74585.1| protein translocase subunit SecY [Escherichia coli]
gb|POL82136.1| protein translocase subunit SecY [Escherichia coli]
gb|POL92611.1| protein translocase subunit SecY [Escherichia coli]
gb|POL93859.1| protein translocase subunit SecY [Escherichia coli]
gb|POL95206.1| protein translocase subunit SecY [Escherichia coli]
gb|AUX00690.1| Preprotein translocase secY subunit [Escherichia coli]
gb|POO36455.1| protein translocase subunit SecY [Escherichia coli]
gb|POO41707.1| protein translocase subunit SecY [Escherichia coli]
gb|POO42728.1| protein translocase subunit SecY [Escherichia coli]
gb|AUY03817.1| protein translocase subunit SecY [Escherichia coli]
gb|AUY44439.1| protein translocase subunit SecY [Escherichia coli]
gb|AUY27686.1| Protein translocase subunit SecY [Escherichia coli]
gb|POR90556.1| protein translocase subunit SecY [Shigella flexneri]
gb|POR95944.1| protein translocase subunit SecY [Shigella flexneri]
gb|POS11995.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS13040.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS26181.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS28508.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS33831.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS41732.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS43301.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS51882.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS53002.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POS98231.1| protein translocase subunit SecY [Escherichia coli]
gb|POS98722.1| protein translocase subunit SecY [Escherichia coli]
gb|POT00437.1| protein translocase subunit SecY [Escherichia coli]
gb|POT11326.1| protein translocase subunit SecY [Escherichia coli]
gb|POT12477.1| protein translocase subunit SecY [Escherichia coli]
gb|POT13126.1| protein translocase subunit SecY [Escherichia coli]
gb|POU25122.1| protein translocase subunit SecY [Escherichia coli]
gb|POV22525.1| protein translocase subunit SecY [Escherichia coli]
gb|AUZ90797.1| protein translocase subunit SecY [Escherichia coli]
gb|POZ10741.1| protein translocase subunit SecY [Escherichia coli]
gb|AVB43938.1| protein translocase subunit SecY [Escherichia coli]
gb|PPA55156.1| protein translocase subunit SecY [Escherichia coli]
gb|AVD30531.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE09203.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE12565.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE15400.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE23125.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE26147.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE34023.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE38555.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE42404.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE49541.1| protein translocase subunit SecY [Escherichia coli]
gb|PPE88699.1| protein translocase subunit SecY [Escherichia coli]
gb|AVE95581.1| protein translocase subunit SecY [Escherichia coli]
gb|AVG00941.1| protein translocase subunit SecY [Escherichia coli]
gb|PPO29505.1| protein translocase subunit SecY [Escherichia coli]
gb|PPO99169.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV43382.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV44507.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV53356.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV57270.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV57415.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV67419.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV73141.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV84209.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV92026.1| protein translocase subunit SecY [Escherichia coli]
gb|PPV98233.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW07900.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW13907.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW14044.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW22277.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW24399.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW26223.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW37911.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW38833.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW39851.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW53526.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW53835.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW59062.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW66858.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW72671.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW77712.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW78452.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW82539.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW92257.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW93723.1| protein translocase subunit SecY [Escherichia coli]
gb|PPW95060.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX06952.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX12507.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX13077.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX21650.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX21779.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX31153.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX33519.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX39412.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX42619.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX48657.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX56137.1| protein translocase subunit SecY [Escherichia coli]
gb|PPX57937.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY58320.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY63228.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY64665.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY70654.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY78922.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY79598.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY81556.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY94282.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY94562.1| protein translocase subunit SecY [Escherichia coli]
gb|PPY96891.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ07223.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ11023.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ17655.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ24236.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ25379.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ30475.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ39607.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ55863.1| protein translocase subunit SecY [Escherichia coli]
gb|PPZ96492.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA01060.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA01167.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA04563.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA15913.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA16254.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA18551.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA29085.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA33384.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA37842.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA44021.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA50092.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA61793.1| protein translocase subunit SecY [Escherichia coli]
gb|PQA63811.1| protein translocase subunit SecY [Escherichia coli]
gb|PQH06775.1| protein translocase subunit SecY [Escherichia coli]
gb|PQI97006.1| protein translocase subunit SecY [Escherichia fergusonii]
gb|PQI99508.1| protein translocase subunit SecY [Escherichia fergusonii]
gb|PQK18796.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK23992.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK31952.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK38492.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK43854.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK44266.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK54625.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK59209.1| protein translocase subunit SecY [Escherichia coli]
gb|PQK61088.1| protein translocase subunit SecY [Escherichia coli]
gb|AVI53459.1| protein translocase subunit SecY [Escherichia coli str. K-12 substr.
MG1655]
gb|AVJ15012.1| protein translocase subunit SecY [Escherichia coli]
gb|PQM84834.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQM92463.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQM98075.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN05569.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN08479.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|PQN18520.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN31218.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN35448.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN37808.1| protein translocase subunit SecY [Shigella boydii]
gb|PQN44241.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN54323.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|PQN60886.1| protein translocase subunit SecY [Shigella boydii]
gb|PQN62192.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN69045.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN73992.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN77933.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN80185.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN85149.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN89806.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQN97612.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQO02552.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQO08677.1| protein translocase subunit SecY [Shigella dysenteriae]
gb|PQO14544.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQO20787.1| protein translocase subunit SecY [Shigella flexneri]
gb|PQO64471.1| protein translocase subunit SecY [Escherichia coli]
gb|PQO66584.1| protein translocase subunit SecY [Escherichia coli]
gb|PQO69413.1| protein translocase subunit SecY [Escherichia coli]
gb|PQO79390.1| protein translocase subunit SecY [Escherichia coli]
gb|PQO83091.1| protein translocase subunit SecY [Escherichia coli]
gb|PQO83960.1| protein translocase subunit SecY [Escherichia coli]
gb|PQP07189.1| protein translocase subunit SecY [Escherichia coli]
gb|PQP27894.1| protein translocase subunit SecY [Escherichia coli]
gb|AVJ69024.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|AVJ77330.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|PQV17617.1| protein translocase subunit SecY [Escherichia coli]
gb|PQV23839.1| protein translocase subunit SecY [Escherichia coli]
gb|PQV30634.1| protein translocase subunit SecY [Escherichia coli]
gb|PQV31193.1| protein translocase subunit SecY [Escherichia coli]
gb|PQV35387.1| protein translocase subunit SecY [Escherichia coli]
gb|PRB32304.1| protein translocase subunit SecY [Escherichia coli]
gb|PRC17365.1| protein translocase subunit SecY [Escherichia coli]
gb|AVL31277.1| protein translocase subunit SecY [Escherichia coli O104:H4]
gb|AVM04855.1| protein translocase subunit SecY [Escherichia coli]
gb|PRO97799.1| protein translocase subunit SecY [Escherichia coli]
gb|PRO98343.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP09769.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP11375.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP11525.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP20403.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP23683.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP33960.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP35807.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP38393.1| protein translocase subunit SecY [Escherichia coli]
gb|PRP46900.1| protein translocase subunit SecY [Escherichia coli]
gb|AVM99575.1| protein translocase subunit SecY [Escherichia coli]
gb|AVN10945.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|AVL08259.1| protein translocase subunit SecY [Escherichia coli]
gb|AVN37953.1| protein translocase subunit SecY [Escherichia coli]
gb|PRT58518.1| protein translocase subunit SecY [Escherichia coli]
gb|PRW37001.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|PRW48532.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|PRW53592.1| preprotein translocase, SecY subunit [Escherichia coli]
gb|PSB94163.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF27052.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF28159.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF40959.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF46280.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF49602.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF57505.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF58703.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF64434.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF72548.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF74222.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF78387.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF86611.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF92061.1| protein translocase subunit SecY [Escherichia coli]
gb|PSF93551.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG01235.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG05292.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG09977.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG14893.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG20540.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG23864.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG29489.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG33774.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG38563.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG43971.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG47920.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG54409.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG57785.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG70032.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG75329.1| protein translocase subunit SecY [Escherichia coli]
gb|PSG81173.1| protein translocase subunit SecY [Escherichia coli]
gb|AVP31468.1| protein translocase subunit SecY [Escherichia coli]
gb|PSK09519.1| protein translocase subunit SecY [Escherichia coli]
gb|PSK20336.1| protein translocase subunit SecY [Escherichia coli]
gb|PSL60685.1| protein translocase subunit SecY [Escherichia coli]
gb|PSL69261.1| protein translocase subunit SecY [Escherichia coli]
gb|PSL70230.1| protein translocase subunit SecY [Escherichia coli]
gb|PSL75849.1| protein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_063267744.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KZH53392.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFAVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_047340654.1| preprotein translocase subunit SecY [Escherichia coli]
gb|AKK34897.1| preprotein translocase subunit SecY [Escherichia coli APEC O18]
gb|POL49909.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POL68658.1| preprotein translocase subunit SecY [Escherichia coli]
gb|POL83090.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRKLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_032314168.1| preprotein translocase subunit SecY [Escherichia coli]
gb|EYX87630.1| preprotein translocase subunit SecY [Escherichia coli O156:H25 str.
2011C-3602]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKLRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_021549622.1| protein translocase subunit SecY [Escherichia coli]
gb|EQV64291.1| preprotein translocase subunit SecY [Escherichia coli KOEGE 61 (174a)]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAQGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_020231571.1| protein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLIAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001666098.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ENG45206.1| preprotein translocase, SecY subunit [Escherichia coli p0305293.15]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLFVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001500112.1| preprotein translocase subunit SecY [Escherichia coli]
gb|END34385.1| preprotein translocase, SecY subunit [Escherichia coli P0302308.4]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAGLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001399816.1| preprotein translocase subunit SecY [Escherichia coli]
gb|ENA10175.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.1]
gb|ENB03619.1| preprotein translocase, SecY subunit [Escherichia coli 2862600]
gb|ENB16976.1| preprotein translocase, SecY subunit [Escherichia coli 2875150]
gb|ENB37246.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.10]
gb|ENB53602.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.12]
gb|ENB54073.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.11]
gb|ENB56923.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.15]
gb|ENB59074.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.6]
gb|ENB60209.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.2]
gb|ENB71911.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.7]
gb|ENB72710.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.9]
gb|ENB73511.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.8]
gb|END61816.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.4]
gb|END62703.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.3]
gb|ENG95319.1| preprotein translocase, SecY subunit [Escherichia coli P0298942.14]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKSGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_015962746.1| MULTISPECIES: protein translocase subunit SecY [Kluyvera]
gb|AGB76469.1| protein translocase subunit secY/sec61 alpha [Enterobacteriaceae
bacterium strain FGI 57]
gb|OAT55924.1| preprotein translocase subunit [Kluyvera georgiana ATCC 51603]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_006817268.1| preprotein translocase subunit SecY [Yokenella regensburgei]
gb|EHM50975.1| preprotein translocase, SecY subunit [Yokenella regensburgei ATCC
43003]
gb|KFD24265.1| preprotein translocase subunit [Yokenella regensburgei ATCC 49455]
Length = 443
Score = 791 bits (2042), Expect = 0.0
Identities = 410/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGFGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_096974258.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGIS+IIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISVIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_089589831.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTV+HPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVIHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_088540863.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGI+AGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIIAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_075332235.1| preprotein translocase subunit SecY [Shigella boydii]
gb|OOO76327.1| preprotein translocase subunit SecY [Shigella boydii]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RG+GNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGVGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_038158504.1| MULTISPECIES: preprotein translocase subunit SecY [Trabulsiella]
gb|KFC05136.1| preprotein translocase subunit [Trabulsiella guamensis ATCC 49490]
gb|KNC89558.1| preprotein translocase subunit SecY [Trabulsiella odontotermitis]
gb|KNC93541.1| preprotein translocase subunit SecY [Trabulsiella odontotermitis]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGFGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTL+GALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLIGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001557396.1| protein translocase subunit SecY [Escherichia coli]
gb|ELE21031.1| preprotein translocase subunit secY [Escherichia coli KTE58]
gb|EQR14747.1| preprotein translocase subunit secY [Escherichia coli HVH 118
(4-7345399)]
gb|ALD33507.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAG+IPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGIIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443
>ref|WP_001118868.1| protein translocase subunit SecY [Escherichia coli]
gb|EFK22947.1| preprotein translocase, SecY subunit [Escherichia coli MS 21-1]
gb|ELG32934.1| preprotein translocase subunit secY [Escherichia coli KTE84]
gb|EOU87282.1| preprotein translocase subunit secY [Escherichia coli KTE36]
gb|KQI88451.1| preprotein translocase subunit SecY [Escherichia coli]
gb|KXL35283.1| preprotein translocase subunit SecY [Escherichia coli]
Length = 443
Score = 790 bits (2041), Expect = 0.0
Identities = 409/443 (92%), Positives = 410/443 (92%)
Frame = +3
Query: 9330 MAKQPGLDFQSAXXXXXXXXXXXXFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI 9509
MAKQPGLDFQSA FVIGALIVFR+GSFIPIPGIDAAVLAKLLEQQRGTI
Sbjct: 1 MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRVGSFIPIPGIDAAVLAKLLEQQRGTI 60
Query: 9510 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 9689
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
Sbjct: 61 IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT 120
Query: 9690 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 9869
RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE
Sbjct: 121 RYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITE 180
Query: 9870 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHXXXXXXXXXXXXXXXXXXXXXERG 10049
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLH ERG
Sbjct: 181 RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG 240
Query: 10050 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 10229
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
Sbjct: 241 QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW 300
Query: 10230 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 10409
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
Sbjct: 301 NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE 360
Query: 10410 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 10589
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
Sbjct: 361 QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV 420
Query: 10590 QTLMMSSQYESALKKANLKGYGR 10658
QTLMMSSQYESALKKANLKGYGR
Sbjct: 421 QTLMMSSQYESALKKANLKGYGR 443