BLASTX nr result
ID: Ziziphus21_contig00048996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048996 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21049.1| Prefoldin [Macrophomina phaseolina MS6] 104 3e-20 >gb|EKG21049.1| Prefoldin [Macrophomina phaseolina MS6] Length = 1085 Score = 104 bits (259), Expect = 3e-20 Identities = 52/58 (89%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 336 STAQKSRSGTLTKGRRPDTRGSTDSGSAGSGHRVR--ISDYEGEKLSWGGRMKRRMGL 169 STAQKSRSGTLTKGRRPDTRGSTDSGSAGSGHRVR +SD E +KLSWGGRMKRRMGL Sbjct: 1028 STAQKSRSGTLTKGRRPDTRGSTDSGSAGSGHRVRGIVSDVENDKLSWGGRMKRRMGL 1085