BLASTX nr result
ID: Ziziphus21_contig00048988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048988 (238 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN63098.1| low-density lipoprotein receptor (ldl) [Anopheles... 59 1e-06 >gb|ETN63098.1| low-density lipoprotein receptor (ldl) [Anopheles darlingi] Length = 2743 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = +3 Query: 102 VQQGQCRQNQITCYDGFCIDGRQRCDGVKDCSQGEDEDGC 221 V+ G+CR Q TC +G CID QRCDG DC G DE GC Sbjct: 1675 VRHGECRPTQFTCANGLCIDANQRCDGYADCRDGSDEVGC 1714