BLASTX nr result
ID: Ziziphus21_contig00048948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048948 (384 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY24511.1| hypothetical protein UCDDS831_g02407 [Diplodia se... 73 1e-10 >gb|KKY24511.1| hypothetical protein UCDDS831_g02407 [Diplodia seriata] Length = 317 Score = 72.8 bits (177), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 342 WPWPPNVDDMKAVMGIENLFKRENWLYVRQDNND 241 WPWPPN+DDMK VMG+ENLFKRENW YVRQD+N+ Sbjct: 20 WPWPPNMDDMKEVMGVENLFKRENWFYVRQDDNN 53