BLASTX nr result
ID: Ziziphus21_contig00048938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048938 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY27297.1| putative c-4 methyl sterol oxidase [Diplodia seri... 83 8e-16 gb|EKG20031.1| hypothetical protein MPH_02662 [Macrophomina phas... 82 1e-13 ref|XP_007585315.1| putative c-4 methyl sterol oxidase protein [... 75 2e-11 ref|XP_007780666.1| methylsterol monooxygenase [Coniosporium apo... 74 3e-11 gb|KIW08367.1| hypothetical protein PV09_01283 [Verruconis gallo... 74 4e-11 ref|XP_003843571.1| hypothetical protein LEMA_P076810.1 [Leptosp... 70 5e-10 gb|KKY21515.1| putative galactose-1-phosphate uridylyltransferas... 69 2e-09 ref|XP_001938772.1| C-4 methylsterol oxidase [Pyrenophora tritic... 67 7e-09 ref|XP_014555084.1| hypothetical protein COCVIDRAFT_103260 [Bipo... 65 1e-08 ref|XP_007714606.1| hypothetical protein COCCADRAFT_102195 [Bipo... 65 1e-08 ref|XP_008029686.1| hypothetical protein SETTUDRAFT_121026 [Seto... 65 1e-08 gb|KNG49447.1| c-4 methylsterol oxidase [Stemphylium lycopersici] 65 2e-08 gb|KEQ85415.1| ERG25, C-4 methyl sterol oxidase [Aureobasidium p... 65 2e-08 ref|XP_007684188.1| hypothetical protein COCMIDRAFT_33341 [Bipol... 65 2e-08 ref|XP_003303774.1| hypothetical protein PTT_16124 [Pyrenophora ... 65 2e-08 ref|XP_013422949.1| ERG25, C-4 methyl sterol oxidase [Aureobasid... 65 3e-08 ref|XP_014078903.1| hypothetical protein COCC4DRAFT_32140 [Bipol... 65 3e-08 ref|XP_007703391.1| hypothetical protein COCSADRAFT_163448 [Bipo... 65 3e-08 gb|KKZ61098.1| methylsterol monooxygenase [Emmonsia crescens UAM... 64 3e-08 gb|EME41297.1| hypothetical protein DOTSEDRAFT_156069 [Dothistro... 64 3e-08 >gb|KKY27297.1| putative c-4 methyl sterol oxidase [Diplodia seriata] Length = 363 Score = 83.2 bits (204), Expect(2) = 8e-16 Identities = 41/62 (66%), Positives = 42/62 (67%) Frame = -1 Query: 186 FLLAEFSSAVTMNXXXXXXXXXXXXXTYWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDV 7 FLL E SSA MN TYW FEEVS+YNVSLNYFERLWLAWYTYM NDV Sbjct: 50 FLLVESSSAANMNSTTAAFAHPAPADTYWAQFEEVSKYNVSLNYFERLWLAWYTYMGNDV 109 Query: 6 LA 1 LA Sbjct: 110 LA 111 Score = 26.9 bits (58), Expect(2) = 8e-16 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -3 Query: 286 KTSRRRSVSPEHHLKRRGQPSPTSGPLRPPRRSF 185 KTSRRRS P + KRR +P G L P SF Sbjct: 19 KTSRRRSFLPPINWKRRVLSTPAPGSL--PSLSF 50 >gb|EKG20031.1| hypothetical protein MPH_02662 [Macrophomina phaseolina MS6] Length = 232 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +1 Query: 1 GQNIVVHVGVPGEPEALKVVEGDIVLRNLLKSTPISVSGRRAGEGSCR 144 GQ+IVVHVGVPG+PEAL+V+EGDIVLRNL++S P+ V GRRAG+GSCR Sbjct: 185 GQDIVVHVGVPGKPEALEVIEGDIVLRNLVESLPVGVGGRRAGKGSCR 232 >ref|XP_007585315.1| putative c-4 methyl sterol oxidase protein [Neofusicoccum parvum UCRNP2] gi|485921511|gb|EOD47214.1| putative c-4 methyl sterol oxidase protein [Neofusicoccum parvum UCRNP2] Length = 313 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YW FEE+S+YNVSLNYFERLWLAWYTYMNNDVLA Sbjct: 27 YWDQFEEISKYNVSLNYFERLWLAWYTYMNNDVLA 61 >ref|XP_007780666.1| methylsterol monooxygenase [Coniosporium apollinis CBS 100218] gi|494828537|gb|EON65349.1| methylsterol monooxygenase [Coniosporium apollinis CBS 100218] Length = 369 Score = 74.3 bits (181), Expect = 3e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG F+E+S+YNVSLNYFERLW AWYTYMNNDVLA Sbjct: 84 YWGQFDEISKYNVSLNYFERLWAAWYTYMNNDVLA 118 >gb|KIW08367.1| hypothetical protein PV09_01283 [Verruconis gallopava] Length = 311 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG FEE+S+YNV+LNYFERLWLAWYTYM NDVLA Sbjct: 23 YWGQFEEISKYNVNLNYFERLWLAWYTYMQNDVLA 57 >ref|XP_003843571.1| hypothetical protein LEMA_P076810.1 [Leptosphaeria maculans JN3] gi|312220150|emb|CBY00092.1| hypothetical protein LEMA_P076810.1 [Leptosphaeria maculans JN3] Length = 372 Score = 70.5 bits (171), Expect = 5e-10 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNYFE++WLAWYT+M NDVLA Sbjct: 86 YWGSFEEISKYNVQLNYFEKMWLAWYTWMGNDVLA 120 >gb|KKY21515.1| putative galactose-1-phosphate uridylyltransferase [Phaeomoniella chlamydospora] Length = 809 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG F+E+S+YNV L+YFERLW AWY YMNNDVLA Sbjct: 526 YWGQFDEISKYNVHLSYFERLWAAWYAYMNNDVLA 560 >ref|XP_001938772.1| C-4 methylsterol oxidase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985871|gb|EDU51359.1| C-4 methylsterol oxidase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 292 Score = 66.6 bits (161), Expect = 7e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+W+AWY +M NDVLA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWMAWYAWMGNDVLA 40 >ref|XP_014555084.1| hypothetical protein COCVIDRAFT_103260 [Bipolaris victoriae FI3] gi|578488060|gb|EUN25509.1| hypothetical protein COCVIDRAFT_103260 [Bipolaris victoriae FI3] Length = 292 Score = 65.5 bits (158), Expect = 1e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+WL WY +M ND+LA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWLTWYAWMGNDILA 40 >ref|XP_007714606.1| hypothetical protein COCCADRAFT_102195 [Bipolaris zeicola 26-R-13] gi|576916827|gb|EUC31071.1| hypothetical protein COCCADRAFT_102195 [Bipolaris zeicola 26-R-13] Length = 292 Score = 65.5 bits (158), Expect = 1e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+WL WY +M ND+LA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWLTWYAWMGNDILA 40 >ref|XP_008029686.1| hypothetical protein SETTUDRAFT_121026 [Setosphaeria turcica Et28A] gi|482805507|gb|EOA82593.1| hypothetical protein SETTUDRAFT_121026 [Setosphaeria turcica Et28A] Length = 301 Score = 65.5 bits (158), Expect = 1e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY E++W+AWY +M NDVLA Sbjct: 15 YWGSFEEISKYNVQLNYLEKMWMAWYAWMGNDVLA 49 >gb|KNG49447.1| c-4 methylsterol oxidase [Stemphylium lycopersici] Length = 1152 Score = 65.1 bits (157), Expect = 2e-08 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY E++W+AWY +M ND+LA Sbjct: 356 YWGSFEEISKYNVQLNYLEKMWMAWYAWMGNDILA 390 >gb|KEQ85415.1| ERG25, C-4 methyl sterol oxidase [Aureobasidium pullulans EXF-150] Length = 306 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YW FE VS+YNV LNYFERLW+AWY Y+ NDVLA Sbjct: 21 YWNQFESVSKYNVHLNYFERLWMAWYAYIGNDVLA 55 >ref|XP_007684188.1| hypothetical protein COCMIDRAFT_33341 [Bipolaris oryzae ATCC 44560] gi|576935785|gb|EUC49286.1| hypothetical protein COCMIDRAFT_33341 [Bipolaris oryzae ATCC 44560] Length = 292 Score = 65.1 bits (157), Expect = 2e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+W+ WY +M NDVLA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWMTWYAWMGNDVLA 40 >ref|XP_003303774.1| hypothetical protein PTT_16124 [Pyrenophora teres f. teres 0-1] gi|311319999|gb|EFQ88129.1| hypothetical protein PTT_16124 [Pyrenophora teres f. teres 0-1] Length = 292 Score = 65.1 bits (157), Expect = 2e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+W+ WY +M NDVLA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWMTWYAWMGNDVLA 40 >ref|XP_013422949.1| ERG25, C-4 methyl sterol oxidase [Aureobasidium namibiae CBS 147.97] gi|662511136|gb|KEQ68718.1| ERG25, C-4 methyl sterol oxidase [Aureobasidium namibiae CBS 147.97] Length = 306 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YW FE+VS+YNV LNYFE+LW+AWY Y+ NDVLA Sbjct: 21 YWNQFEKVSEYNVHLNYFEKLWMAWYAYIGNDVLA 55 >ref|XP_014078903.1| hypothetical protein COCC4DRAFT_32140 [Bipolaris maydis ATCC 48331] gi|451996823|gb|EMD89289.1| hypothetical protein COCHEDRAFT_1022707 [Bipolaris maydis C5] gi|477587914|gb|ENI04994.1| hypothetical protein COCC4DRAFT_32140 [Bipolaris maydis ATCC 48331] Length = 302 Score = 64.7 bits (156), Expect = 3e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+W+ WY +M ND+LA Sbjct: 16 YWGSFEEISKYNVQLNYLERMWMTWYAWMGNDILA 50 >ref|XP_007703391.1| hypothetical protein COCSADRAFT_163448 [Bipolaris sorokiniana ND90Pr] gi|451847749|gb|EMD61056.1| hypothetical protein COCSADRAFT_163448 [Bipolaris sorokiniana ND90Pr] Length = 292 Score = 64.7 bits (156), Expect = 3e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG+FEE+S+YNV LNY ER+W+ WY +M ND+LA Sbjct: 6 YWGSFEEISKYNVQLNYLERMWMTWYAWMGNDILA 40 >gb|KKZ61098.1| methylsterol monooxygenase [Emmonsia crescens UAMH 3008] Length = 332 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YWG FEE+S+YNV LN+ ER+W AWY YM NDVLA Sbjct: 47 YWGQFEEISKYNVHLNFVERMWAAWYAYMQNDVLA 81 >gb|EME41297.1| hypothetical protein DOTSEDRAFT_156069 [Dothistroma septosporum NZE10] Length = 319 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 105 YWGTFEEVSQYNVSLNYFERLWLAWYTYMNNDVLA 1 YW F+++SQYNVSLN+FERLW AWY +M NDVLA Sbjct: 34 YWHEFDQISQYNVSLNFFERLWAAWYAFMGNDVLA 68