BLASTX nr result
ID: Ziziphus21_contig00048937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048937 (338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY27285.1| putative golgi membrane [Diplodia seriata] 93 9e-17 ref|XP_007586252.1| putative golgi membrane protein [Neofusicocc... 93 9e-17 gb|EKG20069.1| hypothetical protein MPH_02618 [Macrophomina phas... 93 9e-17 ref|XP_013344539.1| hypothetical protein AUEXF2481DRAFT_39035 [A... 88 2e-15 gb|KEQ80699.1| Yip1-domain-containing protein [Aureobasidium pul... 88 2e-15 ref|XP_013429378.1| golgi membrane protein-like protein, partial... 88 2e-15 gb|KEQ63861.1| Yip1-domain-containing protein [Aureobasidium mel... 87 4e-15 dbj|GAM84095.1| hypothetical protein ANO11243_020870 [fungal sp.... 87 6e-15 gb|KHO01640.1| hypothetical protein MAM_00641 [Metarhizium album... 86 1e-14 ref|XP_007780092.1| hypothetical protein W97_04008 [Coniosporium... 86 1e-14 gb|KPM40206.1| hypothetical protein AK830_g6350 [Neonectria diti... 85 2e-14 ref|XP_003041534.1| hypothetical protein NECHADRAFT_35094 [Nectr... 84 4e-14 gb|KFA80008.1| hypothetical protein S40288_01830 [Stachybotrys c... 84 5e-14 gb|KEY75162.1| hypothetical protein S7711_01609 [Stachybotrys ch... 84 5e-14 gb|KND90830.1| Protein transport protein yip1 [Tolypocladium oph... 83 7e-14 gb|KJK86808.1| hypothetical protein H633G_09333 [Metarhizium ani... 83 7e-14 gb|KJK83891.1| hypothetical protein H634G_00254 [Metarhizium ani... 83 7e-14 ref|XP_014547346.1| hypothetical protein MBR_02639, partial [Met... 83 7e-14 emb|CEJ79858.1| Putative Yip1 domain-containing protein [Torrubi... 83 7e-14 gb|KFG86339.1| putative Golgi membrane protein [Metarhizium anis... 83 7e-14 >gb|KKY27285.1| putative golgi membrane [Diplodia seriata] Length = 314 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL Sbjct: 263 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 307 >ref|XP_007586252.1| putative golgi membrane protein [Neofusicoccum parvum UCRNP2] gi|485920192|gb|EOD46287.1| putative golgi membrane protein [Neofusicoccum parvum UCRNP2] Length = 315 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL Sbjct: 262 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 306 >gb|EKG20069.1| hypothetical protein MPH_02618 [Macrophomina phaseolina MS6] Length = 264 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL Sbjct: 213 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 257 >ref|XP_013344539.1| hypothetical protein AUEXF2481DRAFT_39035 [Aureobasidium subglaciale EXF-2481] gi|662538654|gb|KEQ95959.1| hypothetical protein AUEXF2481DRAFT_39035 [Aureobasidium subglaciale EXF-2481] Length = 296 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRM+GMRGLVAYPL LFYVGFGIMAIFSSRGTG+L Sbjct: 244 YSSSAMFCAVGRMTGMRGLVAYPLALFYVGFGIMAIFSSRGTGTL 288 >gb|KEQ80699.1| Yip1-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 297 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRM+GMRGLVAYPL LFYVGFGIMAIFSSRGTG+L Sbjct: 245 YSSSAMFCAVGRMTGMRGLVAYPLALFYVGFGIMAIFSSRGTGTL 289 >ref|XP_013429378.1| golgi membrane protein-like protein, partial [Aureobasidium namibiae CBS 147.97] gi|662518016|gb|KEQ75577.1| golgi membrane protein-like protein, partial [Aureobasidium namibiae CBS 147.97] Length = 274 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRM+GMRGLVAYPL LFYVGFGIMAIFSSRGTG+L Sbjct: 230 YSSSAMFCAVGRMTGMRGLVAYPLALFYVGFGIMAIFSSRGTGTL 274 >gb|KEQ63861.1| Yip1-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 296 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRM+GMRGLVAYPL LFYVGFGIMAIFSSRGTG++ Sbjct: 244 YSSSAMFCAVGRMTGMRGLVAYPLALFYVGFGIMAIFSSRGTGTI 288 >dbj|GAM84095.1| hypothetical protein ANO11243_020870 [fungal sp. No.11243] Length = 307 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRM+GMRGLVAYPL LFYVGFGIMAIFSS+G+GSL Sbjct: 256 YSSSAMFCAVGRMTGMRGLVAYPLALFYVGFGIMAIFSSKGSGSL 300 >gb|KHO01640.1| hypothetical protein MAM_00641 [Metarhizium album ARSEF 1941] Length = 318 Score = 85.5 bits (210), Expect = 1e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPLGLFYVGFGIM IFSSRG+GSL Sbjct: 265 YSASGMFCAVGRMKGMRGLVAYPLGLFYVGFGIMGIFSSRGSGSL 309 >ref|XP_007780092.1| hypothetical protein W97_04008 [Coniosporium apollinis CBS 100218] gi|494827879|gb|EON64775.1| hypothetical protein W97_04008 [Coniosporium apollinis CBS 100218] Length = 309 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YSSSAMFCAVGRMS MRGLVAYPL LFYVGFGIM IFSSRGTG+L Sbjct: 258 YSSSAMFCAVGRMSSMRGLVAYPLALFYVGFGIMGIFSSRGTGNL 302 >gb|KPM40206.1| hypothetical protein AK830_g6350 [Neonectria ditissima] Length = 653 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+SAMFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 600 YSASAMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 644 >ref|XP_003041534.1| hypothetical protein NECHADRAFT_35094 [Nectria haematococca mpVI 77-13-4] gi|256722438|gb|EEU35821.1| hypothetical protein NECHADRAFT_35094 [Nectria haematococca mpVI 77-13-4] Length = 319 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFC VGRM GMRGLVAYPLGLFYVGFGIM IFSSRG+GSL Sbjct: 266 YSASGMFCVVGRMKGMRGLVAYPLGLFYVGFGIMGIFSSRGSGSL 310 >gb|KFA80008.1| hypothetical protein S40288_01830 [Stachybotrys chartarum IBT 40288] Length = 330 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM+GMRGLVAYPL LFYVGFGI+AIFSSRG+GSL Sbjct: 277 YSASGMFCAVGRMTGMRGLVAYPLALFYVGFGIIAIFSSRGSGSL 321 >gb|KEY75162.1| hypothetical protein S7711_01609 [Stachybotrys chartarum IBT 7711] gi|667528530|gb|KFA56531.1| hypothetical protein S40293_01042 [Stachybotrys chartarum IBT 40293] Length = 329 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM+GMRGLVAYPL LFYVGFGI+AIFSSRG+GSL Sbjct: 276 YSASGMFCAVGRMTGMRGLVAYPLALFYVGFGIIAIFSSRGSGSL 320 >gb|KND90830.1| Protein transport protein yip1 [Tolypocladium ophioglossoides CBS 100239] Length = 322 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 269 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 313 >gb|KJK86808.1| hypothetical protein H633G_09333 [Metarhizium anisopliae BRIP 53284] Length = 291 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 238 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 282 >gb|KJK83891.1| hypothetical protein H634G_00254 [Metarhizium anisopliae BRIP 53293] Length = 237 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 184 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 228 >ref|XP_014547346.1| hypothetical protein MBR_02639, partial [Metarhizium brunneum ARSEF 3297] gi|743647125|gb|KID78191.1| hypothetical protein MBR_02639, partial [Metarhizium brunneum ARSEF 3297] Length = 316 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 263 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 307 >emb|CEJ79858.1| Putative Yip1 domain-containing protein [Torrubiella hemipterigena] Length = 316 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM+IFSSRG GSL Sbjct: 263 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMSIFSSRGAGSL 307 >gb|KFG86339.1| putative Golgi membrane protein [Metarhizium anisopliae] gi|743630749|gb|KID62166.1| hypothetical protein MAN_08170, partial [Metarhizium anisopliae ARSEF 549] Length = 316 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 336 YSSSAMFCAVGRMSGMRGLVAYPLGLFYVGFGIMAIFSSRGTGSL 202 YS+S MFCAVGRM GMRGLVAYPL LFYVGFGIM IFSSRG+GSL Sbjct: 263 YSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIMGIFSSRGSGSL 307