BLASTX nr result
ID: Ziziphus21_contig00048808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048808 (340 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007586999.1| hypothetical protein UCRNP2_7743 [Neofusicoc... 114 3e-23 gb|KKY17823.1| hypothetical protein UCDDS831_g06247 [Diplodia se... 103 4e-20 gb|EKG15616.1| hypothetical protein MPH_07051 [Macrophomina phas... 92 2e-16 ref|XP_007784888.1| hypothetical protein W97_08831 [Coniosporium... 74 6e-11 ref|XP_014077260.1| hypothetical protein COCC4DRAFT_142688 [Bipo... 73 1e-10 ref|XP_001800620.1| hypothetical protein SNOG_10344 [Parastagono... 73 1e-10 gb|KNG52532.1| hypothetical protein TW65_00345 [Stemphylium lyco... 72 2e-10 ref|XP_008025796.1| hypothetical protein SETTUDRAFT_171544 [Seto... 72 2e-10 ref|XP_007683583.1| hypothetical protein COCMIDRAFT_83284 [Bipol... 72 2e-10 ref|XP_007715902.1| hypothetical protein COCCADRAFT_39883 [Bipol... 72 2e-10 ref|XP_007699609.1| hypothetical protein COCSADRAFT_141691 [Bipo... 72 2e-10 ref|XP_003296810.1| hypothetical protein PTT_06999 [Pyrenophora ... 71 3e-10 ref|XP_001936250.1| conserved hypothetical protein [Pyrenophora ... 71 3e-10 ref|XP_003840090.1| hypothetical protein LEMA_P108760.1 [Leptosp... 69 1e-09 ref|XP_007920651.1| hypothetical protein MYCFIDRAFT_86082 [Pseud... 62 2e-07 ref|XP_013273534.1| hypothetical protein Z518_04374 [Rhinocladie... 60 5e-07 gb|KIV80985.1| hypothetical protein PV11_08440 [Exophiala sideris] 60 5e-07 gb|KIY01488.1| hypothetical protein Z520_03040 [Fonsecaea multim... 60 8e-07 gb|KIW35171.1| hypothetical protein PV07_01885 [Cladophialophora... 59 1e-06 gb|KIW44654.1| hypothetical protein PV06_03109 [Exophiala oligos... 58 3e-06 >ref|XP_007586999.1| hypothetical protein UCRNP2_7743 [Neofusicoccum parvum UCRNP2] gi|485919106|gb|EOD45537.1| hypothetical protein UCRNP2_7743 [Neofusicoccum parvum UCRNP2] Length = 411 Score = 114 bits (285), Expect = 3e-23 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = +3 Query: 159 MADNNQQDGVPGDFFSTIPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 MADNNQ DG GDFFSTIPNFVS+QLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP Sbjct: 1 MADNNQGDGASGDFFSTIPNFVSIQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 60 >gb|KKY17823.1| hypothetical protein UCDDS831_g06247 [Diplodia seriata] Length = 405 Score = 103 bits (258), Expect = 4e-20 Identities = 53/61 (86%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 159 MADNNQQ-DGVPGDFFSTIPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLL 335 MADNN Q DGV G FFSTIP F +QLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLL Sbjct: 1 MADNNNQGDGVRGQFFSTIPGFTDIQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLL 60 Query: 336 P 338 P Sbjct: 61 P 61 >gb|EKG15616.1| hypothetical protein MPH_07051 [Macrophomina phaseolina MS6] Length = 390 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 171 NQQDGVPGDFFSTIPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWM 317 +Q DGV GDFFSTIPNFVS+QLDIVGFLAILGEGSVLANAQVSTLSKWM Sbjct: 7 SQGDGVSGDFFSTIPNFVSIQLDIVGFLAILGEGSVLANAQVSTLSKWM 55 >ref|XP_007784888.1| hypothetical protein W97_08831 [Coniosporium apollinis CBS 100218] gi|494833668|gb|EON69571.1| hypothetical protein W97_08831 [Coniosporium apollinis CBS 100218] Length = 388 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 219 FVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 F LQLDIVGFLAILGEGSVLANAQVSTLSKW++VPRLLP Sbjct: 9 FEDLQLDIVGFLAILGEGSVLANAQVSTLSKWVYVPRLLP 48 >ref|XP_014077260.1| hypothetical protein COCC4DRAFT_142688 [Bipolaris maydis ATCC 48331] gi|451995369|gb|EMD87837.1| hypothetical protein COCHEDRAFT_1182833 [Bipolaris maydis C5] gi|477586266|gb|ENI03351.1| hypothetical protein COCC4DRAFT_142688 [Bipolaris maydis ATCC 48331] Length = 397 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 216 NFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 +F LQLDIVGFLAILGEGSVLANAQVSTLS+W+F+PRLLP Sbjct: 13 SFQELQLDIVGFLAILGEGSVLANAQVSTLSRWIFLPRLLP 53 >ref|XP_001800620.1| hypothetical protein SNOG_10344 [Parastagonospora nodorum SN15] gi|111061559|gb|EAT82679.1| hypothetical protein SNOG_10344 [Parastagonospora nodorum SN15] Length = 401 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 225 SLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 SLQLDIVGFLAILGEGSVLANAQVSTLSKW+F+PRL+P Sbjct: 16 SLQLDIVGFLAILGEGSVLANAQVSTLSKWIFLPRLIP 53 >gb|KNG52532.1| hypothetical protein TW65_00345 [Stemphylium lycopersici] Length = 786 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 228 LQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 LQLDIVGFLAILGEGSVLANAQVSTLSKW+F+PRLLP Sbjct: 17 LQLDIVGFLAILGEGSVLANAQVSTLSKWIFLPRLLP 53 >ref|XP_008025796.1| hypothetical protein SETTUDRAFT_171544 [Setosphaeria turcica Et28A] gi|482810564|gb|EOA87370.1| hypothetical protein SETTUDRAFT_171544 [Setosphaeria turcica Et28A] Length = 402 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 216 NFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 ++ LQLDIVGFLAILGEGSVLANAQ+STLSKW+F+PRLLP Sbjct: 13 SYGQLQLDIVGFLAILGEGSVLANAQISTLSKWIFLPRLLP 53 >ref|XP_007683583.1| hypothetical protein COCMIDRAFT_83284 [Bipolaris oryzae ATCC 44560] gi|576936468|gb|EUC49963.1| hypothetical protein COCMIDRAFT_83284 [Bipolaris oryzae ATCC 44560] Length = 397 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 216 NFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 ++ LQLDIVGFLAILGEGSVLANAQVSTLS+W+F+PRLLP Sbjct: 13 SYKELQLDIVGFLAILGEGSVLANAQVSTLSRWIFLPRLLP 53 >ref|XP_007715902.1| hypothetical protein COCCADRAFT_39883 [Bipolaris zeicola 26-R-13] gi|953427787|ref|XP_014555965.1| hypothetical protein COCVIDRAFT_38374 [Bipolaris victoriae FI3] gi|576915488|gb|EUC29785.1| hypothetical protein COCCADRAFT_39883 [Bipolaris zeicola 26-R-13] gi|578488950|gb|EUN26388.1| hypothetical protein COCVIDRAFT_38374 [Bipolaris victoriae FI3] Length = 397 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 216 NFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 ++ LQLDIVGFLAILGEGSVLANAQVSTLS+W+F+PRLLP Sbjct: 13 SYKELQLDIVGFLAILGEGSVLANAQVSTLSRWIFLPRLLP 53 >ref|XP_007699609.1| hypothetical protein COCSADRAFT_141691 [Bipolaris sorokiniana ND90Pr] gi|451851820|gb|EMD65118.1| hypothetical protein COCSADRAFT_141691 [Bipolaris sorokiniana ND90Pr] Length = 397 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 216 NFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 ++ LQLDIVGFLAILGEGSVLANAQVSTLS+W+F+PRLLP Sbjct: 13 SYKELQLDIVGFLAILGEGSVLANAQVSTLSRWIFLPRLLP 53 >ref|XP_003296810.1| hypothetical protein PTT_06999 [Pyrenophora teres f. teres 0-1] gi|311330888|gb|EFQ95095.1| hypothetical protein PTT_06999 [Pyrenophora teres f. teres 0-1] Length = 398 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 228 LQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 LQLDIVGFLAILGEGSVLANAQVSTLSKW+F+PRL+P Sbjct: 17 LQLDIVGFLAILGEGSVLANAQVSTLSKWIFLPRLIP 53 >ref|XP_001936250.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983349|gb|EDU48837.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 399 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 228 LQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 LQLDIVGFLAILGEGSVLANAQVSTLSKW+F+PRL+P Sbjct: 17 LQLDIVGFLAILGEGSVLANAQVSTLSKWIFLPRLIP 53 >ref|XP_003840090.1| hypothetical protein LEMA_P108760.1 [Leptosphaeria maculans JN3] gi|312216661|emb|CBX96611.1| hypothetical protein LEMA_P108760.1 [Leptosphaeria maculans JN3] Length = 398 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +3 Query: 225 SLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 +LQLDIVGFLAILGEGSVLANAQVSTLS+W+++PRL+P Sbjct: 16 ALQLDIVGFLAILGEGSVLANAQVSTLSRWIYLPRLIP 53 >ref|XP_007920651.1| hypothetical protein MYCFIDRAFT_86082 [Pseudocercospora fijiensis CIRAD86] gi|452988582|gb|EME88337.1| hypothetical protein MYCFIDRAFT_86082 [Pseudocercospora fijiensis CIRAD86] Length = 410 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +3 Query: 165 DNNQQDGVPG----DFFSTIPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRL 332 +NN +PG D + F + QLDIVGFLA+LGEG+VLANAQVS LS+ ++PRL Sbjct: 4 NNNVTVAIPGEANWDVWWQWNVFDNFQLDIVGFLAVLGEGAVLANAQVSALSRLFYLPRL 63 Query: 333 LP 338 LP Sbjct: 64 LP 65 >ref|XP_013273534.1| hypothetical protein Z518_04374 [Rhinocladiella mackenziei CBS 650.93] gi|759330071|gb|KIX06398.1| hypothetical protein Z518_04374 [Rhinocladiella mackenziei CBS 650.93] Length = 516 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 210 IPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 I NF LQLDIVG +A+LGEGSV NAQV++LS W +PRLLP Sbjct: 4 IDNFGDLQLDIVGIIAVLGEGSVTRNAQVTSLSWWSTIPRLLP 46 >gb|KIV80985.1| hypothetical protein PV11_08440 [Exophiala sideris] Length = 234 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 210 IPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 I NF SLQLDIVG +A+LGEGSV NAQV++LS W +PR LP Sbjct: 4 INNFQSLQLDIVGIIAVLGEGSVTRNAQVTSLSWWSILPRFLP 46 >gb|KIY01488.1| hypothetical protein Z520_03040 [Fonsecaea multimorphosa CBS 102226] Length = 505 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 210 IPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 I NF LQLDIVG +A+LGEGS+ NAQV++LS W VPRL+P Sbjct: 4 IANFNDLQLDIVGIIAVLGEGSITRNAQVTSLSWWSTVPRLMP 46 >gb|KIW35171.1| hypothetical protein PV07_01885 [Cladophialophora immunda] Length = 500 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 210 IPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 I NF LQLDIVG +A+LGEGS+ NAQV++LS W +PRL+P Sbjct: 4 IANFNDLQLDIVGIIAVLGEGSITRNAQVTSLSWWSTIPRLMP 46 >gb|KIW44654.1| hypothetical protein PV06_03109 [Exophiala oligosperma] Length = 540 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 210 IPNFVSLQLDIVGFLAILGEGSVLANAQVSTLSKWMFVPRLLP 338 I +F SLQLDIVG +A+LGE SV NAQV++LS W +PRLLP Sbjct: 4 IDSFDSLQLDIVGIIAVLGEASVTRNAQVTSLSWWSAIPRLLP 46