BLASTX nr result
ID: Ziziphus21_contig00048782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048782 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002877225.1| predicted protein [Arabidopsis lyrata subsp.... 66 9e-09 >ref|XP_002877225.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323063|gb|EFH53484.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 88 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 172 MFSESIVIGLTAQGLSLYSPFWSPVIGRKPVH 267 MFSESIVIGLTAQGLSLYSPFWSPVIGRKPV+ Sbjct: 1 MFSESIVIGLTAQGLSLYSPFWSPVIGRKPVN 32