BLASTX nr result
ID: Ziziphus21_contig00048720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048720 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21244.1| hypothetical protein MPH_01436 [Macrophomina phas... 102 9e-20 ref|XP_007583535.1| hypothetical protein UCRNP2_4251 [Neofusicoc... 99 1e-18 gb|KKY26542.1| hypothetical protein UCDDS831_g01202 [Diplodia se... 90 8e-16 gb|KMU83556.1| hypothetical protein CIHG_01339 [Coccidioides imm... 75 3e-11 gb|KMU72715.1| hypothetical protein CISG_03149 [Coccidioides imm... 75 3e-11 gb|KMP01047.1| hypothetical protein CIRG_01187 [Coccidioides imm... 75 3e-11 ref|XP_003066029.1| hypothetical protein CPC735_052540 [Coccidio... 75 3e-11 ref|XP_001247348.1| hypothetical protein CIMG_01119 [Coccidioide... 75 3e-11 gb|EEH19402.1| hypothetical protein PABG_01721 [Paracoccidioides... 71 3e-10 ref|XP_010759555.1| hypothetical protein PADG_03684 [Paracoccidi... 71 3e-10 ref|XP_007779105.1| hypothetical protein W97_03016 [Coniosporium... 71 4e-10 ref|XP_002797288.1| conserved hypothetical protein [Paracoccidio... 71 4e-10 gb|KKZ68176.1| hypothetical protein EMCG_06136 [Emmonsia crescen... 67 4e-09 gb|EER41680.1| conserved hypothetical protein [Histoplasma capsu... 67 4e-09 ref|XP_001538307.1| conserved hypothetical protein [Histoplasma ... 67 4e-09 gb|KKY27225.1| hypothetical protein UCRPC4_g01208 [Phaeomoniella... 67 5e-09 gb|EQL31528.1| hypothetical protein, variant [Blastomyces dermat... 66 9e-09 gb|EQL31527.1| hypothetical protein BDFG_06111 [Blastomyces derm... 66 9e-09 gb|EGE83561.1| hypothetical protein BDDG_06505 [Blastomyces derm... 66 9e-09 gb|EZF36259.1| hypothetical protein H101_00246 [Trichophyton int... 66 1e-08 >gb|EKG21244.1| hypothetical protein MPH_01436 [Macrophomina phaseolina MS6] Length = 735 Score = 102 bits (255), Expect = 9e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA 1 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA Sbjct: 1 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA 50 >ref|XP_007583535.1| hypothetical protein UCRNP2_4251 [Neofusicoccum parvum UCRNP2] gi|485924047|gb|EOD48960.1| hypothetical protein UCRNP2_4251 [Neofusicoccum parvum UCRNP2] Length = 118 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA 1 MQDPSFGVPQFLLPHVHLISSYRYPTLA LS+EQAV+FLLNAPKIVKDVA Sbjct: 1 MQDPSFGVPQFLLPHVHLISSYRYPTLANLSVEQAVEFLLNAPKIVKDVA 50 >gb|KKY26542.1| hypothetical protein UCDDS831_g01202 [Diplodia seriata] Length = 117 Score = 89.7 bits (221), Expect = 8e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA 1 MQDPSFGVPQFLLPHVHLISS+RYPT+ LSIEQA +FLL APK+VKD+A Sbjct: 1 MQDPSFGVPQFLLPHVHLISSFRYPTIGQLSIEQAAEFLLQAPKVVKDMA 50 >gb|KMU83556.1| hypothetical protein CIHG_01339 [Coccidioides immitis H538.4] Length = 484 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/50 (62%), Positives = 46/50 (92%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +MQDP+ GVPQ LLPH+HL+SSYRYP++A L++E AV++LL+APK+V+++ Sbjct: 9 RMQDPAGGVPQQLLPHMHLVSSYRYPSMANLTMETAVEYLLSAPKVVREL 58 >gb|KMU72715.1| hypothetical protein CISG_03149 [Coccidioides immitis RMSCC 3703] Length = 290 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/50 (62%), Positives = 46/50 (92%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +MQDP+ GVPQ LLPH+HL+SSYRYP++A L++E AV++LL+APK+V+++ Sbjct: 9 RMQDPAGGVPQQLLPHMHLVSSYRYPSMANLTMETAVEYLLSAPKVVREL 58 >gb|KMP01047.1| hypothetical protein CIRG_01187 [Coccidioides immitis RMSCC 2394] Length = 659 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/50 (62%), Positives = 46/50 (92%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +MQDP+ GVPQ LLPH+HL+SSYRYP++A L++E AV++LL+APK+V+++ Sbjct: 9 RMQDPAGGVPQQLLPHMHLVSSYRYPSMANLTMETAVEYLLSAPKVVREL 58 >ref|XP_003066029.1| hypothetical protein CPC735_052540 [Coccidioides posadasii C735 delta SOWgp] gi|240105691|gb|EER23884.1| hypothetical protein CPC735_052540 [Coccidioides posadasii C735 delta SOWgp] gi|855529864|gb|KMM65399.1| hypothetical protein CPAG_01750 [Coccidioides posadasii RMSCC 3488] Length = 701 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/50 (62%), Positives = 46/50 (92%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +MQDP+ GVPQ LLPH+HL+SSYRYP++A L++E AV++LL+APK+V+++ Sbjct: 9 RMQDPAGGVPQQLLPHMHLVSSYRYPSMANLTMETAVEYLLSAPKVVREL 58 >ref|XP_001247348.1| hypothetical protein CIMG_01119 [Coccidioides immitis RS] gi|767015480|gb|EAS35765.3| hypothetical protein CIMG_01119 [Coccidioides immitis RS] Length = 701 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/50 (62%), Positives = 46/50 (92%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +MQDP+ GVPQ LLPH+HL+SSYRYP++A L++E AV++LL+APK+V+++ Sbjct: 9 RMQDPAGGVPQQLLPHMHLVSSYRYPSMANLTMETAVEYLLSAPKVVREL 58 >gb|EEH19402.1| hypothetical protein PABG_01721 [Paracoccidioides brasiliensis Pb03] Length = 732 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+SSYRYP +TLS E AVD+L++APK+V+++ Sbjct: 1 MSDPAGGVPQQLLPHMHLVSSYRYPLTSTLSHETAVDYLISAPKVVREL 49 >ref|XP_010759555.1| hypothetical protein PADG_03684 [Paracoccidioides brasiliensis Pb18] gi|226292180|gb|EEH47600.1| hypothetical protein PADG_03684 [Paracoccidioides brasiliensis Pb18] Length = 733 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+SSYRYP +TLS E AVD+L++APK+V+++ Sbjct: 1 MSDPAGGVPQQLLPHMHLVSSYRYPLTSTLSHETAVDYLISAPKVVREL 49 >ref|XP_007779105.1| hypothetical protein W97_03016 [Coniosporium apollinis CBS 100218] gi|494826761|gb|EON63788.1| hypothetical protein W97_03016 [Coniosporium apollinis CBS 100218] Length = 719 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -2 Query: 147 QDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVA 1 QDPS GVP LLPHVHLIS YRYPTLA L E A+ +LL AP++VKD A Sbjct: 3 QDPSAGVPPALLPHVHLISDYRYPTLAHLRPEDALSYLLEAPRVVKDQA 51 >ref|XP_002797288.1| conserved hypothetical protein [Paracoccidioides lutzii Pb01] gi|226282660|gb|EEH38226.1| hypothetical protein PAAG_01147 [Paracoccidioides lutzii Pb01] Length = 733 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+SSYRYP +TLS E AVD+L++APK+V+++ Sbjct: 1 MPDPAGGVPQQLLPHMHLVSSYRYPLTSTLSHETAVDYLISAPKVVREL 49 >gb|KKZ68176.1| hypothetical protein EMCG_06136 [Emmonsia crescens UAMH 3008] Length = 749 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/49 (57%), Positives = 42/49 (85%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+S+YRYP ++ LS E AV++L++APK+V+++ Sbjct: 1 MADPAGGVPQQLLPHMHLVSNYRYPLMSNLSHETAVEYLISAPKVVREL 49 >gb|EER41680.1| conserved hypothetical protein [Histoplasma capsulatum H143] Length = 669 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+SSYRYP + LS E AV++L++APK+V+++ Sbjct: 1 MADPAGGVPQQLLPHMHLVSSYRYPLMNNLSHETAVEYLISAPKVVREL 49 >ref|XP_001538307.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|150414747|gb|EDN10109.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] Length = 563 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M DP+ GVPQ LLPH+HL+SSYRYP + LS E AV++L++APK+V+++ Sbjct: 1 MADPAGGVPQQLLPHMHLVSSYRYPLMNNLSHETAVEYLISAPKVVREL 49 >gb|KKY27225.1| hypothetical protein UCRPC4_g01208 [Phaeomoniella chlamydospora] Length = 804 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 M+DP+ GVP LL H+HL+S YRYP+++ LSIE V++LL APKIV+DV Sbjct: 5 MRDPAAGVPPQLLQHLHLVSKYRYPSVSMLSIETVVNYLLEAPKIVRDV 53 >gb|EQL31528.1| hypothetical protein, variant [Blastomyces dermatitidis ATCC 26199] Length = 671 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/50 (54%), Positives = 42/50 (84%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +M DP+ GVPQ LLPH+HL+S+YRYP + LS + AV++L++APK+V+++ Sbjct: 9 RMADPAGGVPQQLLPHMHLVSNYRYPVMNNLSHDTAVEYLISAPKVVREL 58 >gb|EQL31527.1| hypothetical protein BDFG_06111 [Blastomyces dermatitidis ATCC 26199] Length = 760 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/50 (54%), Positives = 42/50 (84%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +M DP+ GVPQ LLPH+HL+S+YRYP + LS + AV++L++APK+V+++ Sbjct: 9 RMADPAGGVPQQLLPHMHLVSNYRYPVMNNLSHDTAVEYLISAPKVVREL 58 >gb|EGE83561.1| hypothetical protein BDDG_06505 [Blastomyces dermatitidis ATCC 18188] Length = 500 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/50 (54%), Positives = 42/50 (84%) Frame = -2 Query: 153 KMQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 +M DP+ GVPQ LLPH+HL+S+YRYP + LS + AV++L++APK+V+++ Sbjct: 9 RMADPAGGVPQQLLPHMHLVSNYRYPVMNNLSHDTAVEYLISAPKVVREL 58 >gb|EZF36259.1| hypothetical protein H101_00246 [Trichophyton interdigitale H6] Length = 705 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -2 Query: 150 MQDPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDV 4 MQDP+ GVP LLPH+HL+SSYRYP A + E AV++LL APK+V+++ Sbjct: 1 MQDPAGGVPPQLLPHLHLVSSYRYPASAAFTHEMAVEYLLAAPKVVREL 49