BLASTX nr result
ID: Ziziphus21_contig00048711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048711 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20039.1| Cellular retinaldehyde-binding/triple function [M... 73 7e-11 gb|KKY27307.1| putative cral trio domain containing protein [Dip... 68 3e-09 ref|XP_007585318.1| putative phosphatidylinositol transporter pr... 65 2e-08 ref|XP_007779984.1| hypothetical protein W97_03900 [Coniosporium... 60 5e-07 ref|XP_002904755.1| phosphatidylinositol transfer protein SFH5, ... 56 9e-06 >gb|EKG20039.1| Cellular retinaldehyde-binding/triple function [Macrophomina phaseolina MS6] Length = 399 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 477 KKFTVLSYGNQLAGELGGNVPEVYGGKGGTLEAIGQQTQF 358 +KFTVLSYGNQLAGELG NVPEVYGGK TLE+IGQQT F Sbjct: 360 QKFTVLSYGNQLAGELGANVPEVYGGKASTLESIGQQTNF 399 >gb|KKY27307.1| putative cral trio domain containing protein [Diplodia seriata] Length = 368 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -2 Query: 477 KKFTVLSYGNQLAGELGGNVPEVYGGKGGTLEAIGQQTQF 358 +KFTVL+YGNQLAGELG NVPE YGGK G LE IG+QT+F Sbjct: 329 RKFTVLAYGNQLAGELGTNVPEAYGGKTGGLETIGEQTKF 368 >ref|XP_007585318.1| putative phosphatidylinositol transporter protein [Neofusicoccum parvum UCRNP2] gi|485921514|gb|EOD47217.1| putative phosphatidylinositol transporter protein [Neofusicoccum parvum UCRNP2] Length = 412 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 477 KKFTVLSYGNQLAGELGGNVPEVYGGKGGTLEAIGQQTQF 358 KKFTVLSYGNQLA ELG VPEVYGGK TLE +G+QT + Sbjct: 372 KKFTVLSYGNQLAAELGPQVPEVYGGKAATLETVGEQTLY 411 >ref|XP_007779984.1| hypothetical protein W97_03900 [Coniosporium apollinis CBS 100218] gi|494827742|gb|EON64667.1| hypothetical protein W97_03900 [Coniosporium apollinis CBS 100218] Length = 326 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 477 KKFTVLSYGNQLAGELGGNVPEVYGGKGGTLEAIGQ 370 KKFTVLSYGNQLAGELG VP YGGK G LE +G+ Sbjct: 285 KKFTVLSYGNQLAGELGSGVPGAYGGKAGALEGVGE 320 >ref|XP_002904755.1| phosphatidylinositol transfer protein SFH5, putative [Phytophthora infestans T30-4] gi|262095085|gb|EEY53137.1| phosphatidylinositol transfer protein SFH5, putative [Phytophthora infestans T30-4] Length = 251 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 477 KKFTVLSYGNQLAGELGGNVPEVYGGKGGTLEAIGQQT 364 +KFTVLSYG +L ELG ++PEVYGGK L+AIG+QT Sbjct: 213 RKFTVLSYGEELHTELGDSIPEVYGGKAAPLDAIGEQT 250