BLASTX nr result
ID: Ziziphus21_contig00048673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048673 (239 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG17074.1| AMP-dependent synthetase/ligase [Macrophomina pha... 113 5e-23 ref|XP_007584340.1| putative amp-binding enzyme protein [Neofusi... 111 2e-22 gb|KKY19109.1| putative peroxisomal amp binding enzyme [Diplodia... 107 5e-21 gb|KIW07023.1| hypothetical protein PV09_01917 [Verruconis gallo... 101 3e-19 ref|XP_013274150.1| hypothetical protein Z518_04990 [Rhinocladie... 98 2e-18 ref|XP_007777771.1| hypothetical protein W97_01676 [Coniosporium... 96 1e-17 ref|XP_007735860.1| hypothetical protein A1O3_07562 [Capronia ep... 95 2e-17 ref|XP_007720097.1| hypothetical protein A1O1_00993 [Capronia co... 94 3e-17 ref|XP_009152866.1| acyl-CoA synthetase [Exophiala dermatitidis ... 93 9e-17 ref|XP_009152867.1| acyl-CoA synthetase, variant [Exophiala derm... 93 9e-17 gb|KIW96656.1| hypothetical protein Z519_02047 [Cladophialophora... 92 1e-16 ref|XP_013322365.1| hypothetical protein PV05_01863 [Exophiala x... 92 1e-16 gb|KIX95911.1| hypothetical protein Z520_08166 [Fonsecaea multim... 92 2e-16 gb|KIW42346.1| hypothetical protein PV06_05907 [Exophiala oligos... 92 2e-16 ref|XP_013288288.1| hypothetical protein Z517_03730 [Fonsecaea p... 91 3e-16 gb|KIW30541.1| hypothetical protein, variant [Cladophialophora i... 91 3e-16 gb|KIW30540.1| hypothetical protein PV07_06279 [Cladophialophora... 91 3e-16 ref|XP_013346231.1| hypothetical protein AUEXF2481DRAFT_27066 [A... 91 3e-16 ref|XP_013265850.1| hypothetical protein A1O9_01237 [Exophiala a... 91 3e-16 ref|XP_007750174.1| hypothetical protein A1O5_11412 [Cladophialo... 91 3e-16 >gb|EKG17074.1| AMP-dependent synthetase/ligase [Macrophomina phaseolina MS6] Length = 590 Score = 113 bits (283), Expect = 5e-23 Identities = 55/59 (93%), Positives = 55/59 (93%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELFAG 62 G T GRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALV LFAG Sbjct: 521 GLTGGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVQALFAG 579 >ref|XP_007584340.1| putative amp-binding enzyme protein [Neofusicoccum parvum UCRNP2] gi|485922879|gb|EOD48202.1| putative amp-binding enzyme protein [Neofusicoccum parvum UCRNP2] Length = 563 Score = 111 bits (278), Expect = 2e-22 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELFAG 62 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTE+K V+ IPRNAMGKINKKALV LFAG Sbjct: 494 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTELKIVDGIPRNAMGKINKKALVQALFAG 552 >gb|KKY19109.1| putative peroxisomal amp binding enzyme [Diplodia seriata] Length = 581 Score = 107 bits (266), Expect = 5e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELFAG 62 GQTAG+GGKPWGP+DMRRAL+ +LANYKIPTE+K V++IPRNAMGKI+KKALVLELF+G Sbjct: 512 GQTAGKGGKPWGPLDMRRALKGILANYKIPTELKLVDNIPRNAMGKISKKALVLELFSG 570 >gb|KIW07023.1| hypothetical protein PV09_01917 [Verruconis gallopava] Length = 601 Score = 101 bits (251), Expect = 3e-19 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G+T GRGGKPWGPMD+RRALRDVLANYKIP +MK VESIPRNAMGKINKK LV +F Sbjct: 542 GKTGGRGGKPWGPMDLRRALRDVLANYKIPQDMKVVESIPRNAMGKINKKELVKTVF 598 >ref|XP_013274150.1| hypothetical protein Z518_04990 [Rhinocladiella mackenziei CBS 650.93] gi|759330687|gb|KIX07014.1| hypothetical protein Z518_04990 [Rhinocladiella mackenziei CBS 650.93] Length = 565 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G TAGRGGKPWG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK+LV ++F Sbjct: 507 GLTAGRGGKPWGVMDMRRALKDKLANYKIPQELKVVESIPRNAMGKINKKSLVTDVF 563 >ref|XP_007777771.1| hypothetical protein W97_01676 [Coniosporium apollinis CBS 100218] gi|494825268|gb|EON62454.1| hypothetical protein W97_01676 [Coniosporium apollinis CBS 100218] Length = 626 Score = 95.9 bits (237), Expect = 1e-17 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G+T GRGGKPWGPMDMRRAL++ L YKIP EMK VESIPRNAMGKINKK LV ++F Sbjct: 557 GKTGGRGGKPWGPMDMRRALKERLVGYKIPQEMKVVESIPRNAMGKINKKTLVKDVF 613 >ref|XP_007735860.1| hypothetical protein A1O3_07562 [Capronia epimyces CBS 606.96] gi|590006062|gb|EXJ81272.1| hypothetical protein A1O3_07562 [Capronia epimyces CBS 606.96] Length = 567 Score = 95.1 bits (235), Expect = 2e-17 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G T GRGGKPWG MDMRRAL+D LANYKIP E+K VESIPRNAMGK+NKK+LV +F Sbjct: 507 GLTGGRGGKPWGAMDMRRALKDRLANYKIPQELKVVESIPRNAMGKVNKKSLVKNVF 563 >ref|XP_007720097.1| hypothetical protein A1O1_00993 [Capronia coronata CBS 617.96] gi|590020671|gb|EXJ95868.1| hypothetical protein A1O1_00993 [Capronia coronata CBS 617.96] Length = 565 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G T GRGGKPWG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK L+ ++F Sbjct: 507 GLTGGRGGKPWGAMDMRRALKDRLANYKIPQELKIVESIPRNAMGKINKKNLIKDVF 563 >ref|XP_009152866.1| acyl-CoA synthetase [Exophiala dermatitidis NIH/UT8656] gi|378725947|gb|EHY52406.1| acyl-CoA synthetase [Exophiala dermatitidis NIH/UT8656] Length = 632 Score = 92.8 bits (229), Expect = 9e-17 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G TAG+GGKPW MDMRRAL+D LANYKIP E+K V+SIPRNAMGKINKK+LV ++F Sbjct: 570 GLTAGKGGKPWSVMDMRRALKDRLANYKIPQELKVVDSIPRNAMGKINKKSLVKDVF 626 >ref|XP_009152867.1| acyl-CoA synthetase, variant [Exophiala dermatitidis NIH/UT8656] gi|378725946|gb|EHY52405.1| acyl-CoA synthetase, variant [Exophiala dermatitidis NIH/UT8656] Length = 422 Score = 92.8 bits (229), Expect = 9e-17 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G TAG+GGKPW MDMRRAL+D LANYKIP E+K V+SIPRNAMGKINKK+LV ++F Sbjct: 360 GLTAGKGGKPWSVMDMRRALKDRLANYKIPQELKVVDSIPRNAMGKINKKSLVKDVF 416 >gb|KIW96656.1| hypothetical protein Z519_02047 [Cladophialophora bantiana CBS 173.52] Length = 568 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G+++GRGGK WG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK LV ++F Sbjct: 512 GKSSGRGGKQWGVMDMRRALKDKLANYKIPQELKAVESIPRNAMGKINKKMLVRQVF 568 >ref|XP_013322365.1| hypothetical protein PV05_01863 [Exophiala xenobiotica] gi|759285279|gb|KIW61781.1| hypothetical protein PV05_01863 [Exophiala xenobiotica] Length = 405 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G T GRGGK WG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK L+ ++F Sbjct: 344 GLTGGRGGKQWGVMDMRRALKDKLANYKIPQELKVVESIPRNAMGKINKKTLIKDVF 400 >gb|KIX95911.1| hypothetical protein Z520_08166 [Fonsecaea multimorphosa CBS 102226] Length = 569 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G++ GRGGK WG MDMRRAL+D L NYKIP E+K VESIPRNAMGKINKK LV E+F Sbjct: 513 GKSGGRGGKQWGVMDMRRALKDKLVNYKIPQELKVVESIPRNAMGKINKKMLVKEVF 569 >gb|KIW42346.1| hypothetical protein PV06_05907 [Exophiala oligosperma] Length = 614 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G TAG+GGK W MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK LV ++F Sbjct: 557 GMTAGKGGKAWSVMDMRRALKDKLANYKIPQELKVVESIPRNAMGKINKKTLVKDVF 613 >ref|XP_013288288.1| hypothetical protein Z517_03730 [Fonsecaea pedrosoi CBS 271.37] gi|759308076|gb|KIW84480.1| hypothetical protein Z517_03730 [Fonsecaea pedrosoi CBS 271.37] Length = 645 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELFA 65 G++ GRGGK WG MDMRRAL+D LANYKIP E+K VE IPRNAMGKINKK LV ++F+ Sbjct: 585 GKSGGRGGKQWGAMDMRRALKDKLANYKIPQELKVVEHIPRNAMGKINKKMLVKQVFS 642 >gb|KIW30541.1| hypothetical protein, variant [Cladophialophora immunda] Length = 405 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G++ G+GGK WG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK LV +F Sbjct: 349 GKSGGKGGKQWGAMDMRRALKDKLANYKIPQELKVVESIPRNAMGKINKKTLVRHVF 405 >gb|KIW30540.1| hypothetical protein PV07_06279 [Cladophialophora immunda] Length = 623 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G++ G+GGK WG MDMRRAL+D LANYKIP E+K VESIPRNAMGKINKK LV +F Sbjct: 567 GKSGGKGGKQWGAMDMRRALKDKLANYKIPQELKVVESIPRNAMGKINKKTLVRHVF 623 >ref|XP_013346231.1| hypothetical protein AUEXF2481DRAFT_27066 [Aureobasidium subglaciale EXF-2481] gi|662540403|gb|KEQ97704.1| hypothetical protein AUEXF2481DRAFT_27066 [Aureobasidium subglaciale EXF-2481] Length = 610 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/57 (71%), Positives = 51/57 (89%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G+TAG+ GKP+GPMD+RR L+D +AN+KIP E+K VESIPRNAMGKINKK LVL++F Sbjct: 539 GKTAGKDGKPFGPMDLRRGLKDKMANFKIPQELKLVESIPRNAMGKINKKQLVLQVF 595 >ref|XP_013265850.1| hypothetical protein A1O9_01237 [Exophiala aquamarina CBS 119918] gi|656917682|gb|KEF63260.1| hypothetical protein A1O9_01237 [Exophiala aquamarina CBS 119918] Length = 595 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G TAG+GGK W MDMRRAL+D LANYKIP E+K VESIP+NAMGKINKK+LV ++F Sbjct: 507 GMTAGKGGKQWAVMDMRRALKDKLANYKIPQELKVVESIPKNAMGKINKKSLVKDVF 563 >ref|XP_007750174.1| hypothetical protein A1O5_11412 [Cladophialophora psammophila CBS 110553] gi|589980407|gb|EXJ63651.1| hypothetical protein A1O5_11412 [Cladophialophora psammophila CBS 110553] Length = 568 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -2 Query: 238 GQTAGRGGKPWGPMDMRRALRDVLANYKIPTEMKTVESIPRNAMGKINKKALVLELF 68 G++ GRGGK WG MD+RRAL+D LANYKIP E+K VESIPRNAMGKINKK LV ++F Sbjct: 512 GKSGGRGGKQWGVMDLRRALKDQLANYKIPQELKVVESIPRNAMGKINKKMLVRQVF 568