BLASTX nr result
ID: Ziziphus21_contig00048648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048648 (264 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001945072.1| PREDICTED: pescadillo homolog [Acyrthosiphon... 79 2e-12 ref|XP_001656318.1| AAEL012980-PA [Aedes aegypti] gi|122114956|s... 77 5e-12 gb|KFB43262.1| hypothetical protein ZHAS_00011043 [Anopheles sin... 77 7e-12 ref|XP_014097041.1| PREDICTED: pescadillo homolog isoform X2 [Ba... 76 1e-11 ref|XP_014097040.1| PREDICTED: pescadillo homolog isoform X1 [Ba... 76 1e-11 ref|XP_013194581.1| PREDICTED: pescadillo homolog [Amyelois tran... 76 1e-11 ref|XP_012233692.1| PREDICTED: pescadillo homolog isoform X1 [Li... 76 1e-11 ref|XP_011254347.1| PREDICTED: pescadillo homolog [Camponotus fl... 76 1e-11 ref|XP_011200736.1| PREDICTED: pescadillo homolog [Bactrocera do... 76 1e-11 ref|XP_011194333.1| PREDICTED: pescadillo homolog [Bactrocera cu... 76 1e-11 gb|EFN69660.1| Pescadillo [Camponotus floridanus] 76 1e-11 ref|XP_001846610.1| pescadillo [Culex quinquefasciatus] gi|22989... 76 1e-11 ref|XP_014483595.1| PREDICTED: pescadillo homolog [Dinoponera qu... 75 1e-11 ref|XP_012349062.1| PREDICTED: pescadillo homolog isoform X2 [Ap... 75 1e-11 ref|XP_011646012.1| PREDICTED: pescadillo homolog [Pogonomyrmex ... 75 1e-11 ref|XP_006616360.1| PREDICTED: pescadillo homolog isoform X2 [Ap... 75 1e-11 ref|XP_006616359.1| PREDICTED: pescadillo homolog isoform X1 [Ap... 75 1e-11 ref|XP_006560946.1| PREDICTED: pescadillo homolog isoform X2 [Ap... 75 1e-11 ref|XP_006560945.1| PREDICTED: pescadillo homolog isoform X1 [Ap... 75 1e-11 ref|XP_004519354.1| PREDICTED: pescadillo homolog [Ceratitis cap... 75 1e-11 >ref|XP_001945072.1| PREDICTED: pescadillo homolog [Acyrthosiphon pisum] Length = 592 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -3 Query: 145 MVKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREP 5 M + KK+Q+GEGAR++TR+ ALNKLQL+L+DFRTLCIIKGIYPREP Sbjct: 1 MPMQKKKFQSGEGARYVTRRAALNKLQLSLKDFRTLCIIKGIYPREP 47 >ref|XP_001656318.1| AAEL012980-PA [Aedes aegypti] gi|122114956|sp|Q0IE95.1|PESC_AEDAE RecName: Full=Pescadillo homolog gi|108870590|gb|EAT34815.1| AAEL012980-PA [Aedes aegypti] Length = 609 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -3 Query: 145 MVKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 MVKR KYQ+GEGA+++TRK A+ KLQL+++DFR LCI+KGIYPREPK Sbjct: 1 MVKRNHKYQSGEGAQYMTRKAAMRKLQLSMQDFRRLCILKGIYPREPK 48 >gb|KFB43262.1| hypothetical protein ZHAS_00011043 [Anopheles sinensis] Length = 635 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 145 MVKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 MVKR KY+ GEG+ + TRK A+NKLQL++RDFR LCI+KGIYPREPK Sbjct: 1 MVKRFHKYKTGEGSLYYTRKAAMNKLQLSMRDFRQLCILKGIYPREPK 48 >ref|XP_014097041.1| PREDICTED: pescadillo homolog isoform X2 [Bactrocera oleae] Length = 588 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 142 VKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 ++R+KKYQ+GE A++ITR+ AL KLQL+L DFR LCIIKG+YPREPK Sbjct: 1 MRRLKKYQSGEAAQYITRRAALRKLQLSLNDFRRLCIIKGVYPREPK 47 >ref|XP_014097040.1| PREDICTED: pescadillo homolog isoform X1 [Bactrocera oleae] Length = 589 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 142 VKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 ++R+KKYQ+GE A++ITR+ AL KLQL+L DFR LCIIKG+YPREPK Sbjct: 1 MRRLKKYQSGEAAQYITRRAALRKLQLSLNDFRRLCIIKGVYPREPK 47 >ref|XP_013194581.1| PREDICTED: pescadillo homolog [Amyelois transitella] Length = 610 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 139 KRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 K+ KKY +GEGA+F+TRK AL KLQLTL+DFR +CI+KGIYPREP+ Sbjct: 4 KKKKKYSSGEGAQFMTRKAALKKLQLTLKDFRRICILKGIYPREPR 49 >ref|XP_012233692.1| PREDICTED: pescadillo homolog isoform X1 [Linepithema humile] Length = 605 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+FITR+ AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFITRRAALRKLQLTLNDFRKLCILKGIYPREPR 49 >ref|XP_011254347.1| PREDICTED: pescadillo homolog [Camponotus floridanus] gi|752874082|ref|XP_011254348.1| PREDICTED: pescadillo homolog [Camponotus floridanus] Length = 682 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+FITR+ AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFITRRAALRKLQLTLNDFRKLCILKGIYPREPR 49 >ref|XP_011200736.1| PREDICTED: pescadillo homolog [Bactrocera dorsalis] Length = 589 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 142 VKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 ++R+KKYQ+GE A++ITR+ AL KLQL+L DFR LCIIKG+YPREPK Sbjct: 1 MRRLKKYQSGEAAQYITRRAALRKLQLSLNDFRRLCIIKGVYPREPK 47 >ref|XP_011194333.1| PREDICTED: pescadillo homolog [Bactrocera cucurbitae] Length = 587 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 142 VKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 ++R+KKYQ+GE A++ITR+ AL KLQL+L DFR LCIIKG+YPREPK Sbjct: 1 MRRLKKYQSGEAAQYITRRAALRKLQLSLNDFRRLCIIKGVYPREPK 47 >gb|EFN69660.1| Pescadillo [Camponotus floridanus] Length = 638 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+FITR+ AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFITRRAALRKLQLTLNDFRKLCILKGIYPREPR 49 >ref|XP_001846610.1| pescadillo [Culex quinquefasciatus] gi|229891419|sp|B0WD26.1|PESC_CULQU RecName: Full=Pescadillo homolog gi|167880778|gb|EDS44161.1| pescadillo [Culex quinquefasciatus] Length = 607 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = -3 Query: 145 MVKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 MVKR K+Q+GEGA+++TRK A+ KLQL+++DFR LCI+KGIYPREPK Sbjct: 1 MVKRNHKFQSGEGAQYLTRKAAMRKLQLSMQDFRRLCILKGIYPREPK 48 >ref|XP_014483595.1| PREDICTED: pescadillo homolog [Dinoponera quadriceps] Length = 590 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 145 MVKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 +V+ KKYQ GEGA+FITR+ AL KLQLTL DFR +CI+KGIYPREP+ Sbjct: 2 VVRGKKKYQVGEGAQFITRRAALRKLQLTLNDFRKVCILKGIYPREPR 49 >ref|XP_012349062.1| PREDICTED: pescadillo homolog isoform X2 [Apis florea] Length = 594 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TRK AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRKAALKKLQLTLTDFRKLCILKGIYPREPR 49 >ref|XP_011646012.1| PREDICTED: pescadillo homolog [Pogonomyrmex barbatus] Length = 604 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TR+ AL KLQLTL+DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRRAALRKLQLTLKDFRKLCILKGIYPREPR 49 >ref|XP_006616360.1| PREDICTED: pescadillo homolog isoform X2 [Apis dorsata] Length = 594 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TRK AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRKAALKKLQLTLTDFRRLCILKGIYPREPR 49 >ref|XP_006616359.1| PREDICTED: pescadillo homolog isoform X1 [Apis dorsata] Length = 595 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TRK AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRKAALKKLQLTLTDFRRLCILKGIYPREPR 49 >ref|XP_006560946.1| PREDICTED: pescadillo homolog isoform X2 [Apis mellifera] Length = 593 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TRK AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRKAALKKLQLTLTDFRRLCILKGIYPREPR 49 >ref|XP_006560945.1| PREDICTED: pescadillo homolog isoform X1 [Apis mellifera] Length = 594 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 130 KKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 KKYQ+GEGA+F+TRK AL KLQLTL DFR LCI+KGIYPREP+ Sbjct: 7 KKYQSGEGAQFMTRKAALKKLQLTLTDFRRLCILKGIYPREPR 49 >ref|XP_004519354.1| PREDICTED: pescadillo homolog [Ceratitis capitata] Length = 587 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -3 Query: 142 VKRVKKYQAGEGARFITRKTALNKLQLTLRDFRTLCIIKGIYPREPK 2 ++R+KKYQ GE A++ITR+ AL KLQL+L DFR LCIIKG+YPREPK Sbjct: 1 MRRLKKYQTGEAAQYITRRAALRKLQLSLNDFRRLCIIKGVYPREPK 47