BLASTX nr result
ID: Ziziphus21_contig00048620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048620 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG17121.1| hypothetical protein MPH_05693 [Macrophomina phas... 61 3e-07 >gb|EKG17121.1| hypothetical protein MPH_05693 [Macrophomina phaseolina MS6] Length = 1060 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 325 EANFSKRYPSLSGLEMVEMEVPNNGRIRDV 236 EANFSKRYPSLSGLEMVEMEVPN GRIRDV Sbjct: 1031 EANFSKRYPSLSGLEMVEMEVPNGGRIRDV 1060