BLASTX nr result
ID: Ziziphus21_contig00048487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048487 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABM55651.1| hypothetical protein [Maconellicoccus hirsutus] 102 1e-19 >gb|ABM55651.1| hypothetical protein [Maconellicoccus hirsutus] Length = 245 Score = 102 bits (254), Expect = 1e-19 Identities = 42/67 (62%), Positives = 54/67 (80%) Frame = -3 Query: 202 MHFKFVFLTVVSHLICTCTAAETENKTITAVYYETYCPDSIKFITTQLYPTYEKLNGTYF 23 M+FK FL +V L+C+C+A ETENKT+ + YYETYCPDS+KFI QL+PTY KLNGT+F Sbjct: 1 MYFKLGFLVIVFQLMCSCSAGETENKTVVSCYYETYCPDSVKFIVEQLFPTYVKLNGTHF 60 Query: 22 TPHLQPF 2 PH+ P+ Sbjct: 61 IPHMLPY 67