BLASTX nr result
ID: Ziziphus21_contig00048409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048409 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16955.1| hypothetical protein MPH_05780 [Macrophomina phas... 91 3e-16 >gb|EKG16955.1| hypothetical protein MPH_05780 [Macrophomina phaseolina MS6] Length = 332 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/56 (76%), Positives = 48/56 (85%), Gaps = 1/56 (1%) Frame = -1 Query: 252 WEEAPPYSSPVDTRGPQLPNIQRLPSIHITTSVTPVEETPSQRIG-ENDGSNQGET 88 WEEAPPY+SPV+ P LPNIQRLPSIHIT SVTPVEETPS R+G EN+ S+QGET Sbjct: 273 WEEAPPYTSPVEASTPHLPNIQRLPSIHITASVTPVEETPSHRLGEENNNSHQGET 328