BLASTX nr result
ID: Ziziphus21_contig00048378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048378 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12844.1| Zinc finger U1-type protein [Macrophomina phaseol... 78 2e-12 ref|XP_007585379.1| putative c2h2 finger domain-containing prote... 75 2e-11 gb|KKY14203.1| putative c2h2 finger domain protein [Diplodia ser... 69 1e-09 ref|XP_007922096.1| hypothetical protein MYCFIDRAFT_150111 [Pseu... 60 5e-07 gb|EMF16302.1| hypothetical protein SEPMUDRAFT_145588 [Sphaeruli... 58 2e-06 ref|XP_007783405.1| hypothetical protein W97_07236 [Coniosporium... 57 5e-06 >gb|EKG12844.1| Zinc finger U1-type protein [Macrophomina phaseolina MS6] Length = 518 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 290 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ Sbjct: 483 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 518 >ref|XP_007585379.1| putative c2h2 finger domain-containing protein [Neofusicoccum parvum UCRNP2] gi|485921426|gb|EOD47147.1| putative c2h2 finger domain-containing protein [Neofusicoccum parvum UCRNP2] Length = 493 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 290 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 VEKREAKRAQRDQAKAEWTKNKKGN QKHFRDPLLQ Sbjct: 458 VEKREAKRAQRDQAKAEWTKNKKGNSQKHFRDPLLQ 493 >gb|KKY14203.1| putative c2h2 finger domain protein [Diplodia seriata] Length = 524 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 287 EKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 EKREAKRAQRDQAK EW KNKKGN QKHFRDPLLQ Sbjct: 490 EKREAKRAQRDQAKVEWQKNKKGNNQKHFRDPLLQ 524 >ref|XP_007922096.1| hypothetical protein MYCFIDRAFT_150111 [Pseudocercospora fijiensis CIRAD86] gi|452989742|gb|EME89497.1| hypothetical protein MYCFIDRAFT_150111 [Pseudocercospora fijiensis CIRAD86] Length = 539 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 290 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 VEKR KR QR +A+ EWTKNKKGNFQKHFRD LLQ Sbjct: 504 VEKRVQKREQRAEARYEWTKNKKGNFQKHFRDHLLQ 539 >gb|EMF16302.1| hypothetical protein SEPMUDRAFT_145588 [Sphaerulina musiva SO2202] Length = 530 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 290 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 VEKR+AKRAQR QA+ +W +++GN QKHFRDPLLQ Sbjct: 495 VEKRDAKRAQRAQARYQWGNDRRGNMQKHFRDPLLQ 530 >ref|XP_007783405.1| hypothetical protein W97_07236 [Coniosporium apollinis CBS 100218] gi|494831678|gb|EON68088.1| hypothetical protein W97_07236 [Coniosporium apollinis CBS 100218] Length = 572 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 290 VEKREAKRAQRDQAKAEWTKNKKGNFQKHFRDPLLQ 183 VEKRE KR QR QA+ +W NK+ NFQ+HFRDPLLQ Sbjct: 537 VEKRERKREQRAQARYQWGNNKRSNFQEHFRDPLLQ 572