BLASTX nr result
ID: Ziziphus21_contig00048369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048369 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG15755.1| RNA helicase ATP-dependent DEAD-box conserved sit... 79 1e-12 gb|KKY19294.1| putative dead box rna helicase [Diplodia seriata] 71 4e-10 ref|XP_007581838.1| putative dead box rna helicase protein [Neof... 60 8e-07 >gb|EKG15755.1| RNA helicase ATP-dependent DEAD-box conserved site [Macrophomina phaseolina MS6] Length = 675 Score = 79.3 bits (194), Expect = 1e-12 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = -2 Query: 210 MLAPLRRCSASLPRAVRLTALTRSALRNQCIASTRPVPPSRIAHQLSIRAFQSGVRLAAT 31 MLAPLRRC ASLPRA+ TALTR+ALRNQ + + RPV SR+A ++S+RAFQS VRLA Sbjct: 1 MLAPLRRCPASLPRALSATALTRTALRNQSVVAPRPVFSSRLAPRVSLRAFQSSVRLADA 60 Query: 30 PDPSSHD 10 + S + Sbjct: 61 SNSSQDE 67 >gb|KKY19294.1| putative dead box rna helicase [Diplodia seriata] Length = 621 Score = 70.9 bits (172), Expect = 4e-10 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 210 MLAPLRRCSASLPRAVRLTALTRSALRNQCIASTRPVPPSRIAHQLSIRAFQSGVRLAA 34 MLAPLRRC ASLPRA+ A TR ALR+ IAS R + SR+A LS+RAFQS VRLAA Sbjct: 1 MLAPLRRCPASLPRALGAAATTRLALRSTSIASPRALVSSRVAPLLSVRAFQSSVRLAA 59 >ref|XP_007581838.1| putative dead box rna helicase protein [Neofusicoccum parvum UCRNP2] gi|485926405|gb|EOD50680.1| putative dead box rna helicase protein [Neofusicoccum parvum UCRNP2] Length = 124 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/59 (62%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 210 MLAPLRRCSASLPRAVRLTALTRSALRNQCIASTRPV-PPSRIAHQLSIRAFQSGVRLA 37 MLAPLRRC ASLPRA+R A TRSALRN A R V SRI LS RAFQ R A Sbjct: 1 MLAPLRRCPASLPRALRTAAATRSALRNASTALPRTVLSSSRIVPLLSTRAFQLSARPA 59