BLASTX nr result
ID: Ziziphus21_contig00048236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048236 (261 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012251668.1| PREDICTED: probable cytochrome P450 6a14 [At... 61 4e-07 >ref|XP_012251668.1| PREDICTED: probable cytochrome P450 6a14 [Athalia rosae] Length = 666 Score = 60.8 bits (146), Expect = 4e-07 Identities = 22/60 (36%), Positives = 38/60 (63%) Frame = -3 Query: 187 YWYLKKSHKFFDQYNIPYPKPHWLFGHVKDMALMKKPLWNMYIDIYEKHPSDRFVGMYNI 8 YWYL+ ++++ N+P+ KPHW +G + + A KK +Y D+Y K S +F G++N+ Sbjct: 178 YWYLRNQFSYWERLNVPFVKPHWPYGSIAEFAKGKKSAGEVYADLYRKLKSHKFGGIWNL 237