BLASTX nr result
ID: Ziziphus21_contig00048214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048214 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007582484.1| putative 60s ribosomal protein mitochondrial... 75 2e-11 gb|EKG09232.1| Ribosomal protein L37 mitochondrial [Macrophomina... 74 5e-11 gb|KKY19342.1| putative ribosomal protein l37 mitochondrial [Dip... 68 3e-09 >ref|XP_007582484.1| putative 60s ribosomal protein mitochondrial precursor -like protein [Neofusicoccum parvum UCRNP2] gi|485925464|gb|EOD50029.1| putative 60s ribosomal protein mitochondrial precursor -like protein [Neofusicoccum parvum UCRNP2] Length = 209 Score = 74.7 bits (182), Expect = 2e-11 Identities = 41/62 (66%), Positives = 42/62 (67%) Frame = -3 Query: 188 MICPRCLLRAGSRGLRPSAAAAPNSSVRAFTTTRXXXXXXXXXXXARSASPGVPATSTSA 9 MICPRCLLRAGSRGLR AA +SS RAFTTTR ARSASP PATSTS Sbjct: 1 MICPRCLLRAGSRGLRSPPNAASSSSARAFTTTRAASAEAPTTDAARSASPNAPATSTST 60 Query: 8 AQ 3 AQ Sbjct: 61 AQ 62 >gb|EKG09232.1| Ribosomal protein L37 mitochondrial [Macrophomina phaseolina MS6] Length = 156 Score = 73.6 bits (179), Expect = 5e-11 Identities = 42/62 (67%), Positives = 44/62 (70%) Frame = -3 Query: 188 MICPRCLLRAGSRGLRPSAAAAPNSSVRAFTTTRXXXXXXXXXXXARSASPGVPATSTSA 9 MICPRC RAGSRGLR + AAA NSSVRAFTTTR A+SASP PATSTSA Sbjct: 1 MICPRCFFRAGSRGLR-APAAATNSSVRAFTTTRAASAKAPTTDAAKSASPNSPATSTSA 59 Query: 8 AQ 3 AQ Sbjct: 60 AQ 61 >gb|KKY19342.1| putative ribosomal protein l37 mitochondrial [Diplodia seriata] Length = 227 Score = 67.8 bits (164), Expect = 3e-09 Identities = 39/64 (60%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = -3 Query: 188 MICPRCLLRAGSRGLRPSAAAAPNS--SVRAFTTTRXXXXXXXXXXXARSASPGVPATST 15 MICPRCLLRAGSRGLR S +S ++RAFTTTR ARSASP PATST Sbjct: 1 MICPRCLLRAGSRGLRSSVTPTNSSTTTIRAFTTTRAASAKAPSTDAARSASPAPPATST 60 Query: 14 SAAQ 3 S AQ Sbjct: 61 SEAQ 64