BLASTX nr result
ID: Ziziphus21_contig00048207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048207 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007584220.1| putative chitin synthesis regulation congo r... 67 5e-09 gb|EKG17778.1| Chitin synthesis regulation Congo red resistance ... 67 5e-09 >ref|XP_007584220.1| putative chitin synthesis regulation congo red resistance rcr protein [Neofusicoccum parvum UCRNP2] gi|485923025|gb|EOD48301.1| putative chitin synthesis regulation congo red resistance rcr protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -3 Query: 197 NQPNGGYEMGTTGGPQQPQPAYTHDNSRGVENVYEXXXXXXPAKKEDGVIR 45 NQPNGGYE GTTG P QPQPAYTH+ SRG +NVYE PA K DGVIR Sbjct: 59 NQPNGGYETGTTGVPMQPQPAYTHE-SRGDQNVYEPPPGPPPA-KNDGVIR 107 >gb|EKG17778.1| Chitin synthesis regulation Congo red resistance RCR protein [Macrophomina phaseolina MS6] Length = 178 Score = 67.0 bits (162), Expect = 5e-09 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = -3 Query: 197 NQPNGGYEMGTTGG--PQQPQPAYTHDNSRGVENVYE--XXXXXXPAKKEDGVIR 45 NQPNGGYEMGTT PQ PQPAYTHD +RG E VYE AKK+DGV+R Sbjct: 124 NQPNGGYEMGTTTSSTPQPPQPAYTHDGARGGEAVYEPPTGPPPGQAKKDDGVVR 178