BLASTX nr result
ID: Ziziphus21_contig00048159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048159 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007581971.1| putative dna-directed rna polymerase ii prot... 82 2e-13 gb|EKG14968.1| DNA-directed RNA polymerase Rpb11 13-16kDa subuni... 82 2e-13 gb|KKY16723.1| putative dna-directed rna polymerase ii [Diplodia... 74 6e-11 emb|CCX05128.1| Similar to DNA-directed RNA polymerase II subuni... 70 6e-10 ref|XP_002836559.1| hypothetical protein [Tuber melanosporum Mel... 69 1e-09 ref|XP_003068128.1| RNA polymerase Rpb3/Rpb11 dimerization domai... 69 2e-09 ref|XP_001240328.1| DNA-directed RNA polymerase II [Coccidioides... 69 2e-09 ref|XP_008031539.1| hypothetical protein SETTUDRAFT_166391 [Seto... 67 7e-09 ref|XP_007688181.1| hypothetical protein COCMIDRAFT_26520 [Bipol... 67 7e-09 ref|XP_007702138.1| hypothetical protein COCSADRAFT_38897 [Bipol... 67 7e-09 ref|XP_007681753.1| hypothetical protein BAUCODRAFT_127330 [Baud... 66 9e-09 ref|XP_013340814.1| hypothetical protein AUEXF2481DRAFT_43083 [A... 65 2e-08 gb|KIW72559.1| hypothetical protein, variant [Capronia semiimmersa] 64 3e-08 gb|KIV95337.1| hypothetical protein PV10_03006 [Exophiala mesoph... 64 3e-08 gb|KIN03804.1| hypothetical protein OIDMADRAFT_18034 [Oidiodendr... 64 3e-08 gb|KIW30393.1| hypothetical protein PV07_06138 [Cladophialophora... 64 4e-08 gb|KJX93014.1| DNA-directed RNA polymerase II subunit like prote... 63 1e-07 gb|KIV77912.1| hypothetical protein PV11_09684 [Exophiala sideris] 63 1e-07 ref|XP_007781997.1| hypothetical protein W97_05926 [Coniosporium... 63 1e-07 ref|XP_003850628.1| hypothetical protein MYCGRDRAFT_105083 [Zymo... 63 1e-07 >ref|XP_007581971.1| putative dna-directed rna polymerase ii protein [Neofusicoccum parvum UCRNP2] gi|485926240|gb|EOD50556.1| putative dna-directed rna polymerase ii protein [Neofusicoccum parvum UCRNP2] Length = 121 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE Sbjct: 1 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 38 >gb|EKG14968.1| DNA-directed RNA polymerase Rpb11 13-16kDa subunit conserved site [Macrophomina phaseolina MS6] Length = 121 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE Sbjct: 1 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 38 >gb|KKY16723.1| putative dna-directed rna polymerase ii [Diplodia seriata] Length = 128 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 103 DRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 DRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE Sbjct: 12 DRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 45 >emb|CCX05128.1| Similar to DNA-directed RNA polymerase II subunit RPB11; acc. no. P38902 [Pyronema omphalodes CBS 100304] Length = 119 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLGDGE KV M+ DTR PNTAIFTFNKE Sbjct: 1 MNAPDRFELFLLGDGESKVTMEPDTRQPNTAIFTFNKE 38 >ref|XP_002836559.1| hypothetical protein [Tuber melanosporum Mel28] gi|295630386|emb|CAZ80750.1| unnamed protein product [Tuber melanosporum] Length = 119 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLGDGE KV M+ DTR PN AIFTFNKE Sbjct: 1 MNAPDRFELFLLGDGETKVSMEQDTRQPNAAIFTFNKE 38 >ref|XP_003068128.1| RNA polymerase Rpb3/Rpb11 dimerization domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|240107804|gb|EER25983.1| RNA polymerase Rpb3/Rpb11 dimerization domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|320032518|gb|EFW14471.1| DNA-directed RNA polymerase II [Coccidioides posadasii str. Silveira] gi|855534807|gb|KMM69720.1| DNA-directed RNA polymerase II subunit RPB11 [Coccidioides posadasii RMSCC 3488] Length = 128 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFE F+LG GEKKVEM+ DTRVP+TAIFTFNKE Sbjct: 1 MNAPDRFESFVLGPGEKKVEMETDTRVPSTAIFTFNKE 38 >ref|XP_001240328.1| DNA-directed RNA polymerase II [Coccidioides immitis RS] gi|767019363|gb|EAS28745.3| DNA-directed RNA polymerase II [Coccidioides immitis RS] gi|859411805|gb|KMP05849.1| DNA-directed RNA polymerase II [Coccidioides immitis RMSCC 2394] gi|875287091|gb|KMU80720.1| DNA-directed RNA polymerase 2 subunit RPB11 [Coccidioides immitis RMSCC 3703] Length = 128 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFE F+LG GEKKVEM+ DTRVP+TAIFTFNKE Sbjct: 1 MNAPDRFESFVLGPGEKKVEMETDTRVPSTAIFTFNKE 38 >ref|XP_008031539.1| hypothetical protein SETTUDRAFT_166391 [Setosphaeria turcica Et28A] gi|482803844|gb|EOA80969.1| hypothetical protein SETTUDRAFT_166391 [Setosphaeria turcica Et28A] Length = 130 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLL +G++KVE K +TRVPNTA+FTFNKE Sbjct: 1 MNAPDRFELFLLDEGQEKVEEKAETRVPNTAVFTFNKE 38 >ref|XP_007688181.1| hypothetical protein COCMIDRAFT_26520 [Bipolaris oryzae ATCC 44560] gi|628184187|ref|XP_007706988.1| hypothetical protein COCCADRAFT_693 [Bipolaris zeicola 26-R-13] gi|928521896|ref|XP_014079745.1| hypothetical protein COCC4DRAFT_71521 [Bipolaris maydis ATCC 48331] gi|953438725|ref|XP_014561434.1| hypothetical protein COCVIDRAFT_11889 [Bipolaris victoriae FI3] gi|477588758|gb|ENI05836.1| hypothetical protein COCC4DRAFT_71521 [Bipolaris maydis ATCC 48331] gi|576924583|gb|EUC38692.1| hypothetical protein COCCADRAFT_693 [Bipolaris zeicola 26-R-13] gi|576931755|gb|EUC45310.1| hypothetical protein COCMIDRAFT_26520 [Bipolaris oryzae ATCC 44560] gi|578494517|gb|EUN31903.1| hypothetical protein COCVIDRAFT_11889 [Bipolaris victoriae FI3] Length = 130 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLL +G++KVE K +TRVPNTA+FTFNKE Sbjct: 1 MNAPDRFELFLLDEGQEKVEEKAETRVPNTAVFTFNKE 38 >ref|XP_007702138.1| hypothetical protein COCSADRAFT_38897 [Bipolaris sorokiniana ND90Pr] gi|451848796|gb|EMD62101.1| hypothetical protein COCSADRAFT_38897 [Bipolaris sorokiniana ND90Pr] Length = 130 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLL +G++KVE K +TRVPNTA+FTFNKE Sbjct: 1 MNAPDRFELFLLDEGQEKVEEKAETRVPNTAVFTFNKE 38 >ref|XP_007681753.1| hypothetical protein BAUCODRAFT_127330 [Baudoinia panamericana UAMH 10762] gi|449295408|gb|EMC91430.1| hypothetical protein BAUCODRAFT_127330 [Baudoinia panamericana UAMH 10762] Length = 122 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLG+GEKKV + +TRVPN A+FTFNKE Sbjct: 1 MNAPDRFELFLLGEGEKKVTFEIETRVPNAALFTFNKE 38 >ref|XP_013340814.1| hypothetical protein AUEXF2481DRAFT_43083 [Aureobasidium subglaciale EXF-2481] gi|662534981|gb|KEQ92300.1| hypothetical protein AUEXF2481DRAFT_43083 [Aureobasidium subglaciale EXF-2481] Length = 122 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLLGDGEKKV +TRVP+ A+FTFNKE Sbjct: 1 MNAPDRFELFLLGDGEKKVTWAPETRVPDAAVFTFNKE 38 >gb|KIW72559.1| hypothetical protein, variant [Capronia semiimmersa] Length = 123 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 112 NAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 NAPDR E FLLGDGEKK+E K DTR PNT IFTFNKE Sbjct: 3 NAPDRTESFLLGDGEKKIEEKIDTRTPNTTIFTFNKE 39 >gb|KIV95337.1| hypothetical protein PV10_03006 [Exophiala mesophila] Length = 122 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDR E F+LGD EKK+E K DTR PNTAIFTFNKE Sbjct: 1 MNAPDRTESFVLGDNEKKIEEKIDTRTPNTAIFTFNKE 38 >gb|KIN03804.1| hypothetical protein OIDMADRAFT_18034 [Oidiodendron maius Zn] Length = 124 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFELFLL DGEKKV DTR PN++IFTFNKE Sbjct: 1 MNAPDRFELFLLADGEKKVTETADTRTPNSSIFTFNKE 38 >gb|KIW30393.1| hypothetical protein PV07_06138 [Cladophialophora immunda] Length = 122 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDR E FLLGD EKK+E K DTR PNT IFTFNKE Sbjct: 1 MNAPDRTEAFLLGDDEKKIEEKIDTRTPNTTIFTFNKE 38 >gb|KJX93014.1| DNA-directed RNA polymerase II subunit like protein [Zymoseptoria brevis] Length = 121 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFE FLL D EKKVE+ +TRVPN A+FTFNKE Sbjct: 1 MNAPDRFESFLLADNEKKVEVDPETRVPNAAMFTFNKE 38 >gb|KIV77912.1| hypothetical protein PV11_09684 [Exophiala sideris] Length = 125 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 +NAPDR E F+LG+GEKK+E K DTR PNT IFTFNKE Sbjct: 4 INAPDRTEAFILGEGEKKIEEKIDTRTPNTTIFTFNKE 41 >ref|XP_007781997.1| hypothetical protein W97_05926 [Coniosporium apollinis CBS 100218] gi|494830114|gb|EON66680.1| hypothetical protein W97_05926 [Coniosporium apollinis CBS 100218] Length = 147 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 112 NAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 N P+R+ELF+LGDGEKKV DTRVPNTAIFTFNKE Sbjct: 29 NYPERYELFILGDGEKKVTWVLDTRVPNTAIFTFNKE 65 >ref|XP_003850628.1| hypothetical protein MYCGRDRAFT_105083 [Zymoseptoria tritici IPO323] gi|339470507|gb|EGP85604.1| hypothetical protein MYCGRDRAFT_105083 [Zymoseptoria tritici IPO323] Length = 121 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 115 MNAPDRFELFLLGDGEKKVEMKHDTRVPNTAIFTFNKE 2 MNAPDRFE FLL D EKKVE+ +TRVPN A+FTFNKE Sbjct: 1 MNAPDRFESFLLADNEKKVEVDPETRVPNAAMFTFNKE 38