BLASTX nr result
ID: Ziziphus21_contig00047925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047925 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585587.1| hypothetical protein UCRNP2_6318 [Neofusicoc... 79 1e-12 gb|KKY20041.1| hypothetical protein UCDDS831_g05031 [Diplodia se... 77 4e-12 ref|XP_007780769.1| hypothetical protein W97_04690 [Coniosporium... 77 5e-12 ref|XP_013348225.1| hypothetical protein AUEXF2481DRAFT_45679 [A... 75 2e-11 gb|KEQ90016.1| DnaJ protein-like protein [Aureobasidium pullulan... 75 2e-11 gb|KEQ58931.1| DnaJ protein-like protein [Aureobasidium melanoge... 75 2e-11 dbj|GAD99603.1| DnaJ domain protein, putative [Byssochlamys spec... 75 2e-11 gb|KIN06387.1| hypothetical protein OIDMADRAFT_190535 [Oidiodend... 74 3e-11 emb|CRG90491.1| DnaJ-related protein SCJ1 [Talaromyces islandicus] 74 4e-11 ref|XP_002541314.1| conserved hypothetical protein [Uncinocarpus... 74 5e-11 gb|KKY25498.1| hypothetical protein UCRPC4_g01762 [Phaeomoniella... 73 7e-11 gb|KMU85431.1| chaperone protein dnaJ [Coccidioides immitis H538.4] 72 1e-10 gb|EEH07720.1| conserved hypothetical protein [Histoplasma capsu... 72 1e-10 gb|EFW15653.1| DnaJ domain-containing protein [Coccidioides posa... 72 1e-10 ref|XP_003066224.1| DnaJ domain containing protein [Coccidioides... 72 1e-10 gb|EER45879.1| DnaJ domain-containing protein [Histoplasma capsu... 72 1e-10 gb|EEQ83387.1| DnaJ domain-containing protein [Blastomyces derma... 72 1e-10 ref|XP_002621512.1| DnaJ domain-containing protein [Blastomyces ... 72 1e-10 ref|XP_001537950.1| conserved hypothetical protein [Histoplasma ... 72 1e-10 ref|XP_001247100.1| DnaJ domain-containing protein [Coccidioides... 72 1e-10 >ref|XP_007585587.1| hypothetical protein UCRNP2_6318 [Neofusicoccum parvum UCRNP2] gi|485921152|gb|EOD46946.1| hypothetical protein UCRNP2_6318 [Neofusicoccum parvum UCRNP2] Length = 410 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNPD 1 CVEDYYKLLGL+K ASDREIKKAYR+LSKKYHPDKNPD Sbjct: 19 CVEDYYKLLGLEKSASDREIKKAYRSLSKKYHPDKNPD 56 >gb|KKY20041.1| hypothetical protein UCDDS831_g05031 [Diplodia seriata] Length = 410 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNPD 1 C EDYYKLLGL+K ASDREIKKAYR+LSKKYHPDKNPD Sbjct: 19 CAEDYYKLLGLEKNASDREIKKAYRSLSKKYHPDKNPD 56 >ref|XP_007780769.1| hypothetical protein W97_04690 [Coniosporium apollinis CBS 100218] gi|494828667|gb|EON65452.1| hypothetical protein W97_04690 [Coniosporium apollinis CBS 100218] Length = 413 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNPD 1 C EDYY+LLGLDK ASDREIKKAYRTLSKKYHPDKNP+ Sbjct: 18 CAEDYYQLLGLDKSASDREIKKAYRTLSKKYHPDKNPN 55 >ref|XP_013348225.1| hypothetical protein AUEXF2481DRAFT_45679 [Aureobasidium subglaciale EXF-2481] gi|662542151|gb|KEQ99449.1| hypothetical protein AUEXF2481DRAFT_45679 [Aureobasidium subglaciale EXF-2481] Length = 412 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYKLLG++K ASDRE+KKAYRTLSKKYHPDKNP Sbjct: 19 CAEDYYKLLGIEKNASDRELKKAYRTLSKKYHPDKNP 55 >gb|KEQ90016.1| DnaJ protein-like protein [Aureobasidium pullulans EXF-150] Length = 412 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYKLLG++K ASDRE+KKAYRTLSKKYHPDKNP Sbjct: 19 CAEDYYKLLGIEKSASDRELKKAYRTLSKKYHPDKNP 55 >gb|KEQ58931.1| DnaJ protein-like protein [Aureobasidium melanogenum CBS 110374] Length = 412 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYKLLG+DK AS+RE+KKAYRTLSKKYHPDKNP Sbjct: 19 CAEDYYKLLGIDKNASERELKKAYRTLSKKYHPDKNP 55 >dbj|GAD99603.1| DnaJ domain protein, putative [Byssochlamys spectabilis No. 5] Length = 417 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LGLDK AS+R+IKKAYRTLSKKYHPDKNP Sbjct: 21 CAEDYYKILGLDKSASERDIKKAYRTLSKKYHPDKNP 57 >gb|KIN06387.1| hypothetical protein OIDMADRAFT_190535 [Oidiodendron maius Zn] Length = 417 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNPD 1 C ED+YKLLG+DK ASDREIK+AYRTLSKKYHPDKNP+ Sbjct: 19 CAEDFYKLLGIDKQASDREIKRAYRTLSKKYHPDKNPN 56 >emb|CRG90491.1| DnaJ-related protein SCJ1 [Talaromyces islandicus] Length = 420 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LG+DK ASDR+IK+AYRTLSKKYHPDKNP Sbjct: 21 CAEDYYKILGVDKSASDRDIKRAYRTLSKKYHPDKNP 57 >ref|XP_002541314.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237901580|gb|EEP75981.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 413 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LGLDK AS+R+IK+AYRTLSKKYHPDKNP Sbjct: 21 CAEDYYKILGLDKSASERDIKRAYRTLSKKYHPDKNP 57 >gb|KKY25498.1| hypothetical protein UCRPC4_g01762 [Phaeomoniella chlamydospora] Length = 431 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYKLLGLDK SDR+IK+AY+TLSKKYHPDKNP Sbjct: 19 CAEDYYKLLGLDKSCSDRDIKRAYKTLSKKYHPDKNP 55 >gb|KMU85431.1| chaperone protein dnaJ [Coccidioides immitis H538.4] Length = 411 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LG+DK AS+R+IK+AYRTLSKKYHPDKNP Sbjct: 21 CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNP 57 >gb|EEH07720.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] Length = 415 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYY++LGLD+ ASDR+IKKAYRTLSKK+HPDKNP Sbjct: 21 CAEDYYRILGLDRSASDRDIKKAYRTLSKKFHPDKNP 57 >gb|EFW15653.1| DnaJ domain-containing protein [Coccidioides posadasii str. Silveira] Length = 413 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LG+DK AS+R+IK+AYRTLSKKYHPDKNP Sbjct: 22 CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNP 58 >ref|XP_003066224.1| DnaJ domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|240105886|gb|EER24079.1| DnaJ domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|855530122|gb|KMM65657.1| chaperone protein dnaJ [Coccidioides posadasii RMSCC 3488] gi|859405491|gb|KMP00766.1| chaperone protein dnaJ [Coccidioides immitis RMSCC 2394] gi|875281847|gb|KMU75574.1| chaperone protein dnaJ [Coccidioides immitis RMSCC 3703] Length = 413 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LG+DK AS+R+IK+AYRTLSKKYHPDKNP Sbjct: 22 CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNP 58 >gb|EER45879.1| DnaJ domain-containing protein [Histoplasma capsulatum H143] gi|325088510|gb|EGC41820.1| DnaJ domain-containing protein [Histoplasma capsulatum H88] Length = 415 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYY++LGLD+ ASDR+IKKAYRTLSKK+HPDKNP Sbjct: 21 CAEDYYRILGLDRSASDRDIKKAYRTLSKKFHPDKNP 57 >gb|EEQ83387.1| DnaJ domain-containing protein [Blastomyces dermatitidis ER-3] gi|327353024|gb|EGE81881.1| DnaJ domain-containing protein [Blastomyces dermatitidis ATCC 18188] gi|531985337|gb|EQL35924.1| hypothetical protein BDFG_02525 [Blastomyces dermatitidis ATCC 26199] Length = 415 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LGLD+ ASDR+IK+AYRTLSKK+HPDKNP Sbjct: 21 CAEDYYKILGLDRSASDRDIKRAYRTLSKKFHPDKNP 57 >ref|XP_002621512.1| DnaJ domain-containing protein [Blastomyces gilchristii SLH14081] gi|239591340|gb|EEQ73921.1| DnaJ domain-containing protein [Blastomyces gilchristii SLH14081] Length = 415 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LGLD+ ASDR+IK+AYRTLSKK+HPDKNP Sbjct: 21 CAEDYYKILGLDRSASDRDIKRAYRTLSKKFHPDKNP 57 >ref|XP_001537950.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|150415558|gb|EDN10911.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] Length = 415 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYY++LGLD+ ASDR+IKKAYRTLSKK+HPDKNP Sbjct: 21 CAEDYYRILGLDRSASDRDIKKAYRTLSKKFHPDKNP 57 >ref|XP_001247100.1| DnaJ domain-containing protein [Coccidioides immitis RS] gi|767015711|gb|EAS35517.3| DnaJ domain-containing protein [Coccidioides immitis RS] Length = 413 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 114 CVEDYYKLLGLDKGASDREIKKAYRTLSKKYHPDKNP 4 C EDYYK+LG+DK AS+R+IK+AYRTLSKKYHPDKNP Sbjct: 22 CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNP 58