BLASTX nr result
ID: Ziziphus21_contig00047882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047882 (566 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13722.1| hypothetical protein MPH_09188 [Macrophomina phas... 70 9e-10 ref|XP_007585017.1| putative transcription factor jumonji aspart... 68 3e-09 gb|EKG09583.1| Transcription factor jumonji/aspartyl beta-hydrox... 63 1e-07 >gb|EKG13722.1| hypothetical protein MPH_09188 [Macrophomina phaseolina MS6] Length = 567 Score = 69.7 bits (169), Expect = 9e-10 Identities = 34/70 (48%), Positives = 46/70 (65%) Frame = -2 Query: 211 SVRRPTTMQQSDIERWSKCVLRTAKHRGFNAEAVLTAFYNAPPDQPIVKVLRTLQCICEV 32 +++ P + DI RW C+L A GF+ VL AF NAP D+PI VLRTLQC+CEV Sbjct: 218 TIQGPAYLSLRDIHRWKSCILACAAANGFDENRVLEAFENAP-DKPIEDVLRTLQCMCEV 276 Query: 31 ANIPLLLQLR 2 A+ +L+QL+ Sbjct: 277 ASSNILIQLK 286 >ref|XP_007585017.1| putative transcription factor jumonji aspartyl beta-hydroxylase protein [Neofusicoccum parvum UCRNP2] gi|485921892|gb|EOD47505.1| putative transcription factor jumonji aspartyl beta-hydroxylase protein [Neofusicoccum parvum UCRNP2] Length = 603 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 181 SDIERWSKCVLRTAKHRGFNAEAVLTAFYNAPPDQPIVK 65 S I RWS CVL TA+HRGFNAEAVL AF+NAP DQPIVK Sbjct: 456 SGISRWSDCVLHTARHRGFNAEAVLKAFHNAPEDQPIVK 494 >gb|EKG09583.1| Transcription factor jumonji/aspartyl beta-hydroxylase [Macrophomina phaseolina MS6] Length = 1372 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/61 (40%), Positives = 44/61 (72%) Frame = -2 Query: 184 QSDIERWSKCVLRTAKHRGFNAEAVLTAFYNAPPDQPIVKVLRTLQCICEVANIPLLLQL 5 +S+ +RW +C+LR A+ GF + +L +F AP +QP+ K+++ LQ ICEVA+ +LL++ Sbjct: 941 ESEAQRWEQCLLRAAEEGGFYPQGILESFRRAPQNQPLHKIVKVLQYICEVASAEILLEI 1000 Query: 4 R 2 + Sbjct: 1001 K 1001