BLASTX nr result
ID: Ziziphus21_contig00047846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047846 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10470.1| hypothetical protein MPH_12328 [Macrophomina phas... 124 4e-26 ref|XP_007587506.1| hypothetical protein UCRNP2_8261 [Neofusicoc... 121 2e-25 gb|KKY17677.1| hypothetical protein UCDDS831_g06269 [Diplodia se... 111 2e-22 >gb|EKG10470.1| hypothetical protein MPH_12328 [Macrophomina phaseolina MS6] Length = 368 Score = 124 bits (310), Expect = 4e-26 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = -3 Query: 288 FCTGDLEAQFETVTVPDRSLSLNSTVEIDATNTTIIGSAPVRGVCYMQPGGLVCEDRLRV 109 FCTGDLEAQFET PDRS+SLNSTVE++ATN TIIG+AP+RGVCYMQPGGLVCEDRLRV Sbjct: 302 FCTGDLEAQFETTVTPDRSISLNSTVELNATNVTIIGTAPIRGVCYMQPGGLVCEDRLRV 361 Query: 108 QVSQAIA 88 QVSQAIA Sbjct: 362 QVSQAIA 368 >ref|XP_007587506.1| hypothetical protein UCRNP2_8261 [Neofusicoccum parvum UCRNP2] gi|485918343|gb|EOD45020.1| hypothetical protein UCRNP2_8261 [Neofusicoccum parvum UCRNP2] Length = 283 Score = 121 bits (304), Expect = 2e-25 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = -3 Query: 288 FCTGDLEAQFETVTVPDRSLSLNSTVEIDATNTTIIGSAPVRGVCYMQPGGLVCEDRLRV 109 FCTG+LE QFET VPDRS+S+NSTVE+DATNTT+IG+AP+RGVCYMQPGGLVC DRLRV Sbjct: 217 FCTGELEVQFETTVVPDRSISVNSTVELDATNTTVIGTAPIRGVCYMQPGGLVCLDRLRV 276 Query: 108 QVSQAIA 88 QVSQAIA Sbjct: 277 QVSQAIA 283 >gb|KKY17677.1| hypothetical protein UCDDS831_g06269 [Diplodia seriata] Length = 280 Score = 111 bits (278), Expect = 2e-22 Identities = 48/67 (71%), Positives = 61/67 (91%) Frame = -3 Query: 288 FCTGDLEAQFETVTVPDRSLSLNSTVEIDATNTTIIGSAPVRGVCYMQPGGLVCEDRLRV 109 FCTGDL+ ++T VP+RS+SLNSTV++D TNTT++G+AP+RGVCY+QPGGLVCEDRLRV Sbjct: 214 FCTGDLDVNWDTAVVPERSISLNSTVDLDGTNTTLVGTAPIRGVCYIQPGGLVCEDRLRV 273 Query: 108 QVSQAIA 88 QVS+A A Sbjct: 274 QVSEATA 280