BLASTX nr result
ID: Ziziphus21_contig00047818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047818 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG22046.1| hypothetical protein MPH_00637 [Macrophomina phas... 68 3e-09 ref|XP_007583509.1| hypothetical protein UCRNP2_4225 [Neofusicoc... 67 7e-09 gb|KKY26007.1| hypothetical protein UCDDS831_g01517 [Diplodia se... 66 1e-08 >gb|EKG22046.1| hypothetical protein MPH_00637 [Macrophomina phaseolina MS6] Length = 399 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 93 QRVQLLSITNGPNESWLPLLSWDKERASKLP 1 QRVQLLSITNGPNESWLPLLSWDKERASKLP Sbjct: 44 QRVQLLSITNGPNESWLPLLSWDKERASKLP 74 >ref|XP_007583509.1| hypothetical protein UCRNP2_4225 [Neofusicoccum parvum UCRNP2] gi|485924146|gb|EOD49053.1| hypothetical protein UCRNP2_4225 [Neofusicoccum parvum UCRNP2] Length = 396 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 93 QRVQLLSITNGPNESWLPLLSWDKERASKLP 1 QRVQLLSITNGPNESWLPLLSWD+ERASKLP Sbjct: 44 QRVQLLSITNGPNESWLPLLSWDRERASKLP 74 >gb|KKY26007.1| hypothetical protein UCDDS831_g01517 [Diplodia seriata] Length = 392 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 93 QRVQLLSITNGPNESWLPLLSWDKERASKLP 1 QRVQLLS TNGPNESWLPLLSWDKERASKLP Sbjct: 44 QRVQLLSATNGPNESWLPLLSWDKERASKLP 74