BLASTX nr result
ID: Ziziphus21_contig00047701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047701 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG11080.1| hypothetical protein MPH_11823 [Macrophomina phas... 92 2e-16 >gb|EKG11080.1| hypothetical protein MPH_11823 [Macrophomina phaseolina MS6] Length = 698 Score = 91.7 bits (226), Expect = 2e-16 Identities = 47/85 (55%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Frame = +1 Query: 31 PLHTLQXXXXXXXXHPTAEQ---HSHRWPPQTVKYPAXXXXXXXXFRLHRPSHYLTRQTS 201 PL L P A + H + PPQT+K A FRLHRPSHYL RQ+S Sbjct: 2 PLRKLDAKRRGIYLKPAASEANLHGYSRPPQTIKLAASASKSTSSFRLHRPSHYLLRQSS 61 Query: 202 APDEMDLSRPKVPVVITFSVPGTQP 276 AP+EMDLSRPKVPV ITFSVPGT+P Sbjct: 62 APEEMDLSRPKVPVTITFSVPGTRP 86