BLASTX nr result
ID: Ziziphus21_contig00047691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047691 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG14978.1| hypothetical protein MPH_07878 [Macrophomina phas... 87 6e-15 >gb|EKG14978.1| hypothetical protein MPH_07878 [Macrophomina phaseolina MS6] Length = 208 Score = 86.7 bits (213), Expect = 6e-15 Identities = 44/57 (77%), Positives = 46/57 (80%), Gaps = 2/57 (3%) Frame = +3 Query: 228 AAHCDFEVALR--GHGSEMTTRRRAGGVPCSRKMGYGLPEVPQLRLRTLVRRKSLDS 392 A C + LR GHGSEMT RRRAGGVPCSRKMGYGLPEVPQLR RTLVRRKSL + Sbjct: 25 ATSCTASLPLRCEGHGSEMTVRRRAGGVPCSRKMGYGLPEVPQLRPRTLVRRKSLST 81